HHsearch alignment for GI: 254781043 and conserved domain: PRK13512

>PRK13512 coenzyme A disulfide reductase; Provisional.
Probab=93.93  E-value=0.12  Score=29.45  Aligned_cols=34  Identities=21%  Similarity=0.158  Sum_probs=29.3

Q ss_pred             CEEEECCCHHHHHHHHHHHHCC--CCEEEEECCCCC
Q ss_conf             5889899689999999999889--829999868988
Q gi|254781043|r   19 DVVVVGAGGAGLRATLGMAEKG--FKTACITKVFPT   52 (611)
Q Consensus        19 DVlVIG~G~AGl~AAi~A~e~G--~~V~lieK~~~~   52 (611)
T Consensus         3 kiVIIG~g~AG~~aA~~lrk~~~~~eItvi~~e~~~   38 (438)
T PRK13512          3 KIVVVGAVAGGATCASQIRRLDKESDIIIFEKDRDM   38 (438)
T ss_pred             EEEEECCCHHHHHHHHHHHHHCCCCCEEEEECCCCC
T ss_conf             099989849999999999943919999999689988