HHsearch alignment for GI: 254781043 and conserved domain: PRK07121

>PRK07121 hypothetical protein; Validated.
Probab=100.00  E-value=0  Score=506.76  Aligned_cols=404  Identities=25%  Similarity=0.259  Sum_probs=286.3

Q ss_pred             EEEEEECEEEECCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHCCCCEEEEC------CCCCCCCHHHHHHHHHHHC
Q ss_conf             3323105889899689999999999889829999868988521041165342513------7899999999999899845
Q gi|254781043|r   13 YVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASL------ANMTPDSWQWHLYDTIKGS   86 (611)
Q Consensus        13 ~~d~~~DVlVIG~G~AGl~AAi~A~e~G~~V~lieK~~~~~g~s~~A~GGi~a~~------~~~~~Ds~~~~~~Dt~~~g   86 (611)
T Consensus        16 ~wd~e~DVvVVGsG~AGl~AA~~Aae~Ga~VivlEK~~~~GG~s~~sgG~~~~~~~t~~q~~~g~~Ds~e~~~~~~~~~~   95 (491)
T PRK07121         16 SWDDEADVVVVGFGAAGACAAVEAAAAGARVLVLERAAGAGGATALSGGVIYLGGGTAVQKAAGFEDSPENMYAYLRVAV   95 (491)
T ss_pred             CCCCCCCEEEECCCHHHHHHHHHHHHCCCCEEEEECCCCCCCHHHHHCCCEEECCCCHHHHHHCCCCCHHHHHHHHHHHH
T ss_conf             66687698998967999999999998899289995489999508883777260799999997389999999999999970


Q ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCEEEEC-------CCCCCCC---CCCCCCCCEEE---EECCC-C
Q ss_conf             887799999999998899999999869981327998551001-------4641145---67876564079---86665-4
Q gi|254781043|r   87 DWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRP-------FGGHMQN---YGEGPPVQRTC---AAADR-T  152 (611)
Q Consensus        87 ~~l~d~~lv~~~~~~a~~~i~~Le~~Gv~f~r~~~G~~~~~~-------~gg~~~~---~~~g~~~~R~~---~~~d~-t  152 (611)
T Consensus        96 ~~~~d~~l~~~~~~~s~~~i~wL~~~Gv~f~~~~~~~~~~~~~~~~~l~~~g~~~~~~~~~~~~~~pr~h~~~~~g~~~~  175 (491)
T PRK07121         96 GDGVDEEKIRRYCEGSVEHFDWLEGLGVPFERSYFPEKTSYPPNDEGLYYSGNEKVWPFAEHAKPAPRGHRVQGPGDTGG  175 (491)
T ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEECCCCCCCC
T ss_conf             89999999999997229999999974997455657765535677754202585223321013576676653214787764


Q ss_pred             CHHHHHHHHHHHHHCCCEEECCCEEEEEEECCCCCCEEEEEEEECCCEEEEECC-CCEEEECCCCCCC------C-----
Q ss_conf             266789999998731230311315652000134430124689805870899506-7247415765654------3-----
Q gi|254781043|r  153 GHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCCVGVVAWQLETGEIHRFSA-KLVVLATGGYGRA------Y-----  220 (611)
Q Consensus       153 G~~i~~~L~~~~~~~gv~i~~~~~~~~Li~d~dG~V~Gav~~~~~~G~~~~i~A-kaVILATGG~~~l------y-----  220 (611)
T Consensus       176 g~~l~~~l~~~~~~~gv~i~~~t~~~~Li~d~~G~V~Gv~~~--~~~~~~~i~A~k~VILAtGGf~~n~~m~~~~~p~~~  253 (491)
T PRK07121        176 GAMLMDPLAKRAAALGVQIRYETRATRLIVDGDGRVVGVRAR--RFGETGAIRARKGVVLAAGGFAMNRDMVARYAPRYA  253 (491)
T ss_pred             HHHHHHHHHHHHHHCCCEEEECCEEEEEEECCCCCEEEEEEE--ECCCEEEEEECCCEEECCCCCCCCHHHHHHHCCCCC
T ss_conf             999999999999857987996779999999799988999999--789169998147279846996876999997582334


Q ss_pred             -CCCCCCCEECCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCEEECCCCCCCCCEEEEECCCCCCCCCCCCC--CCCCC--
Q ss_conf             -3421064014448878875136533332223288844220143045665578089832686125540765--10047--
Q gi|254781043|r  221 -FSATSAHTCTGDGAGMVARAGLPLQDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPS--AKDLA--  295 (611)
Q Consensus       221 -~~~t~~~~~tGdG~~mA~~aGa~l~~mEf~qfhPt~~~~~~~l~~~~~rg~G~~l~n~~Gerf~~~y~~~--~~el~--  295 (611)
T Consensus       254 ~~~~~~~~~~tGdGi~ma~~aGA~l~~m~~~~~~~~-~~~~~~~-------~~gi~Vn~~G~RF~nE~~~~~~~~~~~~~  325 (491)
T PRK07121        254 GGLPLGTTGDDGSGIRLGQSAGGATAHMDQVFAWRF-IYPPSAL-------LRGILVNKRGQRFVAEDSYGARIGHFILE  325 (491)
T ss_pred             CCCCCCCCCCCCHHHHHHHHCCCCCCCCCCCCCCCC-CCCCCCC-------CCCEEECCCCCCCCCCCCCHHHHHHHHHH
T ss_conf             786678999973799999982997027866000256-5783003-------66269999998667676626789999984


Q ss_pred             CCCEEH-----HHHHHHHHHCCCCC---CCCCEEEEE-E------CCCCHHHHHHHHHHHHHHHHHHCCCCC--CCC---
Q ss_conf             520111-----56889988178888---888746886-1------117989999985379999976436786--544---
Q gi|254781043|r  296 SRDVVS-----RCMMMEIREGRGVG---KSKDHIHLY-L------NHLDPAVLQERLPGISESARIFAGVDV--TRD---  355 (611)
Q Consensus       296 ~rd~~s-----~ai~~ei~~g~g~~---~~~~~v~ld-~------~~~~~~~l~~~~~~~~~~~~~~~g~D~--~~~---  355 (611)
T Consensus       326 ~~~~~~~~i~D~~~~~~~~~~~~~~~~~~~~~~~~adtleeLA~~~gid~~~l~~tv~~yN~~~~~--G~D~~fgk~~~~  403 (491)
T PRK07121        326 QPGGTAYLIVDAALFREARAQLRPQIDGFTPGARKAETIEELARELGIPPGALAATVDAYNRAAAR--GEDPLFHKQPEW  403 (491)
T ss_pred             CCCCEEEEEECHHHHHHHHHHCCHHHHHHCCCCEECCCHHHHHHHHCCCHHHHHHHHHHHHHHHHC--CCCCCCCCCCCC
T ss_conf             889739999778998532431221455413562214889999988497979999999999999862--999755788532


Q ss_pred             --E--------EEEEC----CCCCCCCCCCCCCCCEEECCCCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             --0--------67520----331001234215771585377888533227603402122033566430476432222223
Q gi|254781043|r  356 --P--------IPVIP----TVHYNMGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVF  421 (611)
Q Consensus       356 --~--------i~v~p----~~hy~~GGi~vd~~g~v~~~~~~~~~t~i~GLyAaGe~a~~g~hGanrlggnsl~~~~vf  421 (611)
T Consensus       404 l~pi~~~Pfyav~~~~~~~~~~~~T~GGl~id~~~qVld~~g~----~IpGLYAaGe~a-gg~~g~~yl~G~sl~~~~vf  478 (491)
T PRK07121        404 LAPLDTGPFYALDLSVGTSMFPGFTLGGLRVDEDGEVLRADGA----PIPGLYAAGRCA-VGIASNGYVSGLSLADCSFS  478 (491)
T ss_pred             CCCCCCCCEEEEEEECCCCCCCCEECCCCEECCCCCEECCCCC----EECCEEECCCCC-CCCCCCCCCHHHHHHHHHHH
T ss_conf             2515679847999624754654461568009978857889989----809976675265-68887876468889999999


Q ss_pred             CHHHHHHHHHHH
Q ss_conf             215677556654
Q gi|254781043|r  422 GRAAVIRASEMI  433 (611)
Q Consensus       422 G~~Ag~~aa~~~  433 (611)
T Consensus       479 GriAG~~AA~~a  490 (491)
T PRK07121        479 GRRAGRHAAARA  490 (491)
T ss_pred             HHHHHHHHHHHC
T ss_conf             999999999734