HHsearch alignment for GI: 254781043 and conserved domain: PRK09078

>PRK09078 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed.
Probab=100.00  E-value=0  Score=1236.67  Aligned_cols=598  Identities=75%  Similarity=1.238  Sum_probs=576.1

Q ss_pred             CCCCCCCEEEEEECEEEECCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHCCCCEEEECCCCCCCCHHHHHHHHHHH
Q ss_conf             00534413323105889899689999999999889829999868988521041165342513789999999999989984
Q gi|254781043|r    6 NLKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLANMTPDSWQWHLYDTIKG   85 (611)
Q Consensus         6 ~~~~~~~~~d~~~DVlVIG~G~AGl~AAi~A~e~G~~V~lieK~~~~~g~s~~A~GGi~a~~~~~~~Ds~~~~~~Dt~~~   85 (611)
T Consensus         1 ~~~~~~~~~d~e~DVlVIGsG~AGL~AAi~a~~~G~~V~li~K~~~~~s~s~~AqGGi~aa~~~~~~Ds~~~h~~DTl~a   80 (598)
T PRK09078          1 AMMSAYKIIDHKYDVVVVGAGGAGLRATLGMAEAGLRTACITKVFPTRSHTVAAQGGISASLGNMGEDDWRWHMYDTVKG   80 (598)
T ss_pred             CCCCCCCCCCCCCCEEEECCCHHHHHHHHHHHHCCCEEEEEECCCCCCCCHHHHCCCCEEECCCCCCCCHHHHHHHHHHH
T ss_conf             98776665566379899995699999999998749907999788999985465410050333789999989999999986


Q ss_pred             CCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCEEEECCCCCCCCCCCCCCCCEEEEECCCCCHHHHHHHHHHHH
Q ss_conf             58877999999999988999999998699813279985510014641145678765640798666542667899999987
Q gi|254781043|r   86 SDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQAL  165 (611)
Q Consensus        86 g~~l~d~~lv~~~~~~a~~~i~~Le~~Gv~f~r~~~G~~~~~~~gg~~~~~~~g~~~~R~~~~~d~tG~~i~~~L~~~~~  165 (611)
T Consensus        81 G~~l~d~~~v~~l~~~a~~~i~~L~~~Gv~f~r~~dG~~~~~~~GGhs~~~~~~~~~~R~~~~~d~tG~~i~~~L~~~~~  160 (598)
T PRK09078         81 SDWLGDQDAIEYMCREAPAAVYELEHYGVPFSRTEEGKIYQRPFGGMTTNYGEGPPAQRTCAAADRTGHAILHTLYQQSL  160 (598)
T ss_pred             HCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCEEECCCCCCCEEEEEEECCCCHHHHHHHHHHHHH
T ss_conf             35768899999999989999999998599243289988612445643201357875047885067609999999999998


Q ss_pred             HCCCEEECCCEEEEEEECCCCCCEEEEEEEECCCEEEEECCCCEEEECCCCCCCCCCCCCCCEECCHHHHHHHHHCCCCC
Q ss_conf             31230311315652000134430124689805870899506724741576565433421064014448878875136533
Q gi|254781043|r  166 KNNAEFFIEYFALDLIINSEGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQ  245 (611)
Q Consensus       166 ~~gv~i~~~~~~~~Li~d~dG~V~Gav~~~~~~G~~~~i~AkaVILATGG~~~ly~~~t~~~~~tGdG~~mA~~aGa~l~  245 (611)
T Consensus       161 ~~~i~~~~~~~~~~li~~~~G~v~Gv~~~~~~~G~~~~i~AkaVILATGG~g~~y~~tTn~~~~TGdG~amA~raGA~l~  240 (598)
T PRK09078        161 KHNAEFFIEYFALDLIMDDEGVCRGVVAWNLDDGTLHRFRAHMVVLATGGYGRAYFSATSAHTCTGDGGGMVLRAGLPLQ  240 (598)
T ss_pred             HCCCEEEEEEEEEEEEECCCCEEEEEEEEECCCCCEEEEEECEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCC
T ss_conf             63987999889999998279859999999878995899970769988787776667776999875499999998498725


Q ss_pred             CCCCCCCCCCCCCCCEEECCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCEEHHHHHHHHHHCCCCCCCCCEEEEEE
Q ss_conf             33222328884422014304566557808983268612554076510047520111568899881788888887468861
Q gi|254781043|r  246 DMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEIREGRGVGKSKDHIHLYL  325 (611)
Q Consensus       246 ~mEf~qfhPt~~~~~~~l~~~~~rg~G~~l~n~~Gerf~~~y~~~~~el~~rd~~s~ai~~ei~~g~g~~~~~~~v~ld~  325 (611)
T Consensus       241 dmEfiQfhPT~~~~~~~LisE~~rg~G~~L~n~~GerFm~~y~p~~~ela~Rdvvsrai~~ei~~G~g~~~~~~~v~ld~  320 (598)
T PRK09078        241 DMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSEGERFMERYAPSAKDLASRDVVSRAMTIEIREGRGVGKKKDHIFLHL  320 (598)
T ss_pred             CCHHHHHCCCCCCCCCCEEEECCCCCCEEEECCCCCCCCCCCCCCCHHCCCCCHHHHHHHHHHHHCCCCCCCCCEEEEEH
T ss_conf             85787406774357761542103378508989998998544477520024420789999999985478767887479873


Q ss_pred             CCCCHHHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCCCCCCCCCCCEEECCCCCCCCCCCCCEEECCCCCCCCCC
Q ss_conf             11798999998537999997643678654406752033100123421577158537788853322760340212203356
Q gi|254781043|r  326 NHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVH  405 (611)
Q Consensus       326 ~~~~~~~l~~~~~~~~~~~~~~~g~D~~~~~i~v~p~~hy~~GGi~vd~~g~v~~~~~~~~~t~i~GLyAaGe~a~~g~h  405 (611)
T Consensus       321 ~~~~~~~l~~~~p~i~~~~~~~~giD~~~~~ipv~P~~Hy~mGGi~id~~g~V~~~~~~~~~T~IpGLyAaGE~a~~G~H  400 (598)
T PRK09078        321 DHLDPEVLHERLPGISESAKIFAGVDVTKEPIPVLPTVHYNMGGIPTNYHGEVLTKTGDNPDAVVPGLMAIGEAACVSVH  400 (598)
T ss_pred             HHCCHHHHHHHCHHHHHHHHHHCCCCCCCCCEECCCCCCEECCCEECCCCCCEEECCCCCCCCCCCCCEECCCCCCCCCC
T ss_conf             10898999887758999999966989877864511203440478621767604202578767434621112554446766


Q ss_pred             CCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHCCCEEEE
Q ss_conf             64304764322222232156775566542026566764002357888631010378871368999878876650972687
Q gi|254781043|r  406 GANRLGSNSLIDLVVFGRAAVIRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFR  485 (611)
Q Consensus       406 Ganrlggnsl~~~~vfG~~Ag~~aa~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~i~~~Lq~iM~~~~gi~R  485 (611)
T Consensus       401 GANRLggnsLle~~VfGr~Ag~~Aa~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~lq~~m~~~~gi~R  480 (598)
T PRK09078        401 GANRLGSNSLIDLVVFGRAAALRAAEVIKPGAPHPPLPKDACDKALDRFDRLRHANGSTPTAELRLKMQRTMQNDAAVFR  480 (598)
T ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHCCCEEC
T ss_conf             55220235688999999999999999863578888998778999999887653178987879999999999862168521


Q ss_pred             CHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCEECCCCCCCCCCCCCC
Q ss_conf             58999999999999999984151578775458899999988889999999999996262550462353377887666880
Q gi|254781043|r  486 TQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRGSHAREDFKDGEFGGRDD  565 (611)
Q Consensus       486 ~~~~L~~al~~L~~l~~~~~~i~~~d~~~~~n~el~~~~el~~~l~~Ae~~~~aal~R~ESRG~H~R~DyPe~~~~~rDD  565 (611)
T Consensus       481 ~~~~L~~al~~l~~l~~~~~~~~~~~~~~~~n~~l~~a~el~nll~~A~~i~~aAl~R~ESRG~H~R~DyPe-----~dD  555 (598)
T PRK09078        481 TGEVLEEGVEKISEVWAGLPDIKVTDRSLIWNSDLVETLELDNLMAQAVVTMESAENRKESRGAHAREDFPD-----RDD  555 (598)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCC-----CCC
T ss_conf             789999999999999999873676775522146799999999999999999999860654645424788999-----975


Q ss_pred             HHHCEEEEEEEECCCCEEEEEEECCCCCCCCCCCCEEECCCCCCCC
Q ss_conf             3213569999846898059999447444256755000027721679
Q gi|254781043|r  566 VNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPKARVY  611 (611)
Q Consensus       566 ~nwl~h~~~~~~~~~g~~~~~~~Pv~~~~~~~~~~~~~~~p~~R~Y  611 (611)
T Consensus       556 ~~wl~h~~~~~-~~~g~~~~~~~pv~~~~~~~--~~~~~~p~~r~y  598 (598)
T PRK09078        556 ENWMKHTLAWV-DDKGKVTLDYRPVHLYTLTN--DVQYIPPKKRVY  598 (598)
T ss_pred             HHHHCEEEEEE-CCCCCEEEEECCCCCCCCCC--CCCCCCCCCCCC
T ss_conf             55532078898-79998789854651325677--653319957889