HHsearch alignment for GI: 254781043 and conserved domain: PRK12810

>PRK12810 gltD glutamate synthase subunit beta; Reviewed.
Probab=96.84  E-value=0.00067  Score=44.08  Aligned_cols=37  Identities=32%  Similarity=0.374  Sum_probs=33.3

Q ss_pred             ECEEEECCCHHHHHHHHHHHHCCCCEEEEECCCCCCC
Q ss_conf             0588989968999999999988982999986898852
Q gi|254781043|r   18 YDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRS   54 (611)
Q Consensus        18 ~DVlVIG~G~AGl~AAi~A~e~G~~V~lieK~~~~~g   54 (611)
T Consensus       144 kkVAVIGsGPAGLsaA~~Lar~G~~VtVfE~~~~~GG  180 (472)
T PRK12810        144 KKVAVVGSGPAGLAAADQLARAGHKVTVFERDDRIGG  180 (472)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEECCCCCCC
T ss_conf             9899989778999999999866975899725777775