HHsearch alignment for GI: 254781043 and conserved domain: PRK10015

>PRK10015 hypothetical protein; Provisional.
Probab=99.60  E-value=7.7e-15  Score=115.64  Aligned_cols=163  Identities=23%  Similarity=0.275  Sum_probs=93.1

Q ss_pred             EEEEECEEEECCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHCCCCEEEECCCCCCCCHHHHHHHHHHHCCCCCCHH
Q ss_conf             32310588989968999999999988982999986898852104116534251378999999999998998458877999
Q gi|254781043|r   14 VDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLANMTPDSWQWHLYDTIKGSDWLGDVD   93 (611)
Q Consensus        14 ~d~~~DVlVIG~G~AGl~AAi~A~e~G~~V~lieK~~~~~g~s~~A~GGi~a~~~~~~~Ds~~~~~~Dt~~~g~~l~d~~   93 (611)
T Consensus         2 ~~e~fDVIVVGaGPAG~sAA~~LAk~Gl~VlllErg~~~G~k~~s--Ggv---l---~~~~le~liP~------~~~-~a   66 (429)
T PRK10015          2 SDDKFDAIVVGAGVAGSVAALVMARAGLDVLVIERGDSAGCKNMT--GGR---L---YAHTLEAIIPG------FAA-SA   66 (429)
T ss_pred             CCCCCCEEEECCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCC--CCE---E---CHHHHHHHCCC------CCC-CC
T ss_conf             976158899996889999999998779919999678879985512--637---4---16278886889------644-79


Q ss_pred             HHHHHHHHHHHHHHHHHHCCCCCCCCCCCCEEEECCCCCCCCCCCCCCCCEEEEECCCCCHHHHHHHHHHHHHCCCEEEC
Q ss_conf             99999998899999999869981327998551001464114567876564079866654266789999998731230311
Q gi|254781043|r   94 AIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFI  173 (611)
Q Consensus        94 lv~~~~~~a~~~i~~Le~~Gv~f~r~~~G~~~~~~~gg~~~~~~~g~~~~R~~~~~d~tG~~i~~~L~~~~~~~gv~i~~  173 (611)
T Consensus        67 P~er~V~----------~~~~~~-l~~~~~~~i-~~~~~~~~~~-----~~~~y~v~R--~~fD~WLa~~Ae~aGa~i~~  127 (429)
T PRK10015         67 PVERKVT----------REKISF-LTEESAVTL-DFHREQPDVP-----QHASYTVLR--NRLDPWLMEQAEQAGAQFIP  127 (429)
T ss_pred             CCCEEEE----------EEEEEE-ECCCCCEEC-CCCCCCCCCC-----CCCCEEEEH--HHHHHHHHHHHHHCCCEEEC
T ss_conf             8521589----------878999-878980666-7656786766-----778659899--99999999999975999977


Q ss_pred             CCEEEEEEECCCCCCEEEEEEEECCCEEEEECCCCEEEECCCCC
Q ss_conf             31565200013443012468980587089950672474157656
Q gi|254781043|r  174 EYFALDLIINSEGCCVGVVAWQLETGEIHRFSAKLVVLATGGYG  217 (611)
Q Consensus       174 ~~~~~~Li~d~dG~V~Gav~~~~~~G~~~~i~AkaVILATGG~~  217 (611)
T Consensus       128 g~~v~~l~~e-~g~V~GV~t-----g~-~~l~A~vVI~AdGvns  164 (429)
T PRK10015        128 GVRVDALVRE-GNKVTGVQA-----GD-DILEANVVILADGVNS  164 (429)
T ss_pred             CCEEEEEEEE-CCEEEEEEC-----CC-CEEEEEEEEEECCCCH
T ss_conf             9589999962-998999987-----98-2688658998156227