HHsearch alignment for GI: 254781043 and conserved domain: PRK07251

>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional.
Probab=92.08  E-value=0.28  Score=26.98  Aligned_cols=49  Identities=12%  Similarity=0.229  Sum_probs=26.8

Q ss_pred             HHHHHCCCEEECCCEEEEEEECCCCCCEEEEEEEECCCEEEEECCCCEEEECCCCCCC
Q ss_conf             9987312303113156520001344301246898058708995067247415765654
Q gi|254781043|r  162 GQALKNNAEFFIEYFALDLIINSEGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRA  219 (611)
Q Consensus       162 ~~~~~~gv~i~~~~~~~~Li~d~dG~V~Gav~~~~~~G~~~~i~AkaVILATGG~~~l  219 (611)
T Consensus        84 ~~~~~~gv~~~~g~a--~~-~~-~-~~v~V~----~~~~~~~~~a~~iIIATGs~p~~  132 (438)
T PRK07251         84 AMLAGTGVDIYDAEA--HF-VS-N-KVIEVT----AGDEKQELTAETIVINTGAVSNV  132 (438)
T ss_pred             HHHHHCCCEEEEEEE--EE-CC-C-CEEEEE----CCCCEEEEEEEEEEECCCCCCCC
T ss_conf             999748948999799--98-16-8-489995----59972999976898726787866