HHsearch alignment for GI: 254781043 and conserved domain: KOG2844

>KOG2844 consensus.
Probab=98.13  E-value=0.00019  Score=47.61  Aligned_cols=186  Identities=20%  Similarity=0.149  Sum_probs=91.4

Q ss_pred             EEECEEEECCCHHHHHHHHHHHHCCCCEEEE-ECCCCCCCCCHHCCCCEEEECCCCCCCCH-HHHHHHHH------HHCC
Q ss_conf             3105889899689999999999889829999-86898852104116534251378999999-99999899------8458
Q gi|254781043|r   16 HSYDVVVVGAGGAGLRATLGMAEKGFKTACI-TKVFPTRSHTVAAQGGIAASLANMTPDSW-QWHLYDTI------KGSD   87 (611)
Q Consensus        16 ~~~DVlVIG~G~AGl~AAi~A~e~G~~V~li-eK~~~~~g~s~~A~GGi~a~~~~~~~Ds~-~~~~~Dt~------~~g~   87 (611)
T Consensus        38 ~~A~vvViggG~~g~~~~yhlak~g~k~avlle~~~ltsgttwhtag-l~~~l--r~~dv~~qlia~~~~~l~~~leeEt  114 (856)
T KOG2844          38 STADVVVIGGGSLGCSTAYHLAKRGMKGAVLLERSRLTSGTTWHTAG-LLWQL--FPSDVELQLIAHTSRVLYRELEEET  114 (856)
T ss_pred             CCCCEEEECCCCHHHHHHHHHHHCCCCCEEEEEEEEECCCCCCCCCC-CEEEC--CCCCHHHHHHHHHHHHHHHHHHHHC
T ss_conf             86557998578504789999997146524787641103665633301-03203--6896039998878899999999861


Q ss_pred             CCC---CHHHHHHHHHHHHHH---HHHHHHCCCCCCCCCCCCE----EEECCCCCCCCCCCCCCCCEEEEE-CCC--CCH
Q ss_conf             877---999999999988999---9999986998132799855----100146411456787656407986-665--426
Q gi|254781043|r   88 WLG---DVDAIQYLAMEAPQS---VYELEHYGVPFSRNEAGKI----YQRPFGGHMQNYGEGPPVQRTCAA-ADR--TGH  154 (611)
Q Consensus        88 ~l~---d~~lv~~~~~~a~~~---i~~Le~~Gv~f~r~~~G~~----~~~~~gg~~~~~~~g~~~~R~~~~-~d~--tG~  154 (611)
T Consensus       115 gl~tGwiq~-G~~~lAs~~~R~de~kR~~S~g~a~g~-e~~lLsPee~~~~~pL-----Ln~d~v~g~Ly~P~DG~~DP~  187 (856)
T KOG2844         115 GLHTGWIQN-GGIFLASNRQRLDEYKRLMSRGKAHGV-ESELLSPEETQELFPL-----LNVDDVYGGLYSPGDGVMDPA  187 (856)
T ss_pred             CCCCCEECC-CCEEEECCHHHHHHHHHHHHHHHHCCC-EEEECCHHHHHHHCCC-----CCHHHHEEEEECCCCCCCCHH
T ss_conf             997632427-816870477789999999976433153-1055389999886756-----566674012035887644889


Q ss_pred             HHHHHHHHHHHHCCCEEECCCEEEEEEECCCCCCEEEEEEEECCCEEEEECCCCEEEECCCCCC
Q ss_conf             6789999998731230311315652000134430124689805870899506724741576565
Q gi|254781043|r  155 AILHTLYGQALKNNAEFFIEYFALDLIINSEGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGR  218 (611)
Q Consensus       155 ~i~~~L~~~~~~~gv~i~~~~~~~~Li~d~dG~V~Gav~~~~~~G~~~~i~AkaVILATGG~~~  218 (611)
T Consensus       188 ~lC~ala~~A~~~GA~viE~cpV~~i~~~~~-~~~gVe---T~~G---~iet~~~VNaaGvWAr  244 (856)
T KOG2844         188 GLCQALARAASALGALVIENCPVTGLHVETD-KFGGVE---TPHG---SIETECVVNAAGVWAR  244 (856)
T ss_pred             HHHHHHHHHHHHCCCEEEECCCCCEEEEECC-CCCCEE---CCCC---CEECCEEEECHHHHHH
T ss_conf             9999999999853847981487425775037-755430---4676---4443527852227798