HHsearch alignment for GI: 254781043 and conserved domain: PRK11101

>PRK11101 glpA sn-glycerol-3-phosphate dehydrogenase subunit A; Provisional.
Probab=99.66  E-value=3e-15  Score=118.35  Aligned_cols=192  Identities=17%  Similarity=0.151  Sum_probs=110.4

Q ss_pred             EEECEEEECCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHCCCCEEEECCCCCCCCHHHHHHHHHHHCCCC--CCHH
Q ss_conf             31058898996899999999998898299998689885210411653425137899999999999899845887--7999
Q gi|254781043|r   16 HSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLANMTPDSWQWHLYDTIKGSDWL--GDVD   93 (611)
Q Consensus        16 ~~~DVlVIG~G~AGl~AAi~A~e~G~~V~lieK~~~~~g~s~~A~GGi~a~~~~~~~Ds~~~~~~Dt~~~g~~l--~d~~   93 (611)
T Consensus         4 ~e~DVvIIGgGi~Ga~iArdla~rGl~v~LvEk~D~a~GTSs~ss~LiHgG~RY~~~d~-~~-are~l~e~~~l~~~Aph   81 (545)
T PRK11101          4 QETDVIIIGGGATGAGIARDCALRGLRCILVERHDIATGATGRNHGLLHSGARYAVTDA-ES-ARECISENQILKRIARH   81 (545)
T ss_pred             CCCCEEEECCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCHHHCCCCH-HH-HHHHHHHHHHHHHHCHH
T ss_conf             61768999986899999999986799399998997616200120127122523123370-99-99999989999985916


Q ss_pred             HHHH-------HHHHH----HHHHHHHHHCCCCCCCCCCCCEEEECCCCCCCCCCCCCCCCEEEEECCC--CCHHHHHHH
Q ss_conf             9999-------99988----9999999986998132799855100146411456787656407986665--426678999
Q gi|254781043|r   94 AIQY-------LAMEA----PQSVYELEHYGVPFSRNEAGKIYQRPFGGHMQNYGEGPPVQRTCAAADR--TGHAILHTL  160 (611)
Q Consensus        94 lv~~-------~~~~a----~~~i~~Le~~Gv~f~r~~~G~~~~~~~gg~~~~~~~g~~~~R~~~~~d~--tG~~i~~~L  160 (611)
T Consensus        82 lv~~~g~L~v~~~~~~~~~~~~~~~~~~~~gv~~~~i-~~~e~~~~eP~l~------~~l~ga~~~~Dg~vdp~rL~ia~  154 (545)
T PRK11101         82 CVEPTDGLFITLPEDDLAFQATFIRACEEAGIEAEAI-DPQQALILEPAVN------PALIGAVKVPDGTVDPFRLTAAN  154 (545)
T ss_pred             HCCCCCCEEEEECCHHHHHHHHHHHHHHHCCCCCEEE-CHHHHHHHCCCCC------HHCEEEEEECCEEECHHHHHHHH
T ss_conf             4030686389715022678999999999769984776-8999997586888------30207999552278738999999


Q ss_pred             HHHHHHCCCEEECCCEEEEEEECCCCCCEEEEEEEECCCEEEEECCCCEEEECCCCC
Q ss_conf             999873123031131565200013443012468980587089950672474157656
Q gi|254781043|r  161 YGQALKNNAEFFIEYFALDLIINSEGCCVGVVAWQLETGEIHRFSAKLVVLATGGYG  217 (611)
Q Consensus       161 ~~~~~~~gv~i~~~~~~~~Li~d~dG~V~Gav~~~~~~G~~~~i~AkaVILATGG~~  217 (611)
T Consensus       155 a~~A~~~GA~i~~~t~V~~i~~~-~g~v~gv~~~d~~tg~~~~i~ak~VINAAG~wa  210 (545)
T PRK11101        155 MLDAKEHGARILTAHEVTGLIRE-GDTVCGVRVRDHLTGETQEIHAPVVVNAAGIWG  210 (545)
T ss_pred             HHHHHHCCCCEECCCEEEEEEEE-CCEEEEEEEEECCCCCEEEEEEEEEEECCCCCH
T ss_conf             99999748202026477899941-887999999986789689998569997667546