HHsearch alignment for GI: 254781043 and conserved domain: PRK08850

>PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated.
Probab=98.87  E-value=2.2e-07  Score=66.84  Aligned_cols=161  Identities=19%  Similarity=0.259  Sum_probs=79.5

Q ss_pred             EEEEECEEEECCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHCCCCEEEECCCCCCCCHHHHHHHHHHHCCCCCCHH
Q ss_conf             32310588989968999999999988982999986898852104116534251378999999999998998458877999
Q gi|254781043|r   14 VDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLANMTPDSWQWHLYDTIKGSDWLGDVD   93 (611)
Q Consensus        14 ~d~~~DVlVIG~G~AGl~AAi~A~e~G~~V~lieK~~~~~g~s~~A~GGi~a~~~~~~~Ds~~~~~~Dt~~~g~~l~d~~   93 (611)
T Consensus         1 M~~~~DV~IvGaGp~Gl~lA~~La~~G~~v~viE~~~~~~~~~~~~-d~R~~al~---~~s-~~~L~~l-----G~~-~~   69 (405)
T PRK08850          1 MMQSVDVAIIGGGMVGLALAAALKDSDLRIAVIEGQLPEEELNELP-DVRVSALS---RAS-EHILRNV-----GAW-QG   69 (405)
T ss_pred             CCCCCCEEEECCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCC-CCEEEEEC---HHH-HHHHHHC-----CCH-HH
T ss_conf             9998768999915899999999985899789993799863446789-86588878---999-9999987-----985-55


Q ss_pred             HHHHHHHHHHHHHHHHHHCCCCCC------CCCCCCEEEECCCCCCCCCCCCCCCCEEEEECCCCCHHHHHHHHHHHHH-
Q ss_conf             999999988999999998699813------2799855100146411456787656407986665426678999999873-
Q gi|254781043|r   94 AIQYLAMEAPQSVYELEHYGVPFS------RNEAGKIYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALK-  166 (611)
Q Consensus        94 lv~~~~~~a~~~i~~Le~~Gv~f~------r~~~G~~~~~~~gg~~~~~~~g~~~~R~~~~~d~tG~~i~~~L~~~~~~-  166 (611)
T Consensus        70 i~--------------~~~~~p~~~~~v~~~~~~~~i~---~~~------~~~~~~~lg~iv~--~~~l~~~L~~~~~~~  124 (405)
T PRK08850         70 IE--------------ARRAAPYTAMEVWEQDSFARIE---FDA------ESMAQPDLGHIVE--NRVIQLALLEQIQKQ  124 (405)
T ss_pred             HH--------------HHCCCCEEEEEEEECCCCCEEC---CCH------HHCCCCCCCHHHH--HHHHHHHHHHHHHCC
T ss_conf             67--------------6237851258998479874312---474------4417854212464--499999999999738


Q ss_pred             CCCEEECCCEEEEEEECCCCCCEEEEEEEECCCEEEEECCCCEEEECCCCC
Q ss_conf             123031131565200013443012468980587089950672474157656
Q gi|254781043|r  167 NNAEFFIEYFALDLIINSEGCCVGVVAWQLETGEIHRFSAKLVVLATGGYG  217 (611)
Q Consensus       167 ~gv~i~~~~~~~~Li~d~dG~V~Gav~~~~~~G~~~~i~AkaVILATGG~~  217 (611)
T Consensus       125 ~~v~~~~~~~~~~~~~~~~-~~---~-v~~~~g~--~i~a~llVgaDG~~S  168 (405)
T PRK08850        125 DNVTLLMPARCQSIAVGES-EA---W-LTLDNGQ--ALTAKLVVGADGANS  168 (405)
T ss_pred             CCCEEECCCEEEEEEECCC-CE---E-EEECCCC--EEEEEEEEEECCCCH
T ss_conf             9919973753556761797-15---9-9977998--887508999169873