BLAST/PSIBLAST alignment of GI: 254781043 and GI: 315122382 at iteration 1
>gi|315122382|ref|YP_004062871.1| succinate dehydrogenase flavoprotein subunit [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 611
>gi|313495784|gb|ADR52383.1| succinate dehydrogenase flavoprotein subunit [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 611
 Score = 1190 bits (3079), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 561/611 (91%), Positives = 592/611 (96%)

Query: 1   MKNSSNLKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQ 60
           MK+ SN KSSYTYVDHSYDV++VGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQ
Sbjct: 1   MKDISNFKSSYTYVDHSYDVIIVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQ 60

Query: 61  GGIAASLANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNE 120
           GGIAASLANMTPDSWQWHLYDT+KGSDWLGDVDAIQYLAMEAP+SVYELEHYGVPFSRNE
Sbjct: 61  GGIAASLANMTPDSWQWHLYDTVKGSDWLGDVDAIQYLAMEAPKSVYELEHYGVPFSRNE 120

Query: 121 AGKIYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDL 180
            GKIYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKN+AEFFIEYFALDL
Sbjct: 121 EGKIYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNDAEFFIEYFALDL 180

Query: 181 IINSEGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARA 240
           I+N+EG CVGV+AWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGM+ARA
Sbjct: 181 IMNAEGRCVGVIAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMIARA 240

Query: 241 GLPLQDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVV 300
           GLPLQDMEFVQFHPTGIYG+GCLITEG RGEGGYLVNS+GERFMERYAPSAKDLASRDVV
Sbjct: 241 GLPLQDMEFVQFHPTGIYGSGCLITEGVRGEGGYLVNSEGERFMERYAPSAKDLASRDVV 300

Query: 301 SRCMMMEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVI 360
           SRCMM+EIREGRGVGK+KDHIHLYLNHLDPA+L ERLPGISESARIFAG+DVTRDPIPVI
Sbjct: 301 SRCMMIEIREGRGVGKNKDHIHLYLNHLDPAILHERLPGISESARIFAGIDVTRDPIPVI 360

Query: 361 PTVHYNMGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVV 420
           PTVHYNMGGIPTNYWGEVLD++SKNPER APGLMAIGEAGCASVHGANRLGSNSLIDLVV
Sbjct: 361 PTVHYNMGGIPTNYWGEVLDSDSKNPERLAPGLMAIGEAGCASVHGANRLGSNSLIDLVV 420

Query: 421 FGRAAVIRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLD 480
           FGRAAVIRA+E+IDKSSPIPSLD+S+CD IM+RFDRLR+ADGH+ TA LREKMQRAMQLD
Sbjct: 421 FGRAAVIRAAEIIDKSSPIPSLDVSACDSIMERFDRLRYADGHISTAVLREKMQRAMQLD 480

Query: 481 AGVFRTQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSA 540
           A VFRTQ+SL+ GCRNLS LWDEMA LKV+DRSLIWNSDLVETLELQNLMINAIATVYSA
Sbjct: 481 AAVFRTQESLAAGCRNLSILWDEMAHLKVYDRSLIWNSDLVETLELQNLMINAIATVYSA 540

Query: 541 EARKESRGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVD 600
           EARKESRGSHARED+KDG F GRDDVNWRKHSLCWVD  TGKIKLDYRPV TELLCGG+D
Sbjct: 541 EARKESRGSHAREDYKDGAFSGRDDVNWRKHSLCWVDHKTGKIKLDYRPVRTELLCGGID 600

Query: 601 YSKIAPKARVY 611
           Y+KIAPKARVY
Sbjct: 601 YAKIAPKARVY 611