HHsearch alignment of GI: 254781041 and MMDB domain: 2h88_C_27-140

>2h88_C (C:27-140) Succinate dehydrogenase cytochrome B, large subunit; complex II, membrane protein, heme protein, iron sulfur protein, oxidoreductase, redox enzyme; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 2h89_C* 1yq3_C* 1yq4_C* 2fbw_C*
Probab=100.00  E-value=1.9e-35  Score=212.53  Aligned_cols=111  Identities=20%  Similarity=0.295  Sum_probs=106.3

Q ss_pred             CCEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHH--HCCCHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             35102666599999999999999999999999999985163035546753--0683169999999999999999989999
Q gi|254781041|r   14 LQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCY--MDGSVFEVCLFLYTWAVIHHMLGGIRYL   91 (129)
Q Consensus        14 L~iyk~~~t~~~SI~HRitGi~l~~~~~~~~~~l~~~~~~~~~~~~~~~~--~~~~~~k~~~~~~~~~~~yH~~nGiRHL   91 (129)
                      |||||||+||++||+||+||++++++++++.+++.....+||+|+.+...  .++++++++++++++|+.||++||+||+
T Consensus         1 L~iYk~~lt~~~SI~HRiTG~~L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~yH~~nGiRHL   80 (114)
T 2h88_C            1 ISIYKWSLPMAMSITHRGTGVALSLGVSLFSLAALLLPEQFPHYVAVVKSLSLSPALIYSAKFALVFPLSYHTWNGIRHL   80 (114)
T ss_dssp             TTTSCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCSSCHHHHHHHHHHTCCCHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             CCEECCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             46134238899999999999999999999999999852566889988863002319999999999999999999879999


Q ss_pred             HHHCCHHCCHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             985212335899999999999999999999999
Q gi|254781041|r   92 IWDVSLCLDKKIATQMAKINIIASILTVLIVWI  124 (129)
Q Consensus        92 ~wD~g~g~~~~~~~~s~~~vl~~sil~~~~~~~  124 (129)
                      +||+|+|+|++++++++++++++|++.++.+|.
T Consensus        81 ~wD~g~g~~~~~~~~tg~~v~~~s~~~t~~~~~  113 (114)
T 2h88_C           81 VWDMGKGFKLSQVEQSGVVVLILTLLSSAAIAS  113 (114)
T ss_dssp             HHHTTCCCSHHHHHHHHHHHHHHHHHHHHHHHT
T ss_pred             HHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             996104776999999999999999999999980