HHsearch alignment for GI: 254781043 and conserved domain: TIGR01317

>TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit; InterPro: IPR006005 One pathway for the assimilation of ammonia and glutamate biosynthesis involves glutamate synthase (1.4.1.13 from EC) which transfers the amide group of glutamine to 2-oxoglutarate to yield two molecules of glutamate. 2 L-glutamate + NADP^+ = L-glutamine + 2-oxoglutarate + NADPH + H^+. This describes a family in several archaeal and deeply branched bacterial lineages of a homotetrameric form of the NADPH-dependent or NADH-dependent glutamate synthase (1.4.1.13 from EC and 1.4.1.14 from EC respectively) small subunit. There is no corresponding large subunit. ; GO: 0016639 oxidoreductase activity acting on the CH-NH2 group of donors NAD or NADP as acceptor, 0006537 glutamate biosynthetic process.
Probab=97.81  E-value=0.00015  Score=48.29  Aligned_cols=176  Identities=22%  Similarity=0.242  Sum_probs=89.6

Q ss_pred             CEEEECCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHCCCCEEEECCCCCCCCHHHHHHHHHHHCCCCCCHH-HHHH
Q ss_conf             588989968999999999988982999986898852104116534251378999999999998998458877999-9999
Q gi|254781043|r   19 DVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLANMTPDSWQWHLYDTIKGSDWLGDVD-AIQY   97 (611)
Q Consensus        19 DVlVIG~G~AGl~AAi~A~e~G~~V~lieK~~~~~g~s~~A~GGi~a~~~~~~~Ds~~~~~~Dt~~~g~~l~d~~-lv~~   97 (611)
T Consensus       153 kVAVVGSGPAGLAaA~qLnrAGH~VTVfER~DR~GG--------L---L~YGIPn--------------mKLdK~e~v~-  206 (517)
T TIGR01317       153 KVAVVGSGPAGLAAADQLNRAGHTVTVFEREDRVGG--------L---LRYGIPN--------------MKLDKEEIVD-  206 (517)
T ss_pred             EEEEECCCHHHHHHHHHHHHCCCCEEEEECCCCCCC--------C---CCCCCCC--------------CCCCHHHHHH-
T ss_conf             689975675799999998535883899743678886--------3---0248887--------------4337388999-


Q ss_pred             HHHHHHHHHHHHHHCCCCCCCCCC-C------CEEEECCCCCCCCCCCCCCCCEEEEECCCCCHHHHHHHHHHHHH-CCC
Q ss_conf             999889999999986998132799-8------55100146411456787656407986665426678999999873-123
Q gi|254781043|r   98 LAMEAPQSVYELEHYGVPFSRNEA-G------KIYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALK-NNA  169 (611)
Q Consensus        98 ~~~~a~~~i~~Le~~Gv~f~r~~~-G------~~~~~~~gg~~~~~~~g~~~~R~~~~~d~tG~~i~~~L~~~~~~-~gv  169 (611)
T Consensus       207 ------RRi~~l~aEG~~FvtnteiGdWdenskitnlsk~di~~-~~L~~~fDAVVLa~Ga~---~pRDLpI~GREL~Gi  276 (517)
T TIGR01317       207 ------RRIDLLEAEGVDFVTNTEIGDWDENSKITNLSKKDISA-DELKEDFDAVVLATGAT---KPRDLPIPGRELKGI  276 (517)
T ss_pred             ------HHHHHHHHCCCCCCCCCCCCCCCCCCCEECCCCCCCCH-HHHHHHCCEEEEECCCC---CCCCCCCCCCCCCCC
T ss_conf             ------99999874784201783004653444200022342687-99871469389833788---601035577664660


Q ss_pred             EEECCCEEEEEEECCCCCCE-EEEEEEECCCE-EEEECCCCEEEECCCCCCCCCCCCCCCEECCHHHHHHHHHCCC-CCC
Q ss_conf             03113156520001344301-24689805870-8995067247415765654334210640144488788751365-333
Q gi|254781043|r  170 EFFIEYFALDLIINSEGCCV-GVVAWQLETGE-IHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLP-LQD  246 (611)
Q Consensus       170 ~i~~~~~~~~Li~d~dG~V~-Gav~~~~~~G~-~~~i~AkaVILATGG~~~ly~~~t~~~~~tGdG~~mA~~aGa~-l~~  246 (611)
T Consensus       277 -----H~AMefL~~~-tk~~l~~~~k~-~~GqP~I~akGK~VvvIGGGDT--------G~DCvG----Ts~RhGA~sV~q  337 (517)
T TIGR01317       277 -----HFAMEFLTLN-TKALLDDDFKD-KDGQPFIKAKGKKVVVIGGGDT--------GADCVG----TSLRHGAASVHQ  337 (517)
T ss_pred             -----HHHHHHHHHH-HHHHCCCCCCC-CCCCCCEEECCCEEEEECCCCC--------CCHHHH----HHHHHHHHHHHH
T ss_conf             -----3786554675-48560885366-6788735422867899757875--------622456----323554355230


Q ss_pred             CCC
Q ss_conf             322
Q gi|254781043|r  247 MEF  249 (611)
Q Consensus       247 mEf  249 (611)
T Consensus       338 FE~  340 (517)
T TIGR01317       338 FEI  340 (517)
T ss_pred             CCC
T ss_conf             256