HHsearch alignment for GI: 254781043 and conserved domain: PRK12831

>PRK12831 putative oxidoreductase; Provisional.
Probab=98.99  E-value=8.7e-08  Score=69.52  Aligned_cols=58  Identities=24%  Similarity=0.300  Sum_probs=42.9

Q ss_pred             CCCCCCCCCEEECCCCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHH
Q ss_conf             23421577158537788853322760340212203356643047643222222321567755665420
Q gi|254781043|r  368 GGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIRASEMIDK  435 (611)
Q Consensus       368 GGi~vd~~g~v~~~~~~~~~t~i~GLyAaGe~a~~g~hGanrlggnsl~~~~vfG~~Ag~~aa~~~~~  435 (611)
T Consensus       405 ~gi~~~~~g~i~-~~~~~~~Ts~~gVFa~GD~~-~--------G~~~vV~Ai~~Gr~AA~~I~~yL~g  462 (464)
T PRK12831        405 PGLEINKRGCIV-ADEETGLTSIEGVYAGGDAV-T--------GAATVILAMGAGKKAAKAIDEYLSK  462 (464)
T ss_pred             CCEEECCCCCEE-ECCCCCCCCCCCEEECCCCC-C--------CCHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             680277999888-47899842899999827867-6--------8339999999999999999999735