HHsearch alignment for GI: 254781043 and conserved domain: COG0562

>COG0562 Glf UDP-galactopyranose mutase [Cell envelope biogenesis, outer membrane].
Probab=97.84  E-value=3e-05  Score=52.91  Aligned_cols=49  Identities=24%  Similarity=0.276  Sum_probs=40.6

Q ss_pred             EECEEEECCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHC---CCCEEE
Q ss_conf             1058898996899999999998898299998689885210411---653425
Q gi|254781043|r   17 SYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAA---QGGIAA   65 (611)
Q Consensus        17 ~~DVlVIG~G~AGl~AAi~A~e~G~~V~lieK~~~~~g~s~~A---~GGi~a   65 (611)
T Consensus         1 ~fd~lIVGaGlsG~V~A~~a~~~gk~VLIvekR~HIGGNaYde~d~~tGIlv   52 (374)
T COG0562           1 MFDYLIVGAGLSGAVIAEVAAQLGKRVLIVEKRNHIGGNAYDEADDQTGILV   52 (374)
T ss_pred             CCCEEEECCCHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCCCCCCCCCEEE
T ss_conf             9758998776268899999997598799996256678754343477777588