HHsearch alignment for GI: 254781043 and conserved domain: PRK08958

>PRK08958 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed.
Probab=100.00  E-value=0  Score=1153.12  Aligned_cols=579  Identities=52%  Similarity=0.867  Sum_probs=546.1

Q ss_pred             EEECEEEECCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHCCCCEEEECCCCCCCCHHHHHHHHHHHCCCCCCHHHH
Q ss_conf             31058898996899999999998898299998689885210411653425137899999999999899845887799999
Q gi|254781043|r   16 HSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLANMTPDSWQWHLYDTIKGSDWLGDVDAI   95 (611)
Q Consensus        16 ~~~DVlVIG~G~AGl~AAi~A~e~G~~V~lieK~~~~~g~s~~A~GGi~a~~~~~~~Ds~~~~~~Dt~~~g~~l~d~~lv   95 (611)
T Consensus         6 ~e~DVlVIGsG~AGl~AAi~a~~~g~~V~lv~K~~~~~s~s~~A~GGi~~a~~~~~~Ds~e~h~~Dtlkag~~l~d~~~v   85 (588)
T PRK08958          6 REFDAVVIGAGGAGMRAALQISQSGQSCALLSKVFPTRSHTVSAQGGITVALGNTHEDNWEWHMYDTVKGSDYIGDQDAI   85 (588)
T ss_pred             CCCCEEEECCCHHHHHHHHHHHHCCCEEEEEECCCCCCCCCHHHHHHHEEECCCCCCCCHHHHHHHHHHHCCCCCCHHHH
T ss_conf             56798999954999999999987499389997889899861666310205037999999999999999963787889999


Q ss_pred             HHHHHHHHHHHHHHHHCCCCCCCCCCCCEEEECCCCCCCCCCCCCCCCEEEEECCCCCHHHHHHHHHHHHHCCCEEECCC
Q ss_conf             99999889999999986998132799855100146411456787656407986665426678999999873123031131
Q gi|254781043|r   96 QYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEY  175 (611)
Q Consensus        96 ~~~~~~a~~~i~~Le~~Gv~f~r~~~G~~~~~~~gg~~~~~~~g~~~~R~~~~~d~tG~~i~~~L~~~~~~~gv~i~~~~  175 (611)
T Consensus        86 ~~l~~~~~~~v~~L~~~Gv~f~r~~~G~~~~r~~gg~s~~~-gg~~~~R~~~~~d~tG~~i~~~L~~~~~~~~i~i~~~~  164 (588)
T PRK08958         86 EYMCKTGPEAILELEHMGLPFSRLDDGRIYQRPFGGQSKNF-GGEQAARTAAAADRTGHALLHTLYQQNLKNKTTIFSEW  164 (588)
T ss_pred             HHHHHHHHHHHHHHHHCCCCCCCCCCCCEEECCCCCCCCCC-CCCCCCEEEECCCCCCHHHHHHHHHHHHCCCCEEEEEE
T ss_conf             99999889999999986998614789975001368720002-77633247631576445888768999853598899968


Q ss_pred             EEEEEEECCCCCCEEEEEEEECCCEEEEECCCCEEEECCCCCCCCCCCCCCCEECCHHHHHHHHHCCCCCCCCCCCCCCC
Q ss_conf             56520001344301246898058708995067247415765654334210640144488788751365333322232888
Q gi|254781043|r  176 FALDLIINSEGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDMEFVQFHPT  255 (611)
Q Consensus       176 ~~~~Li~d~dG~V~Gav~~~~~~G~~~~i~AkaVILATGG~~~ly~~~t~~~~~tGdG~~mA~~aGa~l~~mEf~qfhPt  255 (611)
T Consensus       165 ~~~~li~~~~G~v~G~~~~~~~~g~~~~i~AkaVILATGG~g~ly~~ttn~~~~TGdG~amA~raGA~l~dmEfiQfhPT  244 (588)
T PRK08958        165 YALDLVKNQDGAVVGCTAICIETGEVVYFKARATVLATGGAGRIYQSTTNAHINTGDGVGMALRAGVPVQDMEMWQFHPT  244 (588)
T ss_pred             EEEEEEECCCCEEEEEEEEECCCCCEEEEEECEEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCCHHCEECC
T ss_conf             99999885899699999997789919999827699906986544545558999761999999985997368455202047


Q ss_pred             CCCCCEEECCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCEEHHHHHHHHHHCCCCCCC-CCEEEEEECCCCHHHHH
Q ss_conf             44220143045665578089832686125540765100475201115688998817888888-87468861117989999
Q gi|254781043|r  256 GIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEIREGRGVGKS-KDHIHLYLNHLDPAVLQ  334 (611)
Q Consensus       256 ~~~~~~~l~~~~~rg~G~~l~n~~Gerf~~~y~~~~~el~~rd~~s~ai~~ei~~g~g~~~~-~~~v~ld~~~~~~~~l~  334 (611)
T Consensus       245 ~~~~~~~Li~Ea~rgeG~~l~n~~GeRFm~~~~p~~~eLa~Rd~v~~ai~~ei~~g~g~~~~~~~~~~l~~~~~~~~~~~  324 (588)
T PRK08958        245 GIAGAGVLVTEGCRGEGGYLLNKHGERFMERYAPNAKDLAGRDVVARSIMIEIREGRGCDGPWGPHAKLKLDHLGKEVLE  324 (588)
T ss_pred             CCCCCCCCCCHHHCCCCCEEECCCCCEEHHHCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCEEEEEECCCCHHHHH
T ss_conf             20677731122103777578757871734222776312343006677779999855786677776379981103878898


Q ss_pred             HHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCCCCCCCCCCCEEECCCCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCC
Q ss_conf             98537999997643678654406752033100123421577158537788853322760340212203356643047643
Q gi|254781043|r  335 ERLPGISESARIFAGVDVTRDPIPVIPTVHYNMGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNS  414 (611)
Q Consensus       335 ~~~~~~~~~~~~~~g~D~~~~~i~v~p~~hy~~GGi~vd~~g~v~~~~~~~~~t~i~GLyAaGe~a~~g~hGanrlggns  414 (611)
T Consensus       325 ~~~p~~~~~~~~~~~iD~~~~~ipv~P~~Hy~mGGi~vd~~g~v~~~~~~~~~T~I~GLyAaGEva~~GvHGaNRLggns  404 (588)
T PRK08958        325 SRLPGILELSRTFAHVDPVKEPIPVIPTCHYMMGGIPTKVTGQALTVNEKGEDVVVPGLFAVGEIACVSVHGANRLGGNS  404 (588)
T ss_pred             HHHHHHHHHHHHHCCCCCCCCCCEEECCCCEEECCEECCCCCEEEECCCCCCCCCCCCCEECCCCCCCCCCCCCCCCHHH
T ss_conf             76147999999856978655863111467765478772566606631677766414754543542325556665430067


Q ss_pred             CCCCCCCCHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHCCCEEEECHHHHHHHH
Q ss_conf             22222232156775566542026566764002357888631010378871368999878876650972687589999999
Q gi|254781043|r  415 LIDLVVFGRAAVIRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQDSLSDGC  494 (611)
Q Consensus       415 l~~~~vfG~~Ag~~aa~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~i~~~Lq~iM~~~~gi~R~~~~L~~al  494 (611)
T Consensus       405 l~e~~VfG~~Ag~~aa~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~p~~i~~~lq~~m~~~~gi~R~~~~L~~al  484 (588)
T PRK08958        405 LLDLVVFGRAAGLHLQESLAEQGALRDASESDIEASLARLNRWNNNRNGEDPVQIRKDLQECMQNNFSVFREGDAMAKGL  484 (588)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHCCCEEECHHHHHHHH
T ss_conf             89999999999999999876157777877778999999875331267888989999999999984678898689999999


Q ss_pred             HHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCEECCCCCCCCCCCCCCHHHCEEEEE
Q ss_conf             99999999984151578775458899999988889999999999996262550462353377887666880321356999
Q gi|254781043|r  495 RNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRGSHAREDFKDGEFGGRDDVNWRKHSLC  574 (611)
Q Consensus       495 ~~L~~l~~~~~~i~~~d~~~~~n~el~~~~el~~~l~~Ae~~~~aal~R~ESRG~H~R~DyPe~~~~~rDD~nwl~h~~~  574 (611)
T Consensus       485 ~~l~~l~~~~~~~~~~~~~~~~n~~~~~~~El~n~l~~a~~~~~aAL~R~ESRG~H~R~DyP~-----rdD~~wl~ht~~  559 (588)
T PRK08958        485 EELKVIRERLKNARLDDTSSEFNTQRIECLELDNLMETAYATAVSANFRTESRGAHSRFDFPD-----RDDENWLCHSLY  559 (588)
T ss_pred             HHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCC-----CCCHHHCCEEEE
T ss_conf             999999999863756676421240079999999999999999999871523520041768899-----998312715889


Q ss_pred             EEECCCCEE---EEEEECCCCCCCCCCCCEEECCCCCCCC
Q ss_conf             984689805---9999447444256755000027721679
Q gi|254781043|r  575 WVDWNTGKI---KLDYRPVHTELLCGGVDYSKIAPKARVY  611 (611)
Q Consensus       575 ~~~~~~g~~---~~~~~Pv~~~~~~~~~~~~~~~p~~R~Y  611 (611)
T Consensus       560 ~--~~~~~~~~~~v~~~~~---------~~~~~~p~~r~y  588 (588)
T PRK08958        560 L--PETESMTRRSVNMEPK---------LREAFPPKIRTY  588 (588)
T ss_pred             E--CCCCCCCCCCEECCCC---------CCCCCCCCCCCC
T ss_conf             7--7899756662223560---------104408816889