RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254781042|ref|YP_003065455.1| succinate dehydrogenase hydrophobic membrane anchor [Candidatus Liberibacter asiaticus str. psy62] (130 letters) >gnl|CDD|163091 TIGR02968, succ_dehyd_anc, succinate dehydrogenase, hydrophobic membrane anchor protein. In E. coli and many other bacteria, two small, hydrophobic, mutually homologous subunits of succinate dehydrogenase, a TCA cycle enzyme, are SdhC and SdhD. This family is the SdhD, the hydrophobic membrane anchor protein. SdhC is apocytochrome b558, which also plays a role in anchoring the complex. Length = 105 Score = 82.6 bits (205), Expect = 3e-17 Identities = 25/105 (23%), Positives = 52/105 (49%) Query: 18 AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISI 77 A+ G ++ QR TA+ + IF I F + YE ++ ++ + L +++ Sbjct: 1 ARSGLRDWLLQRVTAVVLALYTIFLIGFLLALPGLTYEAWRALFAHPWMKIFTLLALLAL 60 Query: 78 SVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLL 122 H +GM+V++EDY+ L+++ + F++ +I+ F L Sbjct: 61 LYHAWIGMRVVLEDYVKPEGLRLVLQVLIILFLVAYLIWGAFILW 105 >gnl|CDD|181901 PRK09488, sdhD, succinate dehydrogenase cytochrome b556 small membrane subunit; Provisional. Length = 115 Score = 32.4 bits (74), Expect = 0.036 Identities = 28/95 (29%), Positives = 43/95 (45%), Gaps = 8/95 (8%) Query: 7 SSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAV 66 S+LGR +G FI R TAI +II+ + FF G+ YE ++ Sbjct: 6 SALGR--------NGVHDFILVRATAIVLTLYIIYMVGFFATSGELTYEVWRGFFASAFT 57 Query: 67 ASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIM 101 L SI +H +GM ++ DY+ L++M Sbjct: 58 KVFTLLALFSILIHAWIGMWQVLTDYVKPLALRLM 92 >gnl|CDD|150427 pfam09752, DUF2048, Uncharacterized conserved protein (DUF2048). The proteins in this family are conserved from plants to vertebrates. The function is unknown. Length = 337 Score = 28.1 bits (63), Expect = 0.63 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 4/42 (9%) Query: 35 NIPFIIFFIAFFIKYGD-APYEQIVSVLSNVAVASIMGLGTI 75 I II F YG P Q S L NV+ +MG TI Sbjct: 119 GIGSIILENPF---YGLRRPKGQRRSSLRNVSDLFLMGAATI 157 >gnl|CDD|180919 PRK07282, PRK07282, acetolactate synthase catalytic subunit; Reviewed. Length = 566 Score = 27.9 bits (62), Expect = 0.90 Identities = 9/20 (45%), Positives = 14/20 (70%) Query: 66 VASIMGLGTISISVHMQLGM 85 V +++G GTI+ S + LGM Sbjct: 242 VTTLLGQGTIATSHPLFLGM 261 >gnl|CDD|149152 pfam07916, TraG_N, TraG-like protein, N-terminal region. The bacterial sequences found in this family are similar to the N-terminal region of the TraG protein. This is a membrane-spanning protein, with three predicted transmembrane segments and two periplasmic regions. TraG protein is known to be essential for DNA transfer in the process of conjugation, with the N-terminal portion being required for F pilus assembly. The protein is thought to interact with the periplasmic domain of TraN to stabilize mating-cell interactions. Length = 462 Score = 27.7 bits (62), Expect = 0.97 Identities = 13/57 (22%), Positives = 26/57 (45%), Gaps = 5/57 (8%) Query: 65 AVASIMGLGTISISVHMQLGMQVIIE--DYIHYRLLKIMFLFMNSCFVLLLIIFCLF 119 A+A+ GLG + + + V+ E D + L+ + ++ V LL++ L Sbjct: 17 AIAAFTGLGAFPGLIRIAAWLGVLAEGIDEGNKGDLRRIENWL---LVALLVVMFLL 70 >gnl|CDD|180099 PRK05462, PRK05462, S-adenosylmethionine decarboxylase; Provisional. Length = 266 Score = 26.0 bits (58), Expect = 2.9 Identities = 10/25 (40%), Positives = 12/25 (48%) Query: 11 RVRGMGSAKDGTGHFIKQRFTAIAN 35 RVRG +G HFI +I N Sbjct: 168 RVRGFTRDINGKKHFIDHEINSIQN 192 >gnl|CDD|173557 PTZ00364, PTZ00364, dipeptidyl-peptidase I precursor; Provisional. Length = 548 Score = 25.6 bits (56), Expect = 3.6 Identities = 7/24 (29%), Positives = 14/24 (58%) Query: 107 SCFVLLLIIFCLFSLLKIAILGTL 130 S +L+ I+ + L+ I+I+G Sbjct: 478 STIILMAILLLVAGLISISIIGLY 501 >gnl|CDD|178106 PLN02488, PLN02488, probable pectinesterase/pectinesterase inhibitor. Length = 509 Score = 24.6 bits (53), Expect = 8.1 Identities = 20/62 (32%), Positives = 30/62 (48%), Gaps = 14/62 (22%) Query: 18 AKDGTGHFIKQRFTAIANIP------FIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMG 71 AKDG+G + AIA P F+I +IK G Y++IV + S +++G Sbjct: 202 AKDGSGKY-NTVNAAIAAAPEHSRKRFVI-----YIKTG--VYDEIVRIGSTKPNLTLIG 253 Query: 72 LG 73 G Sbjct: 254 DG 255 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.337 0.149 0.436 Gapped Lambda K H 0.267 0.0744 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 2,113,470 Number of extensions: 128798 Number of successful extensions: 707 Number of sequences better than 10.0: 1 Number of HSP's gapped: 705 Number of HSP's successfully gapped: 80 Length of query: 130 Length of database: 5,994,473 Length adjustment: 83 Effective length of query: 47 Effective length of database: 4,201,009 Effective search space: 197447423 Effective search space used: 197447423 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (21.7 bits) S2: 51 (23.4 bits)