HHsearch alignment for GI: 254781043 and conserved domain: PRK08010

>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional.
Probab=90.84  E-value=0.51  Score=25.26  Aligned_cols=42  Identities=17%  Similarity=0.226  Sum_probs=24.5

Q ss_pred             CCCEEECCCEEEEEEECCCCCCEEEEEEEECCCEEEEECCCCEEEECCCCC
Q ss_conf             123031131565200013443012468980587089950672474157656
Q gi|254781043|r  167 NNAEFFIEYFALDLIINSEGCCVGVVAWQLETGEIHRFSAKLVVLATGGYG  217 (611)
Q Consensus       167 ~gv~i~~~~~~~~Li~d~dG~V~Gav~~~~~~G~~~~i~AkaVILATGG~~  217 (611)
T Consensus        90 ~~v~~i~G~a--~f-~~~-~~v~-V---~~~~g~-~~l~a~~ivIATGs~p  131 (441)
T PRK08010         90 PNIDVIDGQA--EF-INN-HSLR-V---HRPDGN-LEIHGEKIFINTGAQS  131 (441)
T ss_pred             CCCEEEEEEE--EE-CCC-CCEE-E---ECCCCC-EEEEEEEEEEECCCCC
T ss_conf             6958999899--98-579-8237-7---648998-9998258999337765