HHsearch alignment for GI: 254781043 and conserved domain: PRK07057

>PRK07057 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed.
Probab=100.00  E-value=0  Score=1164.81  Aligned_cols=584  Identities=53%  Similarity=0.895  Sum_probs=549.0

Q ss_pred             EEEEEECEEEECCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHCCCCEEEECCCCCCCCHHHHHHHHHHHCCCCCCH
Q ss_conf             33231058898996899999999998898299998689885210411653425137899999999999899845887799
Q gi|254781043|r   13 YVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLANMTPDSWQWHLYDTIKGSDWLGDV   92 (611)
Q Consensus        13 ~~d~~~DVlVIG~G~AGl~AAi~A~e~G~~V~lieK~~~~~g~s~~A~GGi~a~~~~~~~Ds~~~~~~Dt~~~g~~l~d~   92 (611)
T Consensus         8 ~~~~~~DVlVIGsG~AGl~AA~~a~~~G~~V~li~K~~~~~s~s~~A~GGi~a~~~~~~~Ds~~~h~~DTl~~g~~l~d~   87 (591)
T PRK07057          8 LPRRKFDVVIVGAGGSGMRASLQLARAGLSVAVLSKVFPTRSHTVAAQGGIGASLGNMSEDNWHFHFYDTIKGSDWLGDQ   87 (591)
T ss_pred             CCCCCCCEEEECCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCHHHHHHHHEEECCCCCCCCHHHHHHHHHHHCCCCCCH
T ss_conf             87447788999966999999999987699589997889999747887423525258999999899999999861677789


Q ss_pred             HHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCEEEECCCCCCCCCCCCCCCCEEEEECCCCCHHHHHHHHHHHHHCCCEEE
Q ss_conf             99999999889999999986998132799855100146411456787656407986665426678999999873123031
Q gi|254781043|r   93 DAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFF  172 (611)
Q Consensus        93 ~lv~~~~~~a~~~i~~Le~~Gv~f~r~~~G~~~~~~~gg~~~~~~~g~~~~R~~~~~d~tG~~i~~~L~~~~~~~gv~i~  172 (611)
T Consensus        88 ~~v~~l~~~a~~~i~~L~~~Gv~f~r~~dg~~~~r~~gGhs~~~g-~~~~~r~~~~~d~tG~~i~~~l~~~~~~~~v~~~  166 (591)
T PRK07057         88 DAIEFMCREAPNVVYELEHFGMPFDRNADGTIYQRPFGGHTANYG-EKPVQRACAAADRTGHALLHTLYQQNVAAKTQFF  166 (591)
T ss_pred             HHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCEEECCCCCCCCCCC-CCCCCEEEECCCCCCHHHHHHHHHHHHHCCCEEE
T ss_conf             999999998999999999869941017998782135677104456-7864245531677549999999999985298899


Q ss_pred             CCCEEEEEEECCCCCCEEEEEEEECCCEEEEECCCCEEEECCCCCCCCCCCCCCCEECCHHHHHHHHHCCCCCCCCCCCC
Q ss_conf             13156520001344301246898058708995067247415765654334210640144488788751365333322232
Q gi|254781043|r  173 IEYFALDLIINSEGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDMEFVQF  252 (611)
Q Consensus       173 ~~~~~~~Li~d~dG~V~Gav~~~~~~G~~~~i~AkaVILATGG~~~ly~~~t~~~~~tGdG~~mA~~aGa~l~~mEf~qf  252 (611)
T Consensus       167 ~~~~~~~ll~~~~G~v~Ga~~~~~~~g~~~~~~AkaVIlATGG~g~ly~~ttn~~~~TGdG~amA~raGA~l~dmEfiQf  246 (591)
T PRK07057        167 VEWMALDLIRDADGDVLGVTALEMETGDVYILEAKTTLFATGGAGRIFAASTNAFINTGDGLGMAARAGIPLQDMEFWQF  246 (591)
T ss_pred             EEEEEEEEEECCCCEEEEEEEEECCCCCEEEEEEEEEEECCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCHHHEE
T ss_conf             97789999874799699999997579909999833699878887666666679888560999999984997259256423


Q ss_pred             CCCCCCCCEEECCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCEEHHHHHHHHHHCCCCCCCCCEEEEEECCCCHHH
Q ss_conf             88844220143045665578089832686125540765100475201115688998817888888874688611179899
Q gi|254781043|r  253 HPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEIREGRGVGKSKDHIHLYLNHLDPAV  332 (611)
Q Consensus       253 hPt~~~~~~~l~~~~~rg~G~~l~n~~Gerf~~~y~~~~~el~~rd~~s~ai~~ei~~g~g~~~~~~~v~ld~~~~~~~~  332 (611)
T Consensus       247 hPt~~~~~~~Lise~~rg~G~~l~n~~GerFm~~y~p~~~elaprd~v~rai~~e~~~g~g~~~~~~~v~ld~~~~~~e~  326 (591)
T PRK07057        247 HPTGVAGAGVLITEGVRGEGGILRNKDGERFMERYAPTLKDLAPRDFVSRSMDQEIKEGRGCGPNKDHVLLDLSHIGAET  326 (591)
T ss_pred             CCCCCCCCCCCCCHHHCCCCCEEECCCCCCCHHHCCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCEEECHHCCCCHHH
T ss_conf             14433687712047551489700367997954440750012004889999999999855787888761000030389999


Q ss_pred             HHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCCCCCCCCCCCEEECCCCCCCCCCCCCEEECCCCCCCCCCCCCCCCC
Q ss_conf             99985379999976436786544067520331001234215771585377888533227603402122033566430476
Q gi|254781043|r  333 LQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGS  412 (611)
Q Consensus       333 l~~~~~~~~~~~~~~~g~D~~~~~i~v~p~~hy~~GGi~vd~~g~v~~~~~~~~~t~i~GLyAaGe~a~~g~hGanrlgg  412 (611)
T Consensus       327 ~~~~~~~~~~~~~~~~~iD~~~~~i~v~P~~Hy~mGGi~id~~g~v~~~~-~~~~~~I~GLyAaGEva~~G~HGANRLgg  405 (591)
T PRK07057        327 IMKRLPSIREIALKFANVDCIKEPIPVVPTIHYQMGGIPTNIHGQVVGTS-RDHKEPVNGFYAIGECSCVSVHGANRLGT  405 (591)
T ss_pred             HHHHHHHHHHHHHHHCCCCCCCCCEEEECCCCEECCCEEECCCCEEEECC-CCCCCCCCCEEECCCCCCCCCCCCCCCCC
T ss_conf             97553699999998517776347654213444761788857874386337-77786317746432234678765534433


Q ss_pred             CCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHCCCEEEECHHHHHH
Q ss_conf             43222222321567755665420265667640023578886310103788713689998788766509726875899999
Q gi|254781043|r  413 NSLIDLVVFGRAAVIRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQDSLSD  492 (611)
Q Consensus       413 nsl~~~~vfG~~Ag~~aa~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~i~~~Lq~iM~~~~gi~R~~~~L~~  492 (611)
T Consensus       406 nsL~e~~VfG~~Ag~~aa~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~lq~~m~~~~gi~R~~~~L~~  485 (591)
T PRK07057        406 NSLLDLVVFGRAAGNHIVDHVKKQHEHKPLPADAADFSLARLAKLDKSTSGEYTQDVANDIRATMQKHAGVFRTSALLDE  485 (591)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHCCEEECHHHHHH
T ss_conf             03889998899999999998761676689983367889998887764468988899999999999851578776999999


Q ss_pred             HHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCEECCCCCCCCCCCCCCHHHCEEE
Q ss_conf             99999999999841515787754588999999888899999999999962625504623533778876668803213569
Q gi|254781043|r  493 GCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRGSHAREDFKDGEFGGRDDVNWRKHS  572 (611)
Q Consensus       493 al~~L~~l~~~~~~i~~~d~~~~~n~el~~~~el~~~l~~Ae~~~~aal~R~ESRG~H~R~DyPe~~~~~rDD~nwl~h~  572 (611)
T Consensus       486 al~~l~~l~~~~~~~~~~d~~~~~n~~~~~~lEl~n~l~~a~~i~~aAl~R~ESRG~H~R~DyPe-----rdD~nwlkht  560 (591)
T PRK07057        486 GVEQILGLKERVENIHLKDKSKVFNTARVEALEVANLIEVARATMVSAAARKESRGAHAHSDYEH-----RDDENWLKHT  560 (591)
T ss_pred             HHHHHHHHHHHHHHCCCCCCCCHHCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCC-----CCCCCCCEEE
T ss_conf             99999999999972785885400156779999999999999999999861554742236778887-----8571505578


Q ss_pred             EEEEECCCCEEEEEEECCCCCCCCCCCCEEECCCCCCCC
Q ss_conf             999846898059999447444256755000027721679
Q gi|254781043|r  573 LCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPKARVY  611 (611)
Q Consensus       573 ~~~~~~~~g~~~~~~~Pv~~~~~~~~~~~~~~~p~~R~Y  611 (611)
T Consensus       561 ~~~~~~~--~--~~~~~v~~----~~~~~~~~~p~~r~y  591 (591)
T PRK07057        561 LWYSEGD--R--LDYKPVQM----KPLTVESVPPKARTF  591 (591)
T ss_pred             EEEECCC--C--CCCCCCEE----CCEEEEEECCCCCCC
T ss_conf             8997799--6--56665230----231777789834779