HHsearch alignment for GI: 254781043 and conserved domain: PRK12844

>PRK12844 3-ketosteroid-delta-1-dehydrogenase; Reviewed.
Probab=100.00  E-value=0  Score=464.68  Aligned_cols=411  Identities=25%  Similarity=0.330  Sum_probs=286.3

Q ss_pred             EEEECEEEECCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHCCCCEEEECC-----CCCCCCHHH---HHHHHHHHC
Q ss_conf             231058898996899999999998898299998689885210411653425137-----899999999---999899845
Q gi|254781043|r   15 DHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLA-----NMTPDSWQW---HLYDTIKGS   86 (611)
Q Consensus        15 d~~~DVlVIG~G~AGl~AAi~A~e~G~~V~lieK~~~~~g~s~~A~GGi~a~~~-----~~~~Ds~~~---~~~Dt~~~g   86 (611)
T Consensus         4 D~e~DVvVVG~G~AGl~AAi~Aae~Ga~V~vlEK~~~~GG~s~~sgG~~~~~~~~~q~~~Gi~Ds~e~~~~~~~~~~~~~   83 (552)
T PRK12844          4 DVTVDVVVVGSGGGGMVAALAAASSGLETLIVEKQPKVGGSTAMSGGVLWLPNNPLMLADGVPDSHEDALAYLDAVVGDQ   83 (552)
T ss_pred             CCEECEEEECCCHHHHHHHHHHHHCCCCEEEEECCCCCCHHHHHHCCCEEECCCHHHHHHCCCCCHHHHHHHHHHHHCCC
T ss_conf             77209799896789999999999889968999889996664798565854089999997189989999999999984555


Q ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCC-CEEEECCCCCCCC------------------C-----CCCC--
Q ss_conf             887799999999998899999999869981327998-5510014641145------------------6-----7876--
Q gi|254781043|r   87 DWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAG-KIYQRPFGGHMQN------------------Y-----GEGP--  140 (611)
Q Consensus        87 ~~l~d~~lv~~~~~~a~~~i~~Le~~Gv~f~r~~~G-~~~~~~~gg~~~~------------------~-----~~g~--  140 (611)
T Consensus        84 ~~~~~~~~~~~~~~~~~~~~~wl~~~g~~f~~~~~~~d~~~~~~gg~~~gr~~~~~~~d~~~~g~~~~~~~~~~~~~~~~  163 (552)
T PRK12844         84 GPASSPERREAYLTAGPAMISFLEHQGMRFARCEGWSDYYPELPGGLARGRSVEAQPLDARKLGPWFAKLNPPMATPPGT  163 (552)
T ss_pred             CCCCCHHHHHHHHHHCHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCCCCEECCCCCCHHHHCCHHHHCCCCCCCCCCE
T ss_conf             65888999999996089999999965983564267752245667776688420255677565041144306652347740


Q ss_pred             --------------CCCEEEE--------------E---CCCCCHHHHHHHHHHHHHCCCEEECCCEEEEEEECCCCCCE
Q ss_conf             --------------5640798--------------6---66542667899999987312303113156520001344301
Q gi|254781043|r  141 --------------PVQRTCA--------------A---ADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCCV  189 (611)
Q Consensus       141 --------------~~~R~~~--------------~---~d~tG~~i~~~L~~~~~~~gv~i~~~~~~~~Li~d~dG~V~  189 (611)
T Consensus       164 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~l~~~l~~~~~~~gv~i~~~t~~~~Li~d-~G~V~  242 (552)
T PRK12844        164 VVMTDEYKWLQLIKRTPRGMRTAARVGARTAAARIRGQKLLTNGAALIGRMLAAALAAGVPVWTNTPLTELVVE-DGRVT  242 (552)
T ss_pred             EECCHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCCCEEEEEC-CCEEE
T ss_conf             10112455444321043221234344345454421255334574899999999998769938935721367622-98599


Q ss_pred             EEEEEEECCCEEEEECC-CCEEEECCCCCC------CCC-------CCCCCCEECCHHHHHHHHHCCCCCCCCCCCCCCC
Q ss_conf             24689805870899506-724741576565------433-------4210640144488788751365333322232888
Q gi|254781043|r  190 GVVAWQLETGEIHRFSA-KLVVLATGGYGR------AYF-------SATSAHTCTGDGAGMVARAGLPLQDMEFVQFHPT  255 (611)
Q Consensus       190 Gav~~~~~~G~~~~i~A-kaVILATGG~~~------ly~-------~~t~~~~~tGdG~~mA~~aGa~l~~mEf~qfhPt  255 (611)
T Consensus       243 Gv~a~--~~g~~~~i~A~kgVILATGGf~~N~em~~~~~p~~~~~~~~~~~~~~tGdGi~ma~~~GA~~~~m~~~~~~~~  320 (552)
T PRK12844        243 GVVVV--RDGREVLITARRGVLLNSGGFGHNAEMRKRYQPQPNEGDWTIANPGDTGEGIEAAMRLGAALDLMDEAWWVPG  320 (552)
T ss_pred             EEEEE--ECCEEEEEEECCEEEEECCCCCCCHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCCCCEECCE
T ss_conf             99999--8994899984225799258720099999970887556764468988785799999985984025653314140


Q ss_pred             CCCCCE---EECCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCC-----CCEEHHHHHHHHHHCC---C-CCCC------
Q ss_conf             442201---43045665578089832686125540765100475-----2011156889988178---8-8888------
Q gi|254781043|r  256 GIYGAG---CLITEGARGEGGYLVNSKGERFMERYAPSAKDLAS-----RDVVSRCMMMEIREGR---G-VGKS------  317 (611)
Q Consensus       256 ~~~~~~---~l~~~~~rg~G~~l~n~~Gerf~~~y~~~~~el~~-----rd~~s~ai~~ei~~g~---g-~~~~------  317 (611)
T Consensus       321 ~~~~~~~~~~~~~~~~~~p~~i~VN~~G~RF~nE~~~~~-~~~~~~~~~~~~~~~~I~D~~~~~~~~~~~~~~~~~~~~~  399 (552)
T PRK12844        321 IPLPTGGPPYMHNSERSLPGSIIVDRAGRRFCNEAGSYM-EVGRRMYANDAVPAWMIMDSRYRKRYLFGDIPPGPTPQEW  399 (552)
T ss_pred             EECCCCCCCCCCCCHHCCCCEEEECCCCCCCCCCCCCHH-HHHHHHHHCCCCCEEEEECHHHHHHHCCCCCCCCCCHHHH
T ss_conf             467899754213312218845998999984756777589-9999998288975799988799965233547875257999


Q ss_pred             --CCEEE-EE-E------CCCCHHHHHHHHHHHHHHHHHHCCCCCCC-------------------------CE---EEE
Q ss_conf             --87468-86-1------11798999998537999997643678654-------------------------40---675
Q gi|254781043|r  318 --KDHIH-LY-L------NHLDPAVLQERLPGISESARIFAGVDVTR-------------------------DP---IPV  359 (611)
Q Consensus       318 --~~~v~-ld-~------~~~~~~~l~~~~~~~~~~~~~~~g~D~~~-------------------------~~---i~v  359 (611)
T Consensus       400 ~~~g~~~kadTleELA~~~gid~~~L~~Tv~~yN~~~~~G~D~dfgr~~~~~~~~~~d~~~~p~~~l~pi~~~PfYA~~~  479 (552)
T PRK12844        400 LDSGYMKRADTIEELAGKCGIDPAGLAATVERFNRFAATGTDPDFHRGESAYDRYYGDPTNKPNPNLGPLDKAPFYAVRM  479 (552)
T ss_pred             HHCCCEEECCCHHHHHHHHCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCHHHHCCCCCCCCCCCCCCCCCCCCCEEEEEE
T ss_conf             86697687599999998859699999999999999986499834476620222025676668872226356799899998


Q ss_pred             ECCCCCCCCCCCCCCCCEEECCCCCCCCCCCCCEEECCCCCCCCCCCCCCCC-CCCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             2033100123421577158537788853322760340212203356643047-64322222232156775566542
Q gi|254781043|r  360 IPTVHYNMGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLG-SNSLIDLVVFGRAAVIRASEMID  434 (611)
Q Consensus       360 ~p~~hy~~GGi~vd~~g~v~~~~~~~~~t~i~GLyAaGe~a~~g~hGanrlg-gnsl~~~~vfG~~Ag~~aa~~~~  434 (611)
T Consensus       480 ~p~~~~T~GGl~in~~~qVL~~~g~----pIpGLYAaGe~~-gg~~g~~y~g~G~sl~~~~~fGriAg~~AA~~~~  550 (552)
T PRK12844        480 VPGDVGTSGGLLTDEYARVLDTDGS----VIPGLYATGNCT-ASVMGRTYPGAGASIGNSMVFGYIAALHAAGASS  550 (552)
T ss_pred             EHHHCCCCCCCCCCCCCCEECCCCC----EECCEEECCCCC-CCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             8634635878129999716899989----849976666465-4778898665056288899999999999872200