HHsearch alignment for GI: 254781043 and conserved domain: PRK07573

>PRK07573 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed.
Probab=100.00  E-value=0  Score=1149.21  Aligned_cols=577  Identities=30%  Similarity=0.436  Sum_probs=520.9

Q ss_pred             CCCCCCCEEEEEECEEEECCCHHHHHHHHHHHHCCCCEEEEEC-CCCCCCCCHHCCCCEEEECCCC-CCCCHHHHHHHHH
Q ss_conf             0053441332310588989968999999999988982999986-8988521041165342513789-9999999999899
Q gi|254781043|r    6 NLKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITK-VFPTRSHTVAAQGGIAASLANM-TPDSWQWHLYDTI   83 (611)
Q Consensus         6 ~~~~~~~~~d~~~DVlVIG~G~AGl~AAi~A~e~G~~V~lieK-~~~~~g~s~~A~GGi~a~~~~~-~~Ds~~~~~~Dt~   83 (611)
T Consensus        22 ~~~~~~~~~~~~~DVlVIGsG~AGL~AAi~aa~~G~~V~vl~~~~~~~~snS~~AqGGInAa~~~~~~~DS~e~H~~DTl  101 (638)
T PRK07573         22 HLKLVNPANKRKFDIIVVGTGLAGASAAATLGELGYNVKVFCYQDSPRRAHSIAAQGGINAAKNYQNDGDSVYRLFYDTV  101 (638)
T ss_pred             CCCCCCCCCCCCCCEEEECCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCCHHHHHHHHHHHCCCCCCCCCHHHHHHHHH
T ss_conf             48556866466488899996699999999999749956999922899962088875556740468999989899999999


Q ss_pred             HHCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCEEEECCCCCCCCCCCCCCCCEEEEECCCCCHHHHH----H
Q ss_conf             845887799999999998899999999869981327998551001464114567876564079866654266789----9
Q gi|254781043|r   84 KGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILH----T  159 (611)
Q Consensus        84 ~~g~~l~d~~lv~~~~~~a~~~i~~Le~~Gv~f~r~~~G~~~~~~~gg~~~~~~~g~~~~R~~~~~d~tG~~i~~----~  159 (611)
T Consensus       102 kaG~gl~d~~~V~~l~~~ap~~I~~L~~~Gv~Fdr~~~g~l~~~~~GGhS--------~~Ri~ha~d~TG~~i~~~l~~~  173 (638)
T PRK07573        102 KGGDFRAREANVYRLAEVSVNIIDQCVAQGVPFAREYGGLLANRSFGGAQ--------VSRTFYARGQTGQQLLLGAYSA  173 (638)
T ss_pred             HHHCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCC--------CCEEEECCCCCHHHHHHHHHHH
T ss_conf             86278774999999999889999999975998756899866044566766--------5247732896168999999999


Q ss_pred             HHHHHHHCCCEEECCCEEEEEEECCCCCCEEEEEEEECCCEEEEECCCCEEEECCCCCCCCCCCCCCCEECCHHHHHHHH
Q ss_conf             99998731230311315652000134430124689805870899506724741576565433421064014448878875
Q gi|254781043|r  160 LYGQALKNNAEFFIEYFALDLIINSEGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVAR  239 (611)
Q Consensus       160 L~~~~~~~gv~i~~~~~~~~Li~d~dG~V~Gav~~~~~~G~~~~i~AkaVILATGG~~~ly~~~t~~~~~tGdG~~mA~~  239 (611)
T Consensus       174 L~~~~~~~~I~~~~~~~~~dLi~~-dg~~~Gv~~~d~~~G~~~~~~AkaVILATGG~g~ly~~TTN~~~atGDG~a~A~r  252 (638)
T PRK07573        174 LSRQIAAGTVELFTRTEMLDLVVV-DGRARGIVARNLVTGEIERHAADAVVLATGGYGNVFYLSTNAMGSNATAIWRAHK  252 (638)
T ss_pred             HHHHHHCCCCEEEECEEEEEEEEE-CCEEEEEEEEECCCCCEEEEECCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHH
T ss_conf             999873389889935799998998-9999999999658994899971679985785751212525899884799999998


Q ss_pred             HCCCCCCCCCCCCCCCCCCCCE------EECCCCCCCCCEEEEECCC--------------CCCCCCCCCCCCCCCCCCE
Q ss_conf             1365333322232888442201------4304566557808983268--------------6125540765100475201
Q gi|254781043|r  240 AGLPLQDMEFVQFHPTGIYGAG------CLITEGARGEGGYLVNSKG--------------ERFMERYAPSAKDLASRDV  299 (611)
Q Consensus       240 aGa~l~~mEf~qfhPt~~~~~~------~l~~~~~rg~G~~l~n~~G--------------erf~~~y~~~~~el~~rd~  299 (611)
T Consensus       253 aGA~l~dmEfvQfHPT~l~~~~~~~~~~~LisEavRGeGailv~~~~~d~~~~~~i~~~er~~fmer~yp~~geLapRDv  332 (638)
T PRK07573        253 KGAYFANPCFTQIHPTCIPVSGDYQSKLTLMSESLRNDGRIWVPKKKGDARKPNDIPEEERDYYLERRYPAFGNLVPRDV  332 (638)
T ss_pred             CCCCCCCCHHEEEECCCCCCCCCCCCCCEEEEHHHHCCCCEECCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCCCCHHHH
T ss_conf             69973584241674310057875455533654234145643125443332341114416777888762543355325389


Q ss_pred             EHHHHHHHHHHCCCCCCCCCEEEEEEC----CCCHHHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCCCCCCCCCC
Q ss_conf             115688998817888888874688611----1798999998537999997643678654406752033100123421577
Q gi|254781043|r  300 VSRCMMMEIREGRGVGKSKDHIHLYLN----HLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMGGIPTNYW  375 (611)
Q Consensus       300 ~s~ai~~ei~~g~g~~~~~~~v~ld~~----~~~~~~l~~~~~~~~~~~~~~~g~D~~~~~i~v~p~~hy~~GGi~vd~~  375 (611)
T Consensus       333 Vsrai~~ei~~Grg~~~~~~~V~LD~~~~i~~~~~~~i~~r~p~~~~~~~~~~g~D~~~~pIpV~PaaHy~MGGI~vD~~  412 (638)
T PRK07573        333 ASRAAKERCDAGRGVGPGGLAVYLDFADAIKRLGEDVIRERYGNLFEMYERITGEDPYKTPMRIYPAVHYTMGGLWVDYN  412 (638)
T ss_pred             HHHHHHHHHHHCCCCCCCCCEEECCHHHHHHHCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCHHCCCCCCCCC
T ss_conf             99999999986268689986443135777653288999998756999999983999545861252355600379668877


Q ss_pred             CEEECCCCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHH-HHHHHHHHHHCCCCCCC--C----CHHHH
Q ss_conf             15853778885332276034021220335664304764322222232156-77556654202656676--4----00235
Q gi|254781043|r  376 GEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAA-VIRASEMIDKSSPIPSL--D----ISSCD  448 (611)
Q Consensus       376 g~v~~~~~~~~~t~i~GLyAaGe~a~~g~hGanrlggnsl~~~~vfG~~A-g~~aa~~~~~~~~~~~~--~----~~~~~  448 (611)
T Consensus       413 ~~----------T~I~GLyAaGE~a~-gvHGANRLgsNSLlE~lVfG~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~  481 (638)
T PRK07573        413 LM----------STIPGLFVIGEANF-SDHGANRLGASALMQGLADGYFVLPYTIGNYLAGTIGTPKVSTDHPEFKEAEA  481 (638)
T ss_pred             CC----------CCCCCEEEEEECCC-CCCCCCCCHHHHHHHHHHHCCCCHHHHHHHHHHHCCCCCCCCCCCHHHHHHHH
T ss_conf             65----------52587188543475-76542120456699998726000024677887640245677767656788999


Q ss_pred             HHHHHHHCCCCCCCCCCHHHHHHHHHHHHHCCCEEEECHHHHHHHHHHHHHHHHHH-HCCCCCCCCCCCCHHHHHHHHHH
Q ss_conf             78886310103788713689998788766509726875899999999999999998-41515787754588999999888
Q gi|254781043|r  449 RIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQDSLSDGCRNLSCLWDEM-ADLKVHDRSLIWNSDLVETLELQ  527 (611)
Q Consensus       449 ~~~~~~~~~~~~~g~~~~~~i~~~Lq~iM~~~~gi~R~~~~L~~al~~L~~l~~~~-~~i~~~d~~~~~n~el~~~~el~  527 (611)
T Consensus       482 ~~~~~~~~l~~~~g~~~~~~ir~~L~~~M~~~vGI~R~~~~L~~al~~l~~l~~~~~~~~~v~~~~~~~N~~l~~alel~  561 (638)
T PRK07573        482 EVQDRIDRLLNINGKRTVDSFHRELGKIMWDYCGMARNEEGLKKALEKIPALREEFWKNVRVPGSGDELNQELEKAGRVA  561 (638)
T ss_pred             HHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHCCEEECHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHH
T ss_conf             99999998761589989899999999999852586777999999999999999999717714788521068999999999


Q ss_pred             HHHHHHHHHHHHHHCCCCCCCCEECCCCCCCC-CCCCCCHHHCEEEEEEEECCCCEEEEEEECCCCCCCCCCCCEEECCC
Q ss_conf             89999999999996262550462353377887-66688032135699998468980599994474442567550000277
Q gi|254781043|r  528 NLMINAIATVYSAEARKESRGSHAREDFKDGE-FGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAP  606 (611)
Q Consensus       528 ~~l~~Ae~~~~aal~R~ESRG~H~R~DyPe~~-~~~rDD~nwl~h~~~~~~~~~g~~~~~~~Pv~~~~~~~~~~~~~~~p  606 (611)
T Consensus       562 nml~vA~~i~~sAL~RkESRGaH~R~DyP~~D~~~~RdD~~~~~~~~~~~~~~~~~~~~~~~pv---------~~~~~~p  632 (638)
T PRK07573        562 DFLELGELMCRDALHREESCGGHFREEHQTEDGEALRDDENFAYVAAWEYKGEGKEPVLHKEPL---------EFENVHL  632 (638)
T ss_pred             HHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHEEEEECCCCCCCEEEECCC---------EEEEECC
T ss_conf             8999999999999846656564577456898887666616555333555548888731531571---------4666787


Q ss_pred             CCCCC
Q ss_conf             21679
Q gi|254781043|r  607 KARVY  611 (611)
Q Consensus       607 ~~R~Y  611 (611)
T Consensus       633 ~~R~Y  637 (638)
T PRK07573        633 AQRSY  637 (638)
T ss_pred             CCCCC
T ss_conf             35778