BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254781041|ref|YP_003065454.1| succinate dehydrogenase protein, cytochrome b subunit [Candidatus Liberibacter asiaticus str. psy62] (129 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254781041|ref|YP_003065454.1| succinate dehydrogenase protein, cytochrome b subunit [Candidatus Liberibacter asiaticus str. psy62] Length = 129 Score = 262 bits (670), Expect = 1e-72, Method: Compositional matrix adjust. Identities = 129/129 (100%), Positives = 129/129 (100%) Query: 1 MSSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSL 60 MSSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSL Sbjct: 1 MSSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSL 60 Query: 61 RCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVL 120 RCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVL Sbjct: 61 RCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVL 120 Query: 121 IVWIIKDIV 129 IVWIIKDIV Sbjct: 121 IVWIIKDIV 129 >gi|254780404|ref|YP_003064817.1| inositol monophosphatase family protein [Candidatus Liberibacter asiaticus str. psy62] Length = 286 Score = 23.9 bits (50), Expect = 1.1, Method: Compositional matrix adjust. Identities = 9/21 (42%), Positives = 13/21 (61%) Query: 79 AVIHHMLGGIRYLIWDVSLCL 99 +++H M GG+ L W LCL Sbjct: 2 SMLHGMFGGMNLLYWYKKLCL 22 >gi|255764486|ref|YP_003065119.2| ABC transporter, membrane spanning protein [Candidatus Liberibacter asiaticus str. psy62] Length = 493 Score = 23.1 bits (48), Expect = 1.8, Method: Compositional matrix adjust. Identities = 13/46 (28%), Positives = 23/46 (50%), Gaps = 2/46 (4%) Query: 21 PTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDG 66 P +++ IT +V G P +V+ FF ++ L + YM+G Sbjct: 287 PKKLRAVIKPITEMLV--GIPTIVYGFFALSLVGPFLRDISIYMNG 330 >gi|254780280|ref|YP_003064693.1| glucokinase [Candidatus Liberibacter asiaticus str. psy62] Length = 348 Score = 21.6 bits (44), Expect = 4.8, Method: Compositional matrix adjust. Identities = 11/29 (37%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Query: 11 SPHLQIYRLIPTMFVSIVH-RITGSVVYL 38 SPH ++ R IPT ++ + I G V Y+ Sbjct: 299 SPHKELMRQIPTYVITNPYIAIAGMVSYI 327 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.333 0.144 0.468 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 86,094 Number of Sequences: 1233 Number of extensions: 3313 Number of successful extensions: 8 Number of sequences better than 100.0: 7 Number of HSP's better than 100.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 3 Number of HSP's gapped (non-prelim): 7 length of query: 129 length of database: 328,796 effective HSP length: 65 effective length of query: 64 effective length of database: 248,651 effective search space: 15913664 effective search space used: 15913664 T: 11 A: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (22.0 bits) S2: 33 (17.3 bits)