HHsearch alignment for GI: 254781043 and conserved domain: PRK11749

>PRK11749 putative oxidoreductase; Provisional.
Probab=98.94  E-value=4.5e-08  Score=71.41  Aligned_cols=59  Identities=19%  Similarity=0.398  Sum_probs=41.7

Q ss_pred             CCCCCCCCEEECCCCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCC
Q ss_conf             342157715853778885332276034021220335664304764322222232156775566542026
Q gi|254781043|r  369 GIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIRASEMIDKSS  437 (611)
Q Consensus       369 Gi~vd~~g~v~~~~~~~~~t~i~GLyAaGe~a~~g~hGanrlggnsl~~~~vfG~~Ag~~aa~~~~~~~  437 (611)
T Consensus       400 g~~~~~~g~i~~-~d~~~~Ts~~gVFAaGD~~-~G--------~~~vv~Ai~~Gr~AA~~I~~~L~G~~  458 (460)
T PRK11749        400 GLAVTRWGTIIA-DDETGRTSLPGVFAGGDIV-TG--------AATVVLAVGDGKDAAEAIHEYLEGAA  458 (460)
T ss_pred             CCEECCCCCEEE-CCCCCCCCCCCEEEECCCC-CC--------CHHHHHHHHHHHHHHHHHHHHHCCCC
T ss_conf             812768999884-6899722899999945877-67--------05999999999999999999858988