HHsearch alignment for GI: 254781043 and conserved domain: PRK06185

>PRK06185 hypothetical protein; Provisional.
Probab=99.25  E-value=4e-10  Score=84.82  Aligned_cols=162  Identities=19%  Similarity=0.184  Sum_probs=89.3

Q ss_pred             EEEEECEEEECCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHCCCCEEEECCCCCCCCHHHHHHHHHHHCCCCCCHH
Q ss_conf             32310588989968999999999988982999986898852104116534251378999999999998998458877999
Q gi|254781043|r   14 VDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLANMTPDSWQWHLYDTIKGSDWLGDVD   93 (611)
Q Consensus        14 ~d~~~DVlVIG~G~AGl~AAi~A~e~G~~V~lieK~~~~~g~s~~A~GGi~a~~~~~~~Ds~~~~~~Dt~~~g~~l~d~~   93 (611)
T Consensus         3 ~~~~tDV~IVGaGpaGL~lAl~Lar~Gi~V~VlEk~~~~~~~~---R-g~~--i---~p~tl~-----iL~~-lGl~---   64 (409)
T PRK06185          3 MVETTDCCIVGGGPAGMMLGLLLARAGVDVTVLEKHADFLRDF---R-GDT--V---HPSTLE-----LMDE-LGLL---   64 (409)
T ss_pred             CCCCCCEEEECCCHHHHHHHHHHHHCCCCEEEECCCCCCCCCC---E-EEE--E---CHHHHH-----HHHH-CCCH---
T ss_conf             8878998999918899999999997799999991899987786---1-898--7---899999-----9998-7986---


Q ss_pred             HHHHHHHHHHHHHHHHHHCCCC----CCCCCCCCE-EEECCCCCCCCCCCCCCCCEEEEECCCCCHHHHHHHHHHHHH-C
Q ss_conf             9999999889999999986998----132799855-100146411456787656407986665426678999999873-1
Q gi|254781043|r   94 AIQYLAMEAPQSVYELEHYGVP----FSRNEAGKI-YQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALK-N  167 (611)
Q Consensus        94 lv~~~~~~a~~~i~~Le~~Gv~----f~r~~~G~~-~~~~~gg~~~~~~~g~~~~R~~~~~d~tG~~i~~~L~~~~~~-~  167 (611)
T Consensus        65 -------------~~l~~~~~~~~~~~~~~~~g~~~~~~d~~-~l-----~~~~~~~~~~---~q~~ll~~L~~~a~~~~  122 (409)
T PRK06185         65 -------------ERFLELPHSKVRTLRFDIGGRTVTLADFS-RL-----PTRYPYIAMM---PQWDFLDFLAEKASRYP  122 (409)
T ss_pred             -------------HHHHHCCCCCEEEEEEEECCEEEEEECCC-CC-----CCCCCCEEEC---CHHHHHHHHHHHHHCCC
T ss_conf             -------------89973678733479999599389974300-16-----8888842770---18999999999985189


Q ss_pred             CCEEECCCEEEEEEECCCCCCEEEEEEEECCCEEEEECCCCEEEECCCCCC
Q ss_conf             230311315652000134430124689805870899506724741576565
Q gi|254781043|r  168 NAEFFIEYFALDLIINSEGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGR  218 (611)
Q Consensus       168 gv~i~~~~~~~~Li~d~dG~V~Gav~~~~~~G~~~~i~AkaVILATGG~~~  218 (611)
T Consensus       123 ~~~l~~~~~v~~l~~d-~~~v~gV~~~~-~dg~~-~i~adlvVGADG~~S~  170 (409)
T PRK06185        123 TFTLRMGAEVTGLIEE-GGRVAGVRYRT-PDGEL-EIRADLTVGADGRHSR  170 (409)
T ss_pred             CCEEEECCEEEEEEEE-CCCEEEEEEEC-CCCCE-EEEEEEEEECCCCCCH
T ss_conf             9599968888999995-99089999984-89858-9997299973899847