BLAST/PSIBLAST alignment of GI: 254781041 and GI: 315122380 at iteration 1
>gi|315122380|ref|YP_004062869.1| succinate dehydrogenase protein, cytochrome b subunit [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 129
>gi|313495782|gb|ADR52381.1| succinate dehydrogenase protein, cytochrome b subunit [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 129
 Score =  182 bits (462), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 83/128 (64%), Positives = 101/128 (78%)

Query: 1   MSSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSL 60
           MS +K+NRPLSPHLQIY+LIPTM +SIVHRITGS VY GTP +V WFF +A G++TL   
Sbjct: 1   MSDLKSNRPLSPHLQIYKLIPTMLISIVHRITGSAVYFGTPALVLWFFAVAEGKYTLGLW 60

Query: 61  RCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVL 120
           R Y D   F + LFLYTW+ IHHMLGGIRYL+WD S  L+KK++  MAKINIIASI  V 
Sbjct: 61  RSYTDCGFFSIFLFLYTWSAIHHMLGGIRYLMWDSSFLLEKKVSITMAKINIIASIFIVS 120

Query: 121 IVWIIKDI 128
           ++WI+K+I
Sbjct: 121 VIWIVKNI 128