HHsearch alignment for GI: 254781043 and conserved domain: COG2509

>COG2509 Uncharacterized FAD-dependent dehydrogenases [General function prediction only].
Probab=99.22  E-value=1.3e-09  Score=81.38  Aligned_cols=63  Identities=27%  Similarity=0.346  Sum_probs=50.8

Q ss_pred             CHHHHHHHHHHHHHCCCEEECCCEEEEEEECCCCCCEEEEEEEECCCEEEEECCCCEEEECCCCCCCCC
Q ss_conf             266789999998731230311315652000134430124689805870899506724741576565433
Q gi|254781043|r  153 GHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYF  221 (611)
Q Consensus       153 G~~i~~~L~~~~~~~gv~i~~~~~~~~Li~d~dG~V~Gav~~~~~~G~~~~i~AkaVILATGG~~~ly~  221 (611)
T Consensus       172 l~~vvkni~~~l~~~G~ei~f~t~VeDi~~~-~~~~~~v~---~~~g~--~i~~~~vvlA~Grsg~dw~  234 (486)
T COG2509         172 LPKVVKNIREYLESLGGEIRFNTEVEDIEIE-DNEVLGVK---LTKGE--EIEADYVVLAPGRSGRDWF  234 (486)
T ss_pred             HHHHHHHHHHHHHHCCCEEEEEEEEEEEEEC-CCCEEEEE---CCCCC--EEECCEEEECCCCCHHHHH
T ss_conf             6999999999998558289952078899815-87079999---25784--8732779990476467899