HHsearch alignment for GI: 254781043 and conserved domain: TIGR03315

>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit. Members of this protein family are YgfK, predicted to be one subunit of a three-subunit, molybdopterin-containing selenate reductase. This enzyme is found, typically, in genomic regions associated with xanthine dehydrogenase homologs predicted to belong to the selenium-dependent molybdenum hydroxylases (SDMH). Therefore, the selenate reductase is suggested to play a role in furnishing selenide for SelD, the selenophosphate synthase.
Probab=96.24  E-value=0.0026  Score=40.28  Aligned_cols=55  Identities=24%  Similarity=0.384  Sum_probs=39.9

Q ss_pred             CCCCCCCCCEEECCCCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHH
Q ss_conf             23421577158537788853322760340212203356643047643222222321567755665
Q gi|254781043|r  368 GGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIRASEM  432 (611)
Q Consensus       368 GGi~vd~~g~v~~~~~~~~~t~i~GLyAaGe~a~~g~hGanrlggnsl~~~~vfG~~Ag~~aa~~  432 (611)
T Consensus       784 ~GIeld~rG~I~-vD~~t~~TS~pGVFAaGD~v~---------GpstVV~AIadGR~AA~aIl~~  838 (1012)
T TIGR03315       784 NGIPLDEYGWPV-VNQATGETNITNVFVIGDANR---------GPATIVEAIADGRKAANAILSR  838 (1012)
T ss_pred             CCCEECCCCCEE-ECCCCCCCCCCCEEEEECCCC---------CHHHHHHHHHHHHHHHHHHHHH
T ss_conf             484088998988-688878789999888006675---------7789999999999999999864