HHsearch alignment for GI: 254781043 and conserved domain: PRK05249

>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional.
Probab=96.72  E-value=0.037  Score=32.71  Aligned_cols=50  Identities=18%  Similarity=0.253  Sum_probs=30.7

Q ss_pred             HHHHHHHCCCEEECCCEEEEEEECCCCCCEEEEEEEECCCEEEEECCCCEEEECCCCC
Q ss_conf             9999873123031131565200013443012468980587089950672474157656
Q gi|254781043|r  160 LYGQALKNNAEFFIEYFALDLIINSEGCCVGVVAWQLETGEIHRFSAKLVVLATGGYG  217 (611)
Q Consensus       160 L~~~~~~~gv~i~~~~~~~~Li~d~dG~V~Gav~~~~~~G~~~~i~AkaVILATGG~~  217 (611)
T Consensus       101 ~~~~l~~~gv~~i~G~a--~f-~~~-~~v----~V~~~dg~~~~i~a~~iIIATGs~p  150 (465)
T PRK05249        101 RRGFYARNRVEVIQGRA--SF-VDP-HTV----EVECPDGSVETLTAEKIVIATGSRP  150 (465)
T ss_pred             HHHHHHHCCCEEEEEEE--EE-CCC-CCE----EEECCCCCEEEEEEEEEEEECCCCC
T ss_conf             99999868978998478--97-279-840----4434899628998427999537524