HHsearch alignment for GI: 254781043 and conserved domain: KOG0405

>KOG0405 consensus.
Probab=98.27  E-value=6.3e-06  Score=57.36  Aligned_cols=147  Identities=21%  Similarity=0.353  Sum_probs=78.2

Q ss_pred             EEEECEEEECCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHCCCCEEEECCCCCCCCHHHHHHHHHHHCCCCCCHHH
Q ss_conf             23105889899689999999999889829999868988521041165342513789999999999989984588779999
Q gi|254781043|r   15 DHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLANMTPDSWQWHLYDTIKGSDWLGDVDA   94 (611)
Q Consensus        15 d~~~DVlVIG~G~AGl~AAi~A~e~G~~V~lieK~~~~~g~s~~A~GGi~a~~~~~~~Ds~~~~~~Dt~~~g~~l~d~~l   94 (611)
T Consensus        18 ~k~fDylvIGgGSGGvasARrAa~~GAkv~l~E~~f~l-GGTC--------Vn~GCVPKK--------------------   68 (478)
T KOG0405          18 VKDFDYLVIGGGSGGVASARRAASHGAKVALCELPFGL-GGTC--------VNVGCVPKK--------------------   68 (478)
T ss_pred             CCCCCEEEECCCCCHHHHHHHHHHCCCEEEEEECCCCC-CCEE--------EEECCCCCE--------------------
T ss_conf             44236699847861367767787538537998637786-7447--------860456413--------------------


Q ss_pred             HHHHHHHHHHHHHHHHHCCCCCCCCCCCCEEEECCCCCCCCCCCCCCCCEEEEECCCCCHHHHHHHHHHHH-HCCCEEEC
Q ss_conf             99999988999999998699813279985510014641145678765640798666542667899999987-31230311
Q gi|254781043|r   95 IQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQAL-KNNAEFFI  173 (611)
Q Consensus        95 v~~~~~~a~~~i~~Le~~Gv~f~r~~~G~~~~~~~gg~~~~~~~g~~~~R~~~~~d~tG~~i~~~L~~~~~-~~gv~i~~  173 (611)
T Consensus        69 vm~~~a~~~~~~~da~~yG~~~~--~~~~fdW~~i-----------k~krdayi------~RLngIY~~~L~k~~V~~i~  129 (478)
T KOG0405          69 VMWYAADYSEEMEDAKDYGFPIN--EEGSFDWKVI-----------KQKRDAYI------LRLNGIYKRNLAKAAVKLIE  129 (478)
T ss_pred             EEEEHHHHHHHHHHHHHCCCCCC--CCCCCCHHHH-----------HHHHHHHH------HHHHHHHHHHCCCCCEEEEE
T ss_conf             67744455677545664298534--4467767998-----------75116899------98878988542315406996


Q ss_pred             CCEEEEEEECCCCCCEEEEEEEECCCEEEEECCCCEEEECCCCC
Q ss_conf             31565200013443012468980587089950672474157656
Q gi|254781043|r  174 EYFALDLIINSEGCCVGVVAWQLETGEIHRFSAKLVVLATGGYG  217 (611)
Q Consensus       174 ~~~~~~Li~d~dG~V~Gav~~~~~~G~~~~i~AkaVILATGG~~  217 (611)
T Consensus       130 G~a~--f-~~-~~~v----~V~~~d~~~~~Ytak~iLIAtGg~p  165 (478)
T KOG0405         130 GRAR--F-VS-PGEV----EVEVNDGTKIVYTAKHILIATGGRP  165 (478)
T ss_pred             EEEE--E-CC-CCCE----EEEECCCEEEEEECCEEEEEECCCC
T ss_conf             2678--7-58-9944----7995388157872140899737846