BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254781043|ref|YP_003065456.1| succinate dehydrogenase
flavoprotein subunit [Candidatus Liberibacter asiaticus str. psy62]
         (611 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254781043|ref|YP_003065456.1| succinate dehydrogenase flavoprotein subunit [Candidatus
           Liberibacter asiaticus str. psy62]
 gi|254040720|gb|ACT57516.1| succinate dehydrogenase flavoprotein subunit [Candidatus
           Liberibacter asiaticus str. psy62]
          Length = 611

 Score = 1273 bits (3294), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 611/611 (100%), Positives = 611/611 (100%)

Query: 1   MKNSSNLKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQ 60
           MKNSSNLKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQ
Sbjct: 1   MKNSSNLKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQ 60

Query: 61  GGIAASLANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNE 120
           GGIAASLANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNE
Sbjct: 61  GGIAASLANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNE 120

Query: 121 AGKIYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDL 180
           AGKIYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDL
Sbjct: 121 AGKIYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDL 180

Query: 181 IINSEGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARA 240
           IINSEGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARA
Sbjct: 181 IINSEGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARA 240

Query: 241 GLPLQDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVV 300
           GLPLQDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVV
Sbjct: 241 GLPLQDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVV 300

Query: 301 SRCMMMEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVI 360
           SRCMMMEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVI
Sbjct: 301 SRCMMMEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVI 360

Query: 361 PTVHYNMGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVV 420
           PTVHYNMGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVV
Sbjct: 361 PTVHYNMGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVV 420

Query: 421 FGRAAVIRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLD 480
           FGRAAVIRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLD
Sbjct: 421 FGRAAVIRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLD 480

Query: 481 AGVFRTQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSA 540
           AGVFRTQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSA
Sbjct: 481 AGVFRTQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSA 540

Query: 541 EARKESRGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVD 600
           EARKESRGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVD
Sbjct: 541 EARKESRGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVD 600

Query: 601 YSKIAPKARVY 611
           YSKIAPKARVY
Sbjct: 601 YSKIAPKARVY 611


>gi|315122382|ref|YP_004062871.1| succinate dehydrogenase flavoprotein subunit [Candidatus
           Liberibacter solanacearum CLso-ZC1]
 gi|313495784|gb|ADR52383.1| succinate dehydrogenase flavoprotein subunit [Candidatus
           Liberibacter solanacearum CLso-ZC1]
          Length = 611

 Score = 1190 bits (3079), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 561/611 (91%), Positives = 592/611 (96%)

Query: 1   MKNSSNLKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQ 60
           MK+ SN KSSYTYVDHSYDV++VGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQ
Sbjct: 1   MKDISNFKSSYTYVDHSYDVIIVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQ 60

Query: 61  GGIAASLANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNE 120
           GGIAASLANMTPDSWQWHLYDT+KGSDWLGDVDAIQYLAMEAP+SVYELEHYGVPFSRNE
Sbjct: 61  GGIAASLANMTPDSWQWHLYDTVKGSDWLGDVDAIQYLAMEAPKSVYELEHYGVPFSRNE 120

Query: 121 AGKIYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDL 180
            GKIYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKN+AEFFIEYFALDL
Sbjct: 121 EGKIYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNDAEFFIEYFALDL 180

Query: 181 IINSEGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARA 240
           I+N+EG CVGV+AWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGM+ARA
Sbjct: 181 IMNAEGRCVGVIAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMIARA 240

Query: 241 GLPLQDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVV 300
           GLPLQDMEFVQFHPTGIYG+GCLITEG RGEGGYLVNS+GERFMERYAPSAKDLASRDVV
Sbjct: 241 GLPLQDMEFVQFHPTGIYGSGCLITEGVRGEGGYLVNSEGERFMERYAPSAKDLASRDVV 300

Query: 301 SRCMMMEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVI 360
           SRCMM+EIREGRGVGK+KDHIHLYLNHLDPA+L ERLPGISESARIFAG+DVTRDPIPVI
Sbjct: 301 SRCMMIEIREGRGVGKNKDHIHLYLNHLDPAILHERLPGISESARIFAGIDVTRDPIPVI 360

Query: 361 PTVHYNMGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVV 420
           PTVHYNMGGIPTNYWGEVLD++SKNPER APGLMAIGEAGCASVHGANRLGSNSLIDLVV
Sbjct: 361 PTVHYNMGGIPTNYWGEVLDSDSKNPERLAPGLMAIGEAGCASVHGANRLGSNSLIDLVV 420

Query: 421 FGRAAVIRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLD 480
           FGRAAVIRA+E+IDKSSPIPSLD+S+CD IM+RFDRLR+ADGH+ TA LREKMQRAMQLD
Sbjct: 421 FGRAAVIRAAEIIDKSSPIPSLDVSACDSIMERFDRLRYADGHISTAVLREKMQRAMQLD 480

Query: 481 AGVFRTQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSA 540
           A VFRTQ+SL+ GCRNLS LWDEMA LKV+DRSLIWNSDLVETLELQNLMINAIATVYSA
Sbjct: 481 AAVFRTQESLAAGCRNLSILWDEMAHLKVYDRSLIWNSDLVETLELQNLMINAIATVYSA 540

Query: 541 EARKESRGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVD 600
           EARKESRGSHARED+KDG F GRDDVNWRKHSLCWVD  TGKIKLDYRPV TELLCGG+D
Sbjct: 541 EARKESRGSHAREDYKDGAFSGRDDVNWRKHSLCWVDHKTGKIKLDYRPVRTELLCGGID 600

Query: 601 YSKIAPKARVY 611
           Y+KIAPKARVY
Sbjct: 601 YAKIAPKARVY 611


>gi|325294012|ref|YP_004279876.1| succinate dehydrogenase flavoprotein subunit [Agrobacterium sp.
           H13-3]
 gi|325061865|gb|ADY65556.1| succinate dehydrogenase flavoprotein subunit [Agrobacterium sp.
           H13-3]
          Length = 613

 Score = 1072 bits (2773), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 501/611 (81%), Positives = 556/611 (90%), Gaps = 1/611 (0%)

Query: 1   MKNSSNLKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQ 60
           + + S    +YTYVDHSYDV+VVGAGGAGLRATLGMAE+GF+TACITKVFPTRSHTVAAQ
Sbjct: 4   ISSPSQNGKAYTYVDHSYDVIVVGAGGAGLRATLGMAEQGFRTACITKVFPTRSHTVAAQ 63

Query: 61  GGIAASLANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNE 120
           GGIAASL NMTPD WQWHLYDT+KGSDWLGDVDA+QYLAMEAP++VYELEHYGVPFSRN 
Sbjct: 64  GGIAASLTNMTPDCWQWHLYDTVKGSDWLGDVDAMQYLAMEAPKAVYELEHYGVPFSRNA 123

Query: 121 AGKIYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDL 180
            GKIYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQ+L+NNAEFFIEYFALDL
Sbjct: 124 EGKIYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQSLRNNAEFFIEYFALDL 183

Query: 181 IINSEGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARA 240
           I+  +G C GVVAW L+ G IHRFSAK+VVLATGGYGRAYFSATSAHTCTGDG GM+ARA
Sbjct: 184 IMAPDGRCTGVVAWNLDDGTIHRFSAKMVVLATGGYGRAYFSATSAHTCTGDGGGMIARA 243

Query: 241 GLPLQDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVV 300
           GLPLQDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNS+GERFMERYAPSAKDLASRDVV
Sbjct: 244 GLPLQDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSEGERFMERYAPSAKDLASRDVV 303

Query: 301 SRCMMMEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVI 360
           SRCM MEIREGRGVGK+KDHI L+L+HLDPA+L ERLPGISESA+IFAGVDVTR+PIPV+
Sbjct: 304 SRCMTMEIREGRGVGKNKDHIFLHLDHLDPAILHERLPGISESAKIFAGVDVTREPIPVL 363

Query: 361 PTVHYNMGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVV 420
           PTVHYNMGGIPTNYWGEVL+AN++NPER APGLMA+GEAGCASVHGANRLGSNSLIDLVV
Sbjct: 364 PTVHYNMGGIPTNYWGEVLNANAENPERIAPGLMAVGEAGCASVHGANRLGSNSLIDLVV 423

Query: 421 FGRAAVIRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLD 480
           FGRAA IRA+++ID+ +P+P+LD ++CD+IMDRFD LR+A+G  PTA LR+KMQRAMQ D
Sbjct: 424 FGRAAAIRAAQVIDRDAPVPALDTAACDKIMDRFDSLRYANGSTPTAVLRDKMQRAMQDD 483

Query: 481 AGVFRTQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSA 540
           A VFRTQ+SL  GC+ +S +W E+ D+KV DRS++WNSDLVETLEL NLM NAI TVY A
Sbjct: 484 AAVFRTQESLESGCQRISAIWKELPDVKVTDRSMVWNSDLVETLELHNLMANAITTVYGA 543

Query: 541 EARKESRGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVD 600
           EARKESRGSHAREDF DG FGGRDDVNWRKH+L WV    G +KLDYRPVHT+L+  G+D
Sbjct: 544 EARKESRGSHAREDFVDGPFGGRDDVNWRKHTLAWVS-PEGDVKLDYRPVHTDLIADGID 602

Query: 601 YSKIAPKARVY 611
             KI PKARVY
Sbjct: 603 PKKIEPKARVY 613


>gi|15889899|ref|NP_355580.1| succinate dehydrogenase flavoprotein subunit [Agrobacterium
           tumefaciens str. C58]
 gi|15157850|gb|AAK88365.1| succinate dehydrogenase flavoprotein subunit [Agrobacterium
           tumefaciens str. C58]
          Length = 613

 Score = 1071 bits (2770), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 501/611 (81%), Positives = 556/611 (90%), Gaps = 1/611 (0%)

Query: 1   MKNSSNLKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQ 60
           + + S    +YTYVDHSYDV+VVGAGGAGLRATLGMAE+GF+TACITKVFPTRSHTVAAQ
Sbjct: 4   ISSPSQNGKAYTYVDHSYDVIVVGAGGAGLRATLGMAEQGFRTACITKVFPTRSHTVAAQ 63

Query: 61  GGIAASLANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNE 120
           GGIAASL NMTPD WQWHLYDT+KGSDWLGDVDA+QYLAMEAP++VYELEHYGVPFSRN 
Sbjct: 64  GGIAASLTNMTPDCWQWHLYDTVKGSDWLGDVDAMQYLAMEAPKAVYELEHYGVPFSRNA 123

Query: 121 AGKIYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDL 180
            GKIYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQ+L+NNAEFFIEYFALDL
Sbjct: 124 EGKIYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQSLRNNAEFFIEYFALDL 183

Query: 181 IINSEGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARA 240
           I+  +G C GVVAW L+ G IHRFSAK+VVLATGGYGRAYFSATSAHTCTGDG GM+ARA
Sbjct: 184 IMAPDGRCTGVVAWNLDDGTIHRFSAKMVVLATGGYGRAYFSATSAHTCTGDGGGMIARA 243

Query: 241 GLPLQDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVV 300
           GLPLQDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNS+GERFMERYAPSAKDLASRDVV
Sbjct: 244 GLPLQDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSEGERFMERYAPSAKDLASRDVV 303

Query: 301 SRCMMMEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVI 360
           SRCM MEIREGRGVGK+KDHI L+L+HLDPA+L ERLPGISESA+IFAGVDVTR+PIPV+
Sbjct: 304 SRCMTMEIREGRGVGKNKDHIFLHLDHLDPAILHERLPGISESAKIFAGVDVTREPIPVL 363

Query: 361 PTVHYNMGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVV 420
           PTVHYNMGGIPTNYWGEVL+A++ NPER APGLMA+GEAGCASVHGANRLGSNSLIDLVV
Sbjct: 364 PTVHYNMGGIPTNYWGEVLNADANNPERIAPGLMAVGEAGCASVHGANRLGSNSLIDLVV 423

Query: 421 FGRAAVIRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLD 480
           FGRAA IRA+++ID+ +P+P+LDI++CD+IM+RFD LR+A+G  PTA LR+KMQRAMQ D
Sbjct: 424 FGRAAAIRAAQVIDRDAPVPALDIAACDKIMERFDSLRYANGSTPTAVLRDKMQRAMQDD 483

Query: 481 AGVFRTQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSA 540
           A VFRTQ+SL  GC+ LS +W E+ D+KV DRS++WNSDLVETLEL NLM NAI TVY A
Sbjct: 484 AAVFRTQESLESGCQRLSAIWKELPDVKVTDRSMVWNSDLVETLELHNLMANAITTVYGA 543

Query: 541 EARKESRGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVD 600
           EARKESRGSHAREDF DG FGGRDDVNWRKH+L WV    G +KLDYRPVHT+L+  G+D
Sbjct: 544 EARKESRGSHAREDFVDGPFGGRDDVNWRKHTLAWVS-PEGDVKLDYRPVHTDLIADGID 602

Query: 601 YSKIAPKARVY 611
             KI PKARVY
Sbjct: 603 PKKIEPKARVY 613


>gi|222087467|ref|YP_002546004.1| succinate dehydrogenase, flavoprotein subunit [Agrobacterium
           radiobacter K84]
 gi|221724915|gb|ACM28071.1| succinate dehydrogenase, flavoprotein subunit [Agrobacterium
           radiobacter K84]
          Length = 613

 Score = 1069 bits (2764), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 501/611 (81%), Positives = 557/611 (91%), Gaps = 2/611 (0%)

Query: 2   KNSSNLKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQG 61
            +S+    +Y YVDHSYDV+VVGAGGAGLRATLGMAE+GF+TACITKVFPTRSHTVAAQG
Sbjct: 4   NSSAQNGKAYKYVDHSYDVIVVGAGGAGLRATLGMAEQGFRTACITKVFPTRSHTVAAQG 63

Query: 62  GIAASLANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEA 121
           GIAASL NMTPDSWQWHLYDT+KGSDWLGDVDA+QY+ MEAP++VYELEHYGVPFSRNE 
Sbjct: 64  GIAASLQNMTPDSWQWHLYDTVKGSDWLGDVDAMQYMVMEAPKAVYELEHYGVPFSRNEE 123

Query: 122 GKIYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLI 181
           GKIYQRPFGGHMQN+GEGPPVQRTCAAADRTGHAILHTLYGQ+L+NNAEFFIEYFALDLI
Sbjct: 124 GKIYQRPFGGHMQNFGEGPPVQRTCAAADRTGHAILHTLYGQSLRNNAEFFIEYFALDLI 183

Query: 182 INSEGC-CVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARA 240
           ++ +G  C GVVAW L+ G IHRF+AK+VVLATGGYGRAYFSATSAHTCTGDG GMVARA
Sbjct: 184 MSDDGSRCTGVVAWCLDDGTIHRFAAKMVVLATGGYGRAYFSATSAHTCTGDGGGMVARA 243

Query: 241 GLPLQDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVV 300
           GLPL+DMEFVQFHPTGIYG+GCLITEGARGEGGYLVNS+GERFMERYAPSAKDLASRDVV
Sbjct: 244 GLPLEDMEFVQFHPTGIYGSGCLITEGARGEGGYLVNSEGERFMERYAPSAKDLASRDVV 303

Query: 301 SRCMMMEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVI 360
           SRCM +EIREGRGVGK+KDHI L+L+HLDPAVL ERLPGISESARIFAGVDVTR+PIPV+
Sbjct: 304 SRCMTLEIREGRGVGKNKDHIFLHLDHLDPAVLHERLPGISESARIFAGVDVTREPIPVL 363

Query: 361 PTVHYNMGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVV 420
           PTVHYNMGGIPTNYWGEVL+A+S NPER  PGLMA+GEAGCASVHGANRLGSNSLIDLVV
Sbjct: 364 PTVHYNMGGIPTNYWGEVLNADSNNPERVLPGLMAVGEAGCASVHGANRLGSNSLIDLVV 423

Query: 421 FGRAAVIRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLD 480
           FGRAA IRA E+ID+ SP+P +++++CD+IMDRFDRLRHA G  PTA LREKMQRAMQ D
Sbjct: 424 FGRAAAIRAGEVIDRVSPVPPVNVAACDKIMDRFDRLRHASGSTPTAVLREKMQRAMQED 483

Query: 481 AGVFRTQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSA 540
           A VFRTQ+SL  GCR +S +W E++D+KV DRSLIWNSDLVETLEL NLM NAIAT+Y A
Sbjct: 484 AAVFRTQESLESGCRRISEIWKELSDVKVTDRSLIWNSDLVETLELHNLMTNAIATIYGA 543

Query: 541 EARKESRGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVD 600
           EARKESRGSHARED+ +G+FGGRDD NWRKH+L WV+   G +KLDYRPVHTEL+  G+D
Sbjct: 544 EARKESRGSHAREDYTEGKFGGRDDENWRKHTLAWVN-EAGDVKLDYRPVHTELIAEGID 602

Query: 601 YSKIAPKARVY 611
             KI PKARVY
Sbjct: 603 PHKIEPKARVY 613


>gi|116254176|ref|YP_770014.1| succinate dehydrogenase flavoprotein subunit [Rhizobium
           leguminosarum bv. viciae 3841]
 gi|115258824|emb|CAK09930.1| putative succinate dehydrogenase flavoprotein subunit [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 613

 Score = 1066 bits (2757), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 500/603 (82%), Positives = 552/603 (91%), Gaps = 2/603 (0%)

Query: 10  SYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLAN 69
           +Y YVDHSYDV+VVGAGGAGLRATLGMAE+GF+TACITKVFPTRSHTVAAQGGIAASL N
Sbjct: 12  AYRYVDHSYDVIVVGAGGAGLRATLGMAEQGFRTACITKVFPTRSHTVAAQGGIAASLRN 71

Query: 70  MTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRPF 129
           MTPDSWQWHLYDT+KGSDWLGDVDA+QYL MEAP++VYELEHYGVPFSRNE GKIYQRPF
Sbjct: 72  MTPDSWQWHLYDTVKGSDWLGDVDAMQYLTMEAPKAVYELEHYGVPFSRNEEGKIYQRPF 131

Query: 130 GGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGC-C 188
           GGHMQNYGEGPPVQRTCA ADRTGHAILHTLYGQ+L+NNAEFFIEYFALDLI++ +G  C
Sbjct: 132 GGHMQNYGEGPPVQRTCAVADRTGHAILHTLYGQSLRNNAEFFIEYFALDLIMSEDGSRC 191

Query: 189 VGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDME 248
           +GVVAW L+ G IHRF+AK+VVLATGGYGRAYFSATSAHTCTGDG GMVARAGLPLQDME
Sbjct: 192 IGVVAWCLDDGTIHRFAAKMVVLATGGYGRAYFSATSAHTCTGDGGGMVARAGLPLQDME 251

Query: 249 FVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEI 308
           FVQFHPTGIYG+GCLITEGARGEGGYLVNS+GERFMERYAPSAKDLASRDVVSRCM +EI
Sbjct: 252 FVQFHPTGIYGSGCLITEGARGEGGYLVNSEGERFMERYAPSAKDLASRDVVSRCMTLEI 311

Query: 309 REGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMG 368
           REGRGVGK+KDHI L+L+HLDPAVL ERLPGISESA+IFAGVDVTR+PIPV+PTVHYNMG
Sbjct: 312 REGRGVGKAKDHIFLHLDHLDPAVLHERLPGISESAKIFAGVDVTREPIPVLPTVHYNMG 371

Query: 369 GIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIR 428
           GIPTNYWGEVL+A+  NPER  PGLMA+GEAGCASVHGANRLGSNSLIDLVVFGRAA IR
Sbjct: 372 GIPTNYWGEVLNADGANPERIIPGLMAVGEAGCASVHGANRLGSNSLIDLVVFGRAAAIR 431

Query: 429 ASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQD 488
           A E+ID+++PIP L++++CD+IMDRFD LRHA G  PTA LREKMQRAMQ DA VFRTQ+
Sbjct: 432 AGEVIDRAAPIPHLNVAACDKIMDRFDGLRHASGGTPTAELREKMQRAMQEDAAVFRTQE 491

Query: 489 SLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRG 548
           SL  GCR +S +W EM D+KV DRS+IWNSDLVETLELQNLM NAI T+Y AEARKESRG
Sbjct: 492 SLESGCRRISAIWGEMKDIKVTDRSMIWNSDLVETLELQNLMANAITTIYGAEARKESRG 551

Query: 549 SHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPKA 608
           SHARED+ +G F GRDDVNWRKH+L WV+   G++KLDYRPVHTEL+  G+D  KI PKA
Sbjct: 552 SHAREDYTEGAFAGRDDVNWRKHTLAWVN-EAGEVKLDYRPVHTELIAEGIDPHKIEPKA 610

Query: 609 RVY 611
           RVY
Sbjct: 611 RVY 613


>gi|86359476|ref|YP_471368.1| succinate dehydrogenase flavoprotein subunit [Rhizobium etli CFN
           42]
 gi|86283578|gb|ABC92641.1| succinate dehydrogenase, flavoprotein subunit protein [Rhizobium
           etli CFN 42]
          Length = 613

 Score = 1063 bits (2750), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 499/603 (82%), Positives = 550/603 (91%), Gaps = 2/603 (0%)

Query: 10  SYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLAN 69
           +Y YVDHSYDV+VVGAGGAGLRATLGMAE+GF+TACITKVFPTRSHTVAAQGGIAASL N
Sbjct: 12  AYKYVDHSYDVIVVGAGGAGLRATLGMAEQGFRTACITKVFPTRSHTVAAQGGIAASLRN 71

Query: 70  MTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRPF 129
           MTPDSWQWHLYDT+KGSDWLGDVDA+QYL MEAP++VYELEHYGVPFSRNE GKIYQRPF
Sbjct: 72  MTPDSWQWHLYDTVKGSDWLGDVDAMQYLTMEAPKAVYELEHYGVPFSRNEEGKIYQRPF 131

Query: 130 GGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGC-C 188
           GGHMQNYGEGPPVQRTCA ADRTGHAILHTLYGQ+L+NNAEFFIEYFALDLI++ +G  C
Sbjct: 132 GGHMQNYGEGPPVQRTCAVADRTGHAILHTLYGQSLRNNAEFFIEYFALDLIMSEDGSRC 191

Query: 189 VGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDME 248
            GVVAW L+ G IHRF+AK+VVLATGGYGRAYFSATSAHTCTGDG GMVARAGLPLQDME
Sbjct: 192 TGVVAWCLDDGTIHRFAAKMVVLATGGYGRAYFSATSAHTCTGDGGGMVARAGLPLQDME 251

Query: 249 FVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEI 308
           FVQFHPTGIYG+GCLITEGARGEGGYLVNS+GERFMERYAPSAKDLASRDVVSRCM +EI
Sbjct: 252 FVQFHPTGIYGSGCLITEGARGEGGYLVNSEGERFMERYAPSAKDLASRDVVSRCMTLEI 311

Query: 309 REGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMG 368
           REGRGVGK+KDHI L+L+HLDPAVL ERLPGISESA+IFAGVDVTR+PIPV+PTVHYNMG
Sbjct: 312 REGRGVGKNKDHIFLHLDHLDPAVLHERLPGISESAKIFAGVDVTREPIPVLPTVHYNMG 371

Query: 369 GIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIR 428
           GIPTNYWGEVL+A+  NPER  PGLMA+GEAGCASVHGANRLGSNSLIDLVVFGRAA IR
Sbjct: 372 GIPTNYWGEVLNADGANPERIIPGLMAVGEAGCASVHGANRLGSNSLIDLVVFGRAAAIR 431

Query: 429 ASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQD 488
           A E+ID+++PIP L++++CD+IMDRFD LRHA G  PTA LREKMQRAMQ DA VFRTQ+
Sbjct: 432 AGEVIDRAAPIPHLNVAACDKIMDRFDGLRHASGGTPTADLREKMQRAMQEDAAVFRTQE 491

Query: 489 SLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRG 548
           SL  GCR +S +W EM D+KV DRS++WNSDLVETLELQNLM NAI T+Y AEARKESRG
Sbjct: 492 SLESGCRRISAIWQEMRDIKVTDRSMVWNSDLVETLELQNLMANAITTIYGAEARKESRG 551

Query: 549 SHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPKA 608
           SHARED+ +G F GRDDVNWRKH+L WV+   G +KLDYRPVHTEL+  G+D  KI PKA
Sbjct: 552 SHAREDYTEGAFAGRDDVNWRKHTLAWVN-EAGDVKLDYRPVHTELIAEGIDPHKIEPKA 610

Query: 609 RVY 611
           RVY
Sbjct: 611 RVY 613


>gi|241206662|ref|YP_002977758.1| succinate dehydrogenase flavoprotein subunit [Rhizobium
           leguminosarum bv. trifolii WSM1325]
 gi|240860552|gb|ACS58219.1| succinate dehydrogenase or fumarate reductase, flavoprotein subunit
           [Rhizobium leguminosarum bv. trifolii WSM1325]
          Length = 613

 Score = 1062 bits (2747), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 498/603 (82%), Positives = 550/603 (91%), Gaps = 2/603 (0%)

Query: 10  SYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLAN 69
           +Y YVDHSYDV+VVGAGGAGLRATLGMAE+GF+TACITKVFPTRSHTVAAQGGIAASL N
Sbjct: 12  AYKYVDHSYDVIVVGAGGAGLRATLGMAEQGFRTACITKVFPTRSHTVAAQGGIAASLRN 71

Query: 70  MTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRPF 129
           MTPDSWQWHLYDT+KGSDWLGDVDA+QYL MEAP++VYELEHYGVPFSRNE GKIYQRPF
Sbjct: 72  MTPDSWQWHLYDTVKGSDWLGDVDAMQYLTMEAPKAVYELEHYGVPFSRNEEGKIYQRPF 131

Query: 130 GGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGC-C 188
           GGHMQNYGEGPPVQRTCA ADRTGHAILHTLYGQ+L+NNAEFFIEYFALDLI++ +G  C
Sbjct: 132 GGHMQNYGEGPPVQRTCAVADRTGHAILHTLYGQSLRNNAEFFIEYFALDLIMSEDGSRC 191

Query: 189 VGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDME 248
            GV+AW L+ G IHRF+AK+VVLATGGYGRAYFSATSAHTCTGDG GMVARAGLPLQDME
Sbjct: 192 TGVIAWCLDDGTIHRFAAKMVVLATGGYGRAYFSATSAHTCTGDGGGMVARAGLPLQDME 251

Query: 249 FVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEI 308
           FVQFHPTGIYG+GCLITEGARGEGGYLVNS+GERFMERYAPSAKDLASRDVVSRCM +EI
Sbjct: 252 FVQFHPTGIYGSGCLITEGARGEGGYLVNSEGERFMERYAPSAKDLASRDVVSRCMTLEI 311

Query: 309 REGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMG 368
           REGRGVGK+KDHI L+L+HLDPAVL ERLPGISESA+IFAGVDVTR+PIPV+PTVHYNMG
Sbjct: 312 REGRGVGKAKDHIFLHLDHLDPAVLHERLPGISESAKIFAGVDVTREPIPVLPTVHYNMG 371

Query: 369 GIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIR 428
           GIPTNYWGEVL+A+  NPER  PGLMA+GEAGCASVHGANRLGSNSLIDLVVFGRAA IR
Sbjct: 372 GIPTNYWGEVLNADGANPERIIPGLMAVGEAGCASVHGANRLGSNSLIDLVVFGRAAAIR 431

Query: 429 ASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQD 488
           A E+ID+++PIP L++++CD+IMDRFD LRHA G  PTA LREKMQRAMQ DA VFRTQ+
Sbjct: 432 AGEVIDRAAPIPHLNVAACDKIMDRFDGLRHASGGTPTAELREKMQRAMQEDAAVFRTQE 491

Query: 489 SLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRG 548
           SL  GC+ +S +W EM D+KV DRS+IWNSDLVETLELQNLM NAI T+Y AEARKESRG
Sbjct: 492 SLESGCQRISAIWGEMKDIKVTDRSMIWNSDLVETLELQNLMANAITTIYGAEARKESRG 551

Query: 549 SHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPKA 608
           SHARED+ +G F GRDDVNWRKH+L WV+   G +KLDYRPVHTEL+  G+D  KI PKA
Sbjct: 552 SHAREDYTEGAFAGRDDVNWRKHTLAWVN-EAGDVKLDYRPVHTELIAEGIDPHKIEPKA 610

Query: 609 RVY 611
           RVY
Sbjct: 611 RVY 613


>gi|209551262|ref|YP_002283179.1| succinate dehydrogenase flavoprotein subunit [Rhizobium
           leguminosarum bv. trifolii WSM2304]
 gi|209537018|gb|ACI56953.1| succinate dehydrogenase, flavoprotein subunit [Rhizobium
           leguminosarum bv. trifolii WSM2304]
          Length = 613

 Score = 1061 bits (2745), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 499/603 (82%), Positives = 549/603 (91%), Gaps = 2/603 (0%)

Query: 10  SYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLAN 69
           +Y YVDHSYDV+VVGAGGAGLRATLGMAE+GF+TACITKVFPTRSHTVAAQGGIAASL N
Sbjct: 12  AYKYVDHSYDVIVVGAGGAGLRATLGMAEQGFRTACITKVFPTRSHTVAAQGGIAASLRN 71

Query: 70  MTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRPF 129
           MTPDSWQWHLYDT+KGSDWLGDVDA+QYL MEAP++VYELEHYGVPFSRNE GKIYQRPF
Sbjct: 72  MTPDSWQWHLYDTVKGSDWLGDVDAMQYLTMEAPKAVYELEHYGVPFSRNEEGKIYQRPF 131

Query: 130 GGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGC-C 188
           GGHMQNYGEGPPVQRTCA ADRTGHAILHTLYGQ+L++NAEFFIEYFALDLI++ +G  C
Sbjct: 132 GGHMQNYGEGPPVQRTCAVADRTGHAILHTLYGQSLRHNAEFFIEYFALDLIMSEDGSRC 191

Query: 189 VGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDME 248
            GVVAW L+ G IHRF+AK+VVLATGGYGRAYFSATSAHTCTGDG GMVARAGLPLQDME
Sbjct: 192 TGVVAWCLDDGTIHRFAAKMVVLATGGYGRAYFSATSAHTCTGDGGGMVARAGLPLQDME 251

Query: 249 FVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEI 308
           FVQFHPTGIYG+GCLITEGARGEGGYLVNS+GERFMERYAPSAKDLASRDVVSRCM +EI
Sbjct: 252 FVQFHPTGIYGSGCLITEGARGEGGYLVNSEGERFMERYAPSAKDLASRDVVSRCMTLEI 311

Query: 309 REGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMG 368
           REGRGVGK+KDHI L+L+HLDPAVL ERLPGISESA+IFAGVDVTR+PIPV+PTVHYNMG
Sbjct: 312 REGRGVGKNKDHIFLHLDHLDPAVLHERLPGISESAKIFAGVDVTREPIPVLPTVHYNMG 371

Query: 369 GIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIR 428
           GIPTNYWGEVL+A+  NPER  PGLMA+GEAGCASVHGANRLGSNSLIDLVVFGRAA IR
Sbjct: 372 GIPTNYWGEVLNADGANPERIIPGLMAVGEAGCASVHGANRLGSNSLIDLVVFGRAAAIR 431

Query: 429 ASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQD 488
           A E+ID+++PIP L++S+CD+IMDRFD LRHA G  PTA LREKMQRAMQ DA VFRTQ+
Sbjct: 432 AGEVIDRAAPIPHLNVSACDKIMDRFDGLRHASGSTPTAELREKMQRAMQEDAAVFRTQE 491

Query: 489 SLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRG 548
           SL  GCR +S +W EM D+KV DRS+IWNSDLVETLELQNLM NAI T+Y AEARKESRG
Sbjct: 492 SLESGCRRISAIWQEMRDIKVTDRSMIWNSDLVETLELQNLMANAITTIYGAEARKESRG 551

Query: 549 SHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPKA 608
           SHARED+ +G F GRDDVNWRKH+L WV    G +KLDYRPVHT+L+  G+D  KI PKA
Sbjct: 552 SHAREDYTEGAFAGRDDVNWRKHTLAWVS-EAGDVKLDYRPVHTDLIAEGIDPHKIEPKA 610

Query: 609 RVY 611
           RVY
Sbjct: 611 RVY 613


>gi|190893744|ref|YP_001980286.1| succinate dehydrogenase, flavoprotein subunit [Rhizobium etli CIAT
           652]
 gi|190699023|gb|ACE93108.1| succinate dehydrogenase protein, flavoprotein subunit [Rhizobium
           etli CIAT 652]
          Length = 613

 Score = 1061 bits (2745), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 496/603 (82%), Positives = 551/603 (91%), Gaps = 2/603 (0%)

Query: 10  SYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLAN 69
           +Y YVDHSYDV+VVGAGGAGLRATLGMAE+GF+TACITKVFPTRSHTVAAQGGIAASL N
Sbjct: 12  AYNYVDHSYDVIVVGAGGAGLRATLGMAEQGFRTACITKVFPTRSHTVAAQGGIAASLRN 71

Query: 70  MTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRPF 129
           MTPDSWQWHLYDT+KGSDWLGDVDA+QYL MEAP++VYELEHYGVPFSRNE GKIYQRPF
Sbjct: 72  MTPDSWQWHLYDTVKGSDWLGDVDAMQYLTMEAPKAVYELEHYGVPFSRNEEGKIYQRPF 131

Query: 130 GGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGC-C 188
           GGHMQNYGEGPPVQRTCA ADRTGHAILHTLYGQ+L++NAEFFIEYFALDLI++ +G  C
Sbjct: 132 GGHMQNYGEGPPVQRTCAVADRTGHAILHTLYGQSLRHNAEFFIEYFALDLIMSEDGSRC 191

Query: 189 VGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDME 248
            GV+AW L+ G IHRF+AK+VVLATGGYGRAYFSATSAHTCTGDG GMVARAGLPLQDME
Sbjct: 192 TGVIAWCLDDGTIHRFAAKMVVLATGGYGRAYFSATSAHTCTGDGGGMVARAGLPLQDME 251

Query: 249 FVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEI 308
           FVQFHPTGIYG+GCLITEGARGEGGYLVNS+GERFMERYAPSAKDLASRDVVSRCM +EI
Sbjct: 252 FVQFHPTGIYGSGCLITEGARGEGGYLVNSEGERFMERYAPSAKDLASRDVVSRCMTLEI 311

Query: 309 REGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMG 368
           REGRGVGK+KDHI L+L+HLDPAVL ERLPGISESA+IFAGVDVTR+PIPV+PTVHYNMG
Sbjct: 312 REGRGVGKNKDHIFLHLDHLDPAVLHERLPGISESAKIFAGVDVTREPIPVLPTVHYNMG 371

Query: 369 GIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIR 428
           GIPTNYWGEVL+A+  NPER  PGLMA+GEAGCASVHGANRLGSNSLIDLVVFGRAA IR
Sbjct: 372 GIPTNYWGEVLNADGANPERIIPGLMAVGEAGCASVHGANRLGSNSLIDLVVFGRAAAIR 431

Query: 429 ASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQD 488
           A E+ID+++P+P L++++CD+IMDRFD LRHA G  PTA LREKMQRAMQ DA VFRTQ+
Sbjct: 432 AGEVIDRAAPVPHLNVAACDKIMDRFDGLRHASGGTPTAELREKMQRAMQEDAAVFRTQE 491

Query: 489 SLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRG 548
           SL  GCR +S +W EM D+KV DRS++WNSDLVETLELQNLM NAI T+Y AEARKESRG
Sbjct: 492 SLESGCRRISAIWQEMRDIKVTDRSMVWNSDLVETLELQNLMANAITTIYGAEARKESRG 551

Query: 549 SHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPKA 608
           SHARED+ +G F GRDDVNWRKH+L WVD + G +KLDYRPVHT+L+  G+D  KI PKA
Sbjct: 552 SHAREDYTEGAFAGRDDVNWRKHTLAWVD-DAGDVKLDYRPVHTDLIAEGIDPHKIEPKA 610

Query: 609 RVY 611
           RVY
Sbjct: 611 RVY 613


>gi|222150046|ref|YP_002551003.1| succinate dehydrogenase flavoprotein subunit [Agrobacterium vitis
           S4]
 gi|221737028|gb|ACM37991.1| succinate dehydrogenase flavoprotein subunit [Agrobacterium vitis
           S4]
          Length = 618

 Score = 1056 bits (2732), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 505/602 (83%), Positives = 556/602 (92%), Gaps = 1/602 (0%)

Query: 10  SYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLAN 69
           SYTYVDH+YDVVVVGAGGAGLRATLGMAE+GFKTACITKVFPTRSHTVAAQGGIAASL N
Sbjct: 18  SYTYVDHAYDVVVVGAGGAGLRATLGMAEQGFKTACITKVFPTRSHTVAAQGGIAASLNN 77

Query: 70  MTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRPF 129
           MTPD WQWHLYDT+KGSDWLGDVDA+QYLAMEAP++VYELEHYGVPFSRNE GKIYQRPF
Sbjct: 78  MTPDCWQWHLYDTVKGSDWLGDVDAMQYLAMEAPKAVYELEHYGVPFSRNEEGKIYQRPF 137

Query: 130 GGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCCV 189
           GGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQ+LK+NAEFFIEYFALDLI+  +G C 
Sbjct: 138 GGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQSLKHNAEFFIEYFALDLIMAEDGRCT 197

Query: 190 GVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDMEF 249
           GVVAW L+ G IHRFSAK+VVLATGGYGRAYFSATSAHTCTGDG GM+ARAGLPLQDMEF
Sbjct: 198 GVVAWNLDDGTIHRFSAKMVVLATGGYGRAYFSATSAHTCTGDGGGMIARAGLPLQDMEF 257

Query: 250 VQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEIR 309
           VQFHPTGIYGAGCLITEGARGEGGYLVNS+GERFMERYAPSAKDLASRDVVSRCM +EIR
Sbjct: 258 VQFHPTGIYGAGCLITEGARGEGGYLVNSEGERFMERYAPSAKDLASRDVVSRCMTLEIR 317

Query: 310 EGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMGG 369
           EGRGVGK+KDHI+L+L+HLDPAVL ERLPGISESA+IFAGVDVTR+PIPV+PTVHYNMGG
Sbjct: 318 EGRGVGKNKDHIYLHLDHLDPAVLHERLPGISESAKIFAGVDVTREPIPVLPTVHYNMGG 377

Query: 370 IPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIRA 429
           IPTNYWGEVL+A+++NPER APGLMA+GEAGCASVHGANRLGSNSLIDLVVFGRAA IRA
Sbjct: 378 IPTNYWGEVLNADAENPERIAPGLMAVGEAGCASVHGANRLGSNSLIDLVVFGRAAAIRA 437

Query: 430 SEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQDS 489
           +E+ID+ SPIP+L++++CD+IM+RFD +RH+ G  PTA LR+KMQRAMQ DA VFRTQ++
Sbjct: 438 AEVIDRVSPIPALNVAACDKIMERFDAIRHSSGSTPTAVLRDKMQRAMQEDAAVFRTQEA 497

Query: 490 LSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRGS 549
           L  GCR +S +W EM D+KV DRSL+WNSDLVETLEL NLM NAI TVY AEARKESRGS
Sbjct: 498 LESGCRRISEIWKEMPDIKVTDRSLVWNSDLVETLELHNLMANAITTVYGAEARKESRGS 557

Query: 550 HAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPKAR 609
           HAREDF DG +GGRDDVNWRKH+L WV+   G +KLDYRPVHTELL  G+D  KI PKAR
Sbjct: 558 HAREDFVDGPYGGRDDVNWRKHTLAWVN-EAGDVKLDYRPVHTELLADGIDPKKIEPKAR 616

Query: 610 VY 611
           VY
Sbjct: 617 VY 618


>gi|150398154|ref|YP_001328621.1| succinate dehydrogenase flavoprotein subunit [Sinorhizobium medicae
           WSM419]
 gi|150029669|gb|ABR61786.1| succinate dehydrogenase, flavoprotein subunit [Sinorhizobium
           medicae WSM419]
          Length = 613

 Score = 1049 bits (2713), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 498/602 (82%), Positives = 556/602 (92%), Gaps = 1/602 (0%)

Query: 10  SYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLAN 69
           +Y YVDHS+DVVVVGAGGAGLRATLGMAE+G +TACITKVFPTRSHTVAAQGGIAASL N
Sbjct: 13  AYKYVDHSFDVVVVGAGGAGLRATLGMAEQGLRTACITKVFPTRSHTVAAQGGIAASLQN 72

Query: 70  MTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRPF 129
           MTPD WQWHLYDT+KGSDWLGDVDA+QYLAMEAP++VYELEHYGVPFSRNE GKIYQRPF
Sbjct: 73  MTPDCWQWHLYDTVKGSDWLGDVDAMQYLAMEAPKAVYELEHYGVPFSRNEEGKIYQRPF 132

Query: 130 GGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCCV 189
           GGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQ+L+NNAEFFIEYFA+DLI++ +G C 
Sbjct: 133 GGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQSLRNNAEFFIEYFAIDLIMSDDGRCT 192

Query: 190 GVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDMEF 249
           GVVAW L+ G IHRF+AK+VVLATGGYGRAYFSATSAHTCTGDG GM+ARAGLPLQDMEF
Sbjct: 193 GVVAWNLDDGTIHRFAAKMVVLATGGYGRAYFSATSAHTCTGDGGGMIARAGLPLQDMEF 252

Query: 250 VQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEIR 309
           VQFHPTGIYGAGCLITEGARGEGGYLVNS+GERFMERYAPSAKDLASRDVVSRCM MEIR
Sbjct: 253 VQFHPTGIYGAGCLITEGARGEGGYLVNSEGERFMERYAPSAKDLASRDVVSRCMTMEIR 312

Query: 310 EGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMGG 369
           EGRGVGK+KDHI L+L+HLDPAVL ERLPGISESA+IFAGVDVTR+PIPV+PTVHYNMGG
Sbjct: 313 EGRGVGKNKDHIFLHLDHLDPAVLHERLPGISESAKIFAGVDVTREPIPVLPTVHYNMGG 372

Query: 370 IPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIRA 429
           +PTNYWGEVL+A+S+NPER APGLMA+GEAGCASVHGANRLGSNSLIDLVVFGRAA IRA
Sbjct: 373 VPTNYWGEVLNADSQNPERIAPGLMAVGEAGCASVHGANRLGSNSLIDLVVFGRAAAIRA 432

Query: 430 SEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQDS 489
            ++ID+++ +P +DI++CDRIMDRFDRLRHA+G  PTA LR+KMQRAMQ DA VFRTQ+S
Sbjct: 433 GQIIDRNAAVPEVDIAACDRIMDRFDRLRHANGATPTAVLRDKMQRAMQEDAAVFRTQES 492

Query: 490 LSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRGS 549
           L  GCR LS +W E+ D++V DRS+IWNSDLVETLEL+NLM NAI TVY AEARKESRG+
Sbjct: 493 LESGCRRLSAIWKELPDIRVTDRSMIWNSDLVETLELENLMANAITTVYGAEARKESRGA 552

Query: 550 HAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPKAR 609
           HARED+KDG  GGRDDVNWRKH+L WV+ + G ++LD+RPVHTEL+  G+D  KI PKAR
Sbjct: 553 HAREDYKDGPLGGRDDVNWRKHTLAWVN-DAGDVRLDFRPVHTELIAEGIDPYKIEPKAR 611

Query: 610 VY 611
           VY
Sbjct: 612 VY 613


>gi|227823650|ref|YP_002827623.1| succinate dehydrogenase flavoprotein subunit [Sinorhizobium fredii
           NGR234]
 gi|227342652|gb|ACP26870.1| succinate dehydrogenase flavoprotein subunit [Sinorhizobium fredii
           NGR234]
          Length = 613

 Score = 1045 bits (2703), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 495/602 (82%), Positives = 553/602 (91%), Gaps = 1/602 (0%)

Query: 10  SYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLAN 69
           +Y YVDH++DVVVVGAGGAGLRATLGMAE+G KTACITKVFPTRSHTVAAQGGIAASL N
Sbjct: 13  AYQYVDHAFDVVVVGAGGAGLRATLGMAEQGLKTACITKVFPTRSHTVAAQGGIAASLQN 72

Query: 70  MTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRPF 129
           MTPDSWQWHLYDT+KGSDWLGDVDA+QYLAMEAP++VYELEHYGVPFSRNE GKIYQRPF
Sbjct: 73  MTPDSWQWHLYDTVKGSDWLGDVDAMQYLAMEAPKAVYELEHYGVPFSRNEEGKIYQRPF 132

Query: 130 GGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCCV 189
           GGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQ+L+NNAEFFIEYFALDLI++ +G C 
Sbjct: 133 GGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQSLRNNAEFFIEYFALDLIMSDDGRCT 192

Query: 190 GVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDMEF 249
           GVVAW L+ G IHR +AK+VVLATGGYGRAYFSATSAHTCTGDG GM+ARAGLPLQDMEF
Sbjct: 193 GVVAWNLDDGTIHRLAAKMVVLATGGYGRAYFSATSAHTCTGDGGGMIARAGLPLQDMEF 252

Query: 250 VQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEIR 309
           VQFHPTGIYGAGCLITEGARGEGGYLVNS+GERFMERYAPSAKDLASRDVVSRCM MEIR
Sbjct: 253 VQFHPTGIYGAGCLITEGARGEGGYLVNSEGERFMERYAPSAKDLASRDVVSRCMTMEIR 312

Query: 310 EGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMGG 369
           EGRGVGK+KDHI L+L+HLDP VL ERLPGISESA+IFAGVDVTR+PIPV+PTVHYNMGG
Sbjct: 313 EGRGVGKNKDHIFLHLDHLDPKVLHERLPGISESAKIFAGVDVTREPIPVLPTVHYNMGG 372

Query: 370 IPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIRA 429
           +PTNYWGEVL+A+++NPER APGLMA+GEAGCASVHGANRLGSNSLIDLVVFGRAA IRA
Sbjct: 373 VPTNYWGEVLNADAQNPERIAPGLMAVGEAGCASVHGANRLGSNSLIDLVVFGRAAAIRA 432

Query: 430 SEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQDS 489
            ++ID++  +P +D ++ DRIM+RFDRLRHA G  PTA LR+KMQRAMQ DA VFRTQ+S
Sbjct: 433 GQIIDRNEAVPEVDTAASDRIMERFDRLRHARGGTPTAVLRDKMQRAMQEDAAVFRTQES 492

Query: 490 LSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRGS 549
           L  GC+ LS +W E+ D+KV DRS+IWNSDLVETLEL+NLM NAI TVY AEARKESRG+
Sbjct: 493 LESGCKRLSAIWKELPDVKVTDRSMIWNSDLVETLELENLMANAITTVYGAEARKESRGA 552

Query: 550 HAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPKAR 609
           HARED+KDG  GGRDD NWRKH+L WV+ +TG+++L+YRPVHTEL+ GG+D  KI PKAR
Sbjct: 553 HAREDYKDGPLGGRDDTNWRKHTLAWVN-DTGEVRLEYRPVHTELIAGGIDPKKIEPKAR 611

Query: 610 VY 611
           VY
Sbjct: 612 VY 613


>gi|15966823|ref|NP_387176.1| succinate dehydrogenase flavoprotein subunit [Sinorhizobium
           meliloti 1021]
 gi|307301651|ref|ZP_07581410.1| succinate dehydrogenase or fumarate reductase, flavoprotein subunit
           [Sinorhizobium meliloti BL225C]
 gi|307316325|ref|ZP_07595769.1| succinate dehydrogenase or fumarate reductase, flavoprotein subunit
           [Sinorhizobium meliloti AK83]
 gi|15076095|emb|CAC47649.1| Probable succinate dehydrogenase flavoprotein subunit
           [Sinorhizobium meliloti 1021]
 gi|306898165|gb|EFN28907.1| succinate dehydrogenase or fumarate reductase, flavoprotein subunit
           [Sinorhizobium meliloti AK83]
 gi|306903349|gb|EFN33938.1| succinate dehydrogenase or fumarate reductase, flavoprotein subunit
           [Sinorhizobium meliloti BL225C]
          Length = 613

 Score = 1044 bits (2699), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 495/602 (82%), Positives = 554/602 (92%), Gaps = 1/602 (0%)

Query: 10  SYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLAN 69
           +Y YVDHS+DVVVVGAGGAGLRATLGMAE+G +TACITKVFPTRSHTVAAQGGIAASL N
Sbjct: 13  AYQYVDHSFDVVVVGAGGAGLRATLGMAEQGLRTACITKVFPTRSHTVAAQGGIAASLQN 72

Query: 70  MTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRPF 129
           MTPDSWQWHLYDT+KGSDWLGDVDA+QYLAMEAP++VYELEHYGVPFSRN  GKIYQRPF
Sbjct: 73  MTPDSWQWHLYDTVKGSDWLGDVDAMQYLAMEAPKAVYELEHYGVPFSRNAEGKIYQRPF 132

Query: 130 GGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCCV 189
           GGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQ+L+NNAEFFIEYFA+DLI++ +G C 
Sbjct: 133 GGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQSLRNNAEFFIEYFAIDLIMSDDGRCT 192

Query: 190 GVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDMEF 249
           GVVAW L+ G IHRF+AK+VVLATGGYGRAYFSATSAHTCTGDG GM+ARAGLPLQDMEF
Sbjct: 193 GVVAWNLDDGTIHRFAAKMVVLATGGYGRAYFSATSAHTCTGDGGGMIARAGLPLQDMEF 252

Query: 250 VQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEIR 309
           VQFHPTGIYGAGCLITEGARGEGGYLVNS+GERFMERYAPSAKDLASRDVVSRCM MEIR
Sbjct: 253 VQFHPTGIYGAGCLITEGARGEGGYLVNSEGERFMERYAPSAKDLASRDVVSRCMTMEIR 312

Query: 310 EGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMGG 369
           EGRGVGK+KDHI L+L+HLDPAVL ERLPGISESA+IFAGVDVTR+PIPV+PTVHYNMGG
Sbjct: 313 EGRGVGKNKDHIFLHLDHLDPAVLHERLPGISESAKIFAGVDVTREPIPVLPTVHYNMGG 372

Query: 370 IPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIRA 429
           +PTNYWGEVL+A+S+NPER APGLMA+GEAGCASVHGANRLGSNSLIDLVVFGRAA IRA
Sbjct: 373 VPTNYWGEVLNADSQNPERIAPGLMAVGEAGCASVHGANRLGSNSLIDLVVFGRAAAIRA 432

Query: 430 SEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQDS 489
            ++ID++  +P ++ ++CDRIM+RFDRLRHA+G  PTA LR+KMQRAMQ DA VFRTQ+S
Sbjct: 433 GQIIDRNEAVPEVNTAACDRIMERFDRLRHANGTTPTAVLRDKMQRAMQEDAAVFRTQES 492

Query: 490 LSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRGS 549
           L  GCR LS +W E+ D++V DRS+IWNSDLVETLEL+NLM NAI TVY AEARKESRG+
Sbjct: 493 LESGCRRLSAIWKELPDVRVTDRSMIWNSDLVETLELENLMANAITTVYGAEARKESRGA 552

Query: 550 HAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPKAR 609
           HARED+KDG  GGRDDVNWRKH+L WV+ + G ++LD+RPVHTEL+  G+D  KI PKAR
Sbjct: 553 HAREDYKDGPLGGRDDVNWRKHTLAWVN-DAGDVRLDFRPVHTELIAEGIDPYKIEPKAR 611

Query: 610 VY 611
           VY
Sbjct: 612 VY 613


>gi|163761419|ref|ZP_02168493.1| succinate dehydrogenase [Hoeflea phototrophica DFL-43]
 gi|162281414|gb|EDQ31711.1| succinate dehydrogenase [Hoeflea phototrophica DFL-43]
          Length = 611

 Score = 1035 bits (2677), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 496/612 (81%), Positives = 552/612 (90%), Gaps = 2/612 (0%)

Query: 1   MKNSSNLKS-SYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAA 59
           M +S N+   +YT VDH+YDVVVVGAGGAGLRATLGMAE+GF+TACI+KVFPTRSHTVAA
Sbjct: 1   MTSSVNIGGRAYTIVDHAYDVVVVGAGGAGLRATLGMAEQGFRTACISKVFPTRSHTVAA 60

Query: 60  QGGIAASLANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRN 119
           QGGIAASL NMTPDSWQWH+YDT+KGSDWLGDVDA+QYL MEAP++VYELEHYGVPFSR 
Sbjct: 61  QGGIAASLTNMTPDSWQWHMYDTVKGSDWLGDVDAMQYLTMEAPKAVYELEHYGVPFSRT 120

Query: 120 EAGKIYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALD 179
           E G+IYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQ+LKNNAEFFIEYFA D
Sbjct: 121 EDGRIYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQSLKNNAEFFIEYFATD 180

Query: 180 LIINSEGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVAR 239
           L++  +G C GVVAW L+ G IHRFSAK+VVLATGGYGRAYFSATSAHTCTGDG GM+AR
Sbjct: 181 LLMEEDGRCTGVVAWNLDDGTIHRFSAKMVVLATGGYGRAYFSATSAHTCTGDGGGMIAR 240

Query: 240 AGLPLQDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDV 299
           AGLPLQDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNS+GERFMERYAPSAKDLASRDV
Sbjct: 241 AGLPLQDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSEGERFMERYAPSAKDLASRDV 300

Query: 300 VSRCMMMEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPV 359
           VSRCM MEIREGRGVGK+KDHI L+L+HLDPAVL ERLPGISESA+IFAGVDVTR+PIPV
Sbjct: 301 VSRCMTMEIREGRGVGKAKDHIFLHLDHLDPAVLHERLPGISESAKIFAGVDVTREPIPV 360

Query: 360 IPTVHYNMGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLV 419
           +PTVHYNMGGIPTNYWGEVL+   K+P++  PGLMA+GEAGCASVHGANRLGSNSLIDLV
Sbjct: 361 LPTVHYNMGGIPTNYWGEVLNPTKKDPDKVTPGLMAVGEAGCASVHGANRLGSNSLIDLV 420

Query: 420 VFGRAAVIRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQL 479
           VFGRAA IRA E+ID++S IP ++ +S +++M RFD +RHA+G  PTA LREKMQR MQ 
Sbjct: 421 VFGRAAAIRAGEVIDRASSIPPVNEASFEKVMTRFDAVRHANGSTPTAELREKMQRTMQE 480

Query: 480 DAGVFRTQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYS 539
           DA VFRTQ+SL  GC+ +S +WDE+ D+KV DRSLIWNSDL+ETLEL NLM NAI TVYS
Sbjct: 481 DAAVFRTQESLESGCKRMSAIWDELPDVKVTDRSLIWNSDLMETLELDNLMANAITTVYS 540

Query: 540 AEARKESRGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGV 599
           AEARKESRGSHARED+ +G FGGRDD NWRKHSL WVD   GK+KLDYRPVHTEL+  G+
Sbjct: 541 AEARKESRGSHAREDYVEGAFGGRDDENWRKHSLAWVD-EKGKVKLDYRPVHTELIADGI 599

Query: 600 DYSKIAPKARVY 611
           D +KIAPKARVY
Sbjct: 600 DIAKIAPKARVY 611


>gi|307942785|ref|ZP_07658130.1| succinate dehydrogenase, flavoprotein subunit [Roseibium sp.
           TrichSKD4]
 gi|307773581|gb|EFO32797.1| succinate dehydrogenase, flavoprotein subunit [Roseibium sp.
           TrichSKD4]
          Length = 608

 Score = 1013 bits (2620), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 485/609 (79%), Positives = 543/609 (89%), Gaps = 5/609 (0%)

Query: 7   LKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAAS 66
           +  +Y +VDH+YDVVVVGAGGAGLRATLGMAE+G +TACITKVFPTRSHTVAAQGGIAAS
Sbjct: 1   MAKTYEFVDHTYDVVVVGAGGAGLRATLGMAEQGLRTACITKVFPTRSHTVAAQGGIAAS 60

Query: 67  LANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQ 126
           L NMTPDSW+WH+YDT+KGSDWLGD DA++YLA EAP++VYELEHYGVPFSR E G+IYQ
Sbjct: 61  LKNMTPDSWEWHMYDTVKGSDWLGDSDAMEYLAREAPKAVYELEHYGVPFSRTEDGRIYQ 120

Query: 127 RPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEG 186
           RPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQ+L+NNAEF+IEYFALDLI++ +G
Sbjct: 121 RPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQSLRNNAEFYIEYFALDLIMSEDG 180

Query: 187 CCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQD 246
            C GV+AW L+ G IHRF+AK+VVLATGGYGRAYFSATSAHTCTGDG GMVARAGLP+QD
Sbjct: 181 VCQGVIAWNLDDGTIHRFAAKMVVLATGGYGRAYFSATSAHTCTGDGGGMVARAGLPMQD 240

Query: 247 MEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMM 306
           MEFVQFHPTGIYG+GCLITEGARGEGGYLVNS+GERFMERYAPSAKDLASRDVVSRCM M
Sbjct: 241 MEFVQFHPTGIYGSGCLITEGARGEGGYLVNSEGERFMERYAPSAKDLASRDVVSRCMTM 300

Query: 307 EIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYN 366
           EIREGRGVGK+KDHI L+L+HLDPA+L ERLPGISESA+IFAGVDVT++PIPV+PTVHYN
Sbjct: 301 EIREGRGVGKNKDHIFLHLDHLDPALLAERLPGISESAKIFAGVDVTKEPIPVLPTVHYN 360

Query: 367 MGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAV 426
           MGGIPTNYWGEVLDA+ ++P R  PGLMA+GEAGCASVHGANRLGSNSLIDLVVFGRAA 
Sbjct: 361 MGGIPTNYWGEVLDASGQHPNRIQPGLMAVGEAGCASVHGANRLGSNSLIDLVVFGRAAA 420

Query: 427 IRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRT 486
           IRA+E++D     P    +SC++IMDRFDRLRHADG  PTA LR+KMQR MQ DA VFRT
Sbjct: 421 IRAAEVVDPKEATPKPSEASCEKIMDRFDRLRHADGATPTANLRDKMQRTMQEDAAVFRT 480

Query: 487 QDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKES 546
           Q+SL  GC+ +S +W EM DLKV DRSLIWNSDLVETLEL+NLM NAI TVY AEARKES
Sbjct: 481 QESLEQGCKRMSSIWGEMKDLKVTDRSLIWNSDLVETLELENLMANAITTVYGAEARKES 540

Query: 547 RGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLC----GGVDYS 602
           RG+HARED+KDG  GGR+D  WRKH+L WVD + G +KLDYRPV TE L     GG+D  
Sbjct: 541 RGAHAREDYKDGALGGRNDAEWRKHTLSWVD-DEGNVKLDYRPVVTEPLTSFQDGGIDPK 599

Query: 603 KIAPKARVY 611
           KIAPKARVY
Sbjct: 600 KIAPKARVY 608


>gi|118590535|ref|ZP_01547937.1| succinate dehydrogenase flavoprotein subunit [Stappia aggregata IAM
           12614]
 gi|118436998|gb|EAV43637.1| succinate dehydrogenase flavoprotein subunit [Stappia aggregata IAM
           12614]
          Length = 608

 Score = 1004 bits (2597), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 482/609 (79%), Positives = 542/609 (88%), Gaps = 5/609 (0%)

Query: 7   LKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAAS 66
           +  +Y +VDH+YDVVVVGAGGAGLRATLGMAE+G +TACITKVFPTRSHTVAAQGGIAAS
Sbjct: 1   MAKTYEFVDHTYDVVVVGAGGAGLRATLGMAEQGLRTACITKVFPTRSHTVAAQGGIAAS 60

Query: 67  LANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQ 126
           L NMTPD W+WH+YDT+KGSDWLGD DA++YLA EAP++VYELEHYGVPFSR E G+IYQ
Sbjct: 61  LKNMTPDCWEWHMYDTVKGSDWLGDTDAMEYLAREAPKAVYELEHYGVPFSRTEDGRIYQ 120

Query: 127 RPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEG 186
           RPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQ+L+NNAEF+IEYFALDLI++ +G
Sbjct: 121 RPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQSLRNNAEFYIEYFALDLIMSEDG 180

Query: 187 CCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQD 246
            C GV+AW L+ G +HRF+AK+VVLATGGYGRA+FSATSAHTCTGDG GMVARAGLPLQD
Sbjct: 181 VCQGVIAWNLDDGTMHRFAAKMVVLATGGYGRAFFSATSAHTCTGDGGGMVARAGLPLQD 240

Query: 247 MEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMM 306
           MEFVQFHPTGIYG+GCLITEGARGEGGYLVNS+GERFMERYAPSAKDLASRDVVSRCM M
Sbjct: 241 MEFVQFHPTGIYGSGCLITEGARGEGGYLVNSEGERFMERYAPSAKDLASRDVVSRCMTM 300

Query: 307 EIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYN 366
           EIREGRGVGK+KDHI L+L+HLDPA+L ERLPGISESARIFAGVDVT+DPIPV+PTVHYN
Sbjct: 301 EIREGRGVGKNKDHIFLHLDHLDPALLAERLPGISESARIFAGVDVTKDPIPVLPTVHYN 360

Query: 367 MGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAV 426
           MGGIPTNYWGEVL A+  NP R   GLMA+GEAGCASVHGANRLGSNSLIDLVVFGRAA 
Sbjct: 361 MGGIPTNYWGEVLKADGDNPNRIQEGLMAVGEAGCASVHGANRLGSNSLIDLVVFGRAAA 420

Query: 427 IRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRT 486
           I+A E++D  S +P+ + +SC++IMDRFD+LR+A G +PTA LR+KMQRAMQ DA VFRT
Sbjct: 421 IKAGEVVDPKSAVPTPNEASCEKIMDRFDKLRNASGSIPTADLRDKMQRAMQEDAAVFRT 480

Query: 487 QDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKES 546
           Q+SL  GC+ L+ +W E+ DLKV DRSLIWNSDLVETLEL+NLM NAI TVY AEARKES
Sbjct: 481 QESLEQGCKRLTEIWGELKDLKVSDRSLIWNSDLVETLELENLMANAITTVYGAEARKES 540

Query: 547 RGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPV----HTELLCGGVDYS 602
           RG+HARED+KDG F GRDD NWRKH+L WVD   G +KLDYRPV     T L  GG+D  
Sbjct: 541 RGAHAREDYKDGPFSGRDDENWRKHTLAWVD-EAGNVKLDYRPVVLDPLTTLEEGGIDPK 599

Query: 603 KIAPKARVY 611
           KIAPKARVY
Sbjct: 600 KIAPKARVY 608


>gi|254503316|ref|ZP_05115467.1| succinate dehydrogenase, flavoprotein subunit [Labrenzia alexandrii
           DFL-11]
 gi|222439387|gb|EEE46066.1| succinate dehydrogenase, flavoprotein subunit [Labrenzia alexandrii
           DFL-11]
          Length = 608

 Score = 1004 bits (2595), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 478/609 (78%), Positives = 546/609 (89%), Gaps = 5/609 (0%)

Query: 7   LKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAAS 66
           +  +Y +VDH+YDVVVVGAGGAGLRATLGMAE+G +TACITKVFPTRSHTVAAQGGIAAS
Sbjct: 1   MAKTYEFVDHTYDVVVVGAGGAGLRATLGMAEQGLRTACITKVFPTRSHTVAAQGGIAAS 60

Query: 67  LANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQ 126
           L NMTPD W+WH+YDT+KGSDWLGD DA++YLA EAP++VYELEHYGVPFSR E G+IYQ
Sbjct: 61  LTNMTPDCWEWHMYDTVKGSDWLGDTDAMEYLAREAPKAVYELEHYGVPFSRTEDGRIYQ 120

Query: 127 RPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEG 186
           RPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQ+L++NAEF+IEYFALDLI++ +G
Sbjct: 121 RPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQSLRHNAEFYIEYFALDLIMSEDG 180

Query: 187 CCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQD 246
            C GV+AW L+ G +HRF+AK+VVLATGGYGR+YFSATSAHTCTGDG GMVARAGLPLQD
Sbjct: 181 VCQGVIAWNLDDGTVHRFAAKMVVLATGGYGRSYFSATSAHTCTGDGGGMVARAGLPLQD 240

Query: 247 MEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMM 306
           MEFVQFHPTGIYG+GCLITEGARGEGGYLVNS+GERFMERYAPSAKDLASRDVVSRCM M
Sbjct: 241 MEFVQFHPTGIYGSGCLITEGARGEGGYLVNSEGERFMERYAPSAKDLASRDVVSRCMTM 300

Query: 307 EIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYN 366
           EIREGRGVGK+KDHI L+L+HLDPA+L ERLPGISESA+IFAGVDVT++PIPVIPTVHYN
Sbjct: 301 EIREGRGVGKNKDHIFLHLDHLDPAILAERLPGISESAKIFAGVDVTKEPIPVIPTVHYN 360

Query: 367 MGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAV 426
           MGGIPTNYWGEVL+ANS +P+R  PGLMA+GEAGCASVHGANRLGSNSLIDLVVFGRAA 
Sbjct: 361 MGGIPTNYWGEVLNANSDHPDRIQPGLMAVGEAGCASVHGANRLGSNSLIDLVVFGRAAA 420

Query: 427 IRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRT 486
           I+A E++D    +P  + +SC+RIMDRFD+LR+A G  PTA LR++MQRAMQ DA VFRT
Sbjct: 421 IKAGEVVDPKEAVPLPNEASCERIMDRFDKLRNASGSTPTAELRDQMQRAMQEDAAVFRT 480

Query: 487 QDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKES 546
           Q++L+ GC+ L  +W  M+DLKV DRS+IWNSDLVETLEL+NLM NAI TVY AEARKES
Sbjct: 481 QETLAQGCKRLDDIWKSMSDLKVSDRSMIWNSDLVETLELENLMANAITTVYGAEARKES 540

Query: 547 RGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLC----GGVDYS 602
           RG+HARED+KDG+F GR+DV+WRKH+L WV+   G +KLDYRPV TE L     GG+D  
Sbjct: 541 RGAHAREDYKDGDFAGRNDVDWRKHTLAWVN-EAGDVKLDYRPVVTEPLTPFQNGGIDPK 599

Query: 603 KIAPKARVY 611
           KIAPKARVY
Sbjct: 600 KIAPKARVY 608


>gi|328541809|ref|YP_004301918.1| Succinate dehydrogenase flavoprotein subunit [polymorphum gilvum
           SL003B-26A1]
 gi|326411561|gb|ADZ68624.1| Succinate dehydrogenase flavoprotein subunit [Polymorphum gilvum
           SL003B-26A1]
          Length = 608

 Score = 1002 bits (2590), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 482/609 (79%), Positives = 541/609 (88%), Gaps = 5/609 (0%)

Query: 7   LKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAAS 66
           +   Y ++DHS+DVVVVGAGGAGLRATLGMAE+G +TACITKVFPTRSHTVAAQGGIAAS
Sbjct: 1   MAKMYEFIDHSHDVVVVGAGGAGLRATLGMAEQGLRTACITKVFPTRSHTVAAQGGIAAS 60

Query: 67  LANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQ 126
           L NMTPDSWQWH+YDT+KGSDWLGD DA++YLA EAP++VYELEHYGVPFSRNE GKIYQ
Sbjct: 61  LVNMTPDSWQWHMYDTVKGSDWLGDTDAMEYLAREAPKAVYELEHYGVPFSRNEEGKIYQ 120

Query: 127 RPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEG 186
           RPFGGHMQN+G+GPPVQRTCAAADRTGHAILHTLYGQ+LK+NAEF+IEYFALDLI++ +G
Sbjct: 121 RPFGGHMQNFGDGPPVQRTCAAADRTGHAILHTLYGQSLKHNAEFYIEYFALDLIMSEDG 180

Query: 187 CCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQD 246
            C GV+AW L+ G IHRF+AK+VVLATGGYGRAYFS TSAHTCTGDG GMVARAGLPLQD
Sbjct: 181 VCQGVIAWNLDDGTIHRFAAKMVVLATGGYGRAYFSCTSAHTCTGDGGGMVARAGLPLQD 240

Query: 247 MEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMM 306
           MEFVQFHPTGIYG+GCLITEGARGEGGYLVNS+GERFMERYAPSAKDLASRDVVSRCM +
Sbjct: 241 MEFVQFHPTGIYGSGCLITEGARGEGGYLVNSEGERFMERYAPSAKDLASRDVVSRCMTL 300

Query: 307 EIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYN 366
           EIREGRGVGK+KDHI L+L+HLDPA+L ERLPGISESA+IFAGVDVT++PIPV+PTVHYN
Sbjct: 301 EIREGRGVGKNKDHIFLHLDHLDPALLAERLPGISESAKIFAGVDVTKEPIPVLPTVHYN 360

Query: 367 MGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAV 426
           MGGIPTNYWGEVL+A+  NP R  PGLMA+GEAGCASVHGANRLGSNSL DLVVFGRAA 
Sbjct: 361 MGGIPTNYWGEVLNADGTNPNRIQPGLMAVGEAGCASVHGANRLGSNSLTDLVVFGRAAA 420

Query: 427 IRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRT 486
           IRA +++D    IP+ + +SC++IMDRFDRLRHA G +PTA LR+KMQRAMQ DA VFRT
Sbjct: 421 IRAGQVVDPKEAIPTPNAASCEKIMDRFDRLRHASGAIPTADLRDKMQRAMQEDAAVFRT 480

Query: 487 QDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKES 546
           Q+SL  GCR LS +W E+ DLKV DRS+IWNSDLVETLEL+NLM NAI TVY AEARKES
Sbjct: 481 QESLEQGCRRLSQIWGELKDLKVTDRSMIWNSDLVETLELENLMANAITTVYGAEARKES 540

Query: 547 RGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLC----GGVDYS 602
           RG+HARED+KDG  GGRDD NWRKH+L  V    G++ LDYRPV TE L     GG+D  
Sbjct: 541 RGAHAREDYKDGPLGGRDDENWRKHTLARVS-EAGEVTLDYRPVITEPLTPYEQGGIDPK 599

Query: 603 KIAPKARVY 611
           KIAPKARVY
Sbjct: 600 KIAPKARVY 608


>gi|319780755|ref|YP_004140231.1| succinate dehydrogenase flavoprotein subunit [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
 gi|317166643|gb|ADV10181.1| succinate dehydrogenase, flavoprotein subunit [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
          Length = 611

 Score =  986 bits (2550), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 475/607 (78%), Positives = 535/607 (88%), Gaps = 10/607 (1%)

Query: 9   SSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLA 68
           + YT+VDH +DVVVVGAGGAGLRATLGMAE+G +TACI+KVFPTRSHTVAAQGGIAASL+
Sbjct: 11  AGYTFVDHKFDVVVVGAGGAGLRATLGMAEQGLRTACISKVFPTRSHTVAAQGGIAASLS 70

Query: 69  NMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRP 128
           NM PDSWQWH+YDT+KGSDWLGDVDA++YL  EAP +VYELEHYGVPFSR E GKIYQRP
Sbjct: 71  NMGPDSWQWHMYDTVKGSDWLGDVDAMEYLVREAPAAVYELEHYGVPFSRTEEGKIYQRP 130

Query: 129 FGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCC 188
           FGGHM NYGEGPPVQRTCAAADRTGHAILHTLYGQ+LKNNA+FFIEYFALDLI+  +G C
Sbjct: 131 FGGHMMNYGEGPPVQRTCAAADRTGHAILHTLYGQSLKNNAQFFIEYFALDLIMEPDGTC 190

Query: 189 VGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDME 248
            GVVAW L+ G IHRFSAK+VVLATGGYGRAYFSATSAHTCTGDG GM ARAG PLQDME
Sbjct: 191 TGVVAWNLDDGTIHRFSAKMVVLATGGYGRAYFSATSAHTCTGDGGGMAARAGFPLQDME 250

Query: 249 FVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEI 308
           FVQFHPTGIYGAGCLITEGARGEGGYLVNS+GERFMERYAPSAKDLASRDVVSRCM +EI
Sbjct: 251 FVQFHPTGIYGAGCLITEGARGEGGYLVNSEGERFMERYAPSAKDLASRDVVSRCMTLEI 310

Query: 309 REGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMG 368
           REGRGVGK+KDHI L+L+HLDPAVL ERLPGISESA+IFAGVD+T++PIPV+PTVHYNMG
Sbjct: 311 REGRGVGKNKDHIFLHLDHLDPAVLHERLPGISESAKIFAGVDLTKEPIPVLPTVHYNMG 370

Query: 369 GIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIR 428
           G+PTNYWGEVL+  + NP++ +PGLMA+GEAGCASVHGANRLGSNSLIDLVVFGRAA IR
Sbjct: 371 GVPTNYWGEVLNPTALNPDQVSPGLMAVGEAGCASVHGANRLGSNSLIDLVVFGRAAAIR 430

Query: 429 ASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQD 488
           A ++ID+ S IPS + +S ++IMDRFDRLRHA+G  PTA LREKMQ+AMQ DA VFRTQ+
Sbjct: 431 AGQVIDRKSAIPSPNEASVEKIMDRFDRLRHANGSTPTAVLREKMQKAMQEDAAVFRTQE 490

Query: 489 SLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRG 548
           SL +GC+ +S +W E+ D+KV DRS+IWNSDLVETLEL+NLM NAI TVYSAEARKESRG
Sbjct: 491 SLENGCKRISQIWGELKDIKVSDRSMIWNSDLVETLELENLMANAITTVYSAEARKESRG 550

Query: 549 SHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLC----GGVDYSKI 604
           +HAREDF       RDD  WRKH+L  +  + GK+ L YRPVHTE       GG+  +KI
Sbjct: 551 AHAREDFS-----ARDDAVWRKHTLARLSED-GKVALSYRPVHTEPQLAEKGGGISLAKI 604

Query: 605 APKARVY 611
           APKARVY
Sbjct: 605 APKARVY 611


>gi|13473607|ref|NP_105175.1| succinate dehydrogenase flavoprotein subunit [Mesorhizobium loti
           MAFF303099]
 gi|14024357|dbj|BAB50961.1| succinate dehydrogenase flavoprotein subunit [Mesorhizobium loti
           MAFF303099]
          Length = 602

 Score =  984 bits (2545), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 474/607 (78%), Positives = 534/607 (87%), Gaps = 10/607 (1%)

Query: 9   SSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLA 68
           + Y +VDH +DVVVVGAGGAGLRATLGMAE+G +TACITKVFPTRSHTVAAQGGIAASL+
Sbjct: 2   AGYNFVDHKFDVVVVGAGGAGLRATLGMAEQGLRTACITKVFPTRSHTVAAQGGIAASLS 61

Query: 69  NMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRP 128
           NM PDSWQWH+YDT+KGSDWLGDVDA++YL  EAP +VYELEHYGVPFSR E GKIYQRP
Sbjct: 62  NMGPDSWQWHMYDTVKGSDWLGDVDAMEYLVREAPAAVYELEHYGVPFSRTEEGKIYQRP 121

Query: 129 FGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCC 188
           FGGHM NYGEGPPVQRTCAAADRTGHAILHTLYGQ+LKNNA+FFIEYFALDLI+  +G C
Sbjct: 122 FGGHMMNYGEGPPVQRTCAAADRTGHAILHTLYGQSLKNNAQFFIEYFALDLIMEPDGTC 181

Query: 189 VGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDME 248
            GVVAW L+ G IHRFSAK+VVLATGGYGRAYFSATSAHTCTGDG GM +RAG PLQDME
Sbjct: 182 TGVVAWNLDDGTIHRFSAKMVVLATGGYGRAYFSATSAHTCTGDGGGMASRAGFPLQDME 241

Query: 249 FVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEI 308
           FVQFHPTGIYGAGCLITEGARGEGGYLVNS+GERFMERYAPSAKDLASRDVVSRCM +EI
Sbjct: 242 FVQFHPTGIYGAGCLITEGARGEGGYLVNSEGERFMERYAPSAKDLASRDVVSRCMTLEI 301

Query: 309 REGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMG 368
           REGRGVGK KDHI L+L+HLDPAVL ERLPGISESA+IFAGVD+T++PIPV+PTVHYNMG
Sbjct: 302 REGRGVGKKKDHIFLHLDHLDPAVLHERLPGISESAKIFAGVDLTKEPIPVLPTVHYNMG 361

Query: 369 GIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIR 428
           G+PTNYWGEVL+  +++P++ +PGLMA+GEAGCASVHGANRLGSNSLIDLVVFGRAA IR
Sbjct: 362 GVPTNYWGEVLNPTTRSPDKVSPGLMAVGEAGCASVHGANRLGSNSLIDLVVFGRAAAIR 421

Query: 429 ASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQD 488
           A ++ID+ S IPS + +S ++IMDRFD LRHA+G  PTA LREKMQ+AMQ DA VFRTQ+
Sbjct: 422 AGQVIDRKSAIPSPNEASVEKIMDRFDGLRHANGSTPTAVLREKMQKAMQEDAAVFRTQE 481

Query: 489 SLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRG 548
           SL +GC+ +S +W E+ D+KV DRS+IWNSDLVETLEL+NLM NAI TVYSAEARKESRG
Sbjct: 482 SLENGCKRISQIWGELKDIKVFDRSMIWNSDLVETLELENLMANAITTVYSAEARKESRG 541

Query: 549 SHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLC----GGVDYSKI 604
           +HAREDF       RDD  WRKH+L  V  + GK+ L YRPVHTE L     GG+  +KI
Sbjct: 542 AHAREDFS-----ARDDAAWRKHTLARVSED-GKVTLSYRPVHTEPLLAEKDGGISLAKI 595

Query: 605 APKARVY 611
           APKARVY
Sbjct: 596 APKARVY 602


>gi|114707255|ref|ZP_01440153.1| succinate dehydrogenase [Fulvimarina pelagi HTCC2506]
 gi|114537451|gb|EAU40577.1| succinate dehydrogenase [Fulvimarina pelagi HTCC2506]
          Length = 616

 Score =  981 bits (2535), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 468/602 (77%), Positives = 531/602 (88%), Gaps = 6/602 (0%)

Query: 10  SYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLAN 69
           +YTYVDH +DVVVVGAGG+GLRATLGMAE+G +TACITKVFPTRSHTVAAQGGIAASL N
Sbjct: 21  AYTYVDHEFDVVVVGAGGSGLRATLGMAEQGLRTACITKVFPTRSHTVAAQGGIAASLKN 80

Query: 70  MTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRPF 129
           MTPDSWQWHLYDT+KGSDWLGDVDA+QYLAMEAP++VYELEHYGVPFSR E G IYQRPF
Sbjct: 81  MTPDSWQWHLYDTLKGSDWLGDVDAMQYLAMEAPKAVYELEHYGVPFSRTEDGLIYQRPF 140

Query: 130 GGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCCV 189
           GGHMQN+GEGPPVQRTCAAADRTGHAILHTLYGQ+LKNNA+FFIEYFA+DLI++ +G C 
Sbjct: 141 GGHMQNFGEGPPVQRTCAAADRTGHAILHTLYGQSLKNNAQFFIEYFAIDLIMSDDGRCT 200

Query: 190 GVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDMEF 249
           GVVAW L+ G IHRFSAK+VVLATGGYGRAYFSATSAHTCTGDG GMVARAGLPLQDMEF
Sbjct: 201 GVVAWDLDDGTIHRFSAKMVVLATGGYGRAYFSATSAHTCTGDGGGMVARAGLPLQDMEF 260

Query: 250 VQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEIR 309
           VQFHPTGIYGAGCLITEG RGEGGYLVNS+GERFMERYAPSAKDLASRDVVSRCM MEIR
Sbjct: 261 VQFHPTGIYGAGCLITEGVRGEGGYLVNSEGERFMERYAPSAKDLASRDVVSRCMTMEIR 320

Query: 310 EGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMGG 369
           EGRGVGK KDHI L+L+HLDP +L ERLPGISESA+IFAGVDVTR+PIPV+PTVHYNMGG
Sbjct: 321 EGRGVGKEKDHIFLHLDHLDPKILHERLPGISESAKIFAGVDVTREPIPVLPTVHYNMGG 380

Query: 370 IPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIRA 429
           IPTNY GEVL+  + NP+   PGLMA+GEAGCASVHGANRLGSNSLIDLVVFGRAA I+A
Sbjct: 381 IPTNYHGEVLNPTADNPDAIVPGLMAVGEAGCASVHGANRLGSNSLIDLVVFGRAAAIKA 440

Query: 430 SEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQDS 489
            +++D+++    ++  +CD+IM RFDR+RHA G  PTAA+RE+MQ+AMQ DA VFRTQ++
Sbjct: 441 GQVVDRNASAAQINEPACDKIMSRFDRIRHASGSSPTAAVRERMQKAMQEDAAVFRTQET 500

Query: 490 LSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRGS 549
           L  GC+ +S +W E++DL+V+DRS+IWNSDLVETLEL+NLM NAI TVYSAEARKESRG+
Sbjct: 501 LESGCKRISEIWQELSDLRVNDRSMIWNSDLVETLELENLMANAITTVYSAEARKESRGA 560

Query: 550 HAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPKAR 609
           HAREDF +     RDD NWR H+L  V    GK+ L YRPVH + +  G+   K+APK R
Sbjct: 561 HAREDFTE-----RDDQNWRHHTLATVS-EAGKVDLTYRPVHVDFIAEGMPEEKMAPKKR 614

Query: 610 VY 611
           VY
Sbjct: 615 VY 616


>gi|239833033|ref|ZP_04681362.1| succinate dehydrogenase, flavoprotein subunit [Ochrobactrum
           intermedium LMG 3301]
 gi|239825300|gb|EEQ96868.1| succinate dehydrogenase, flavoprotein subunit [Ochrobactrum
           intermedium LMG 3301]
          Length = 613

 Score =  980 bits (2534), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 477/605 (78%), Positives = 531/605 (87%), Gaps = 11/605 (1%)

Query: 11  YTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLANM 70
           YTYVDH +DVVVVGAGGAGLRATLGMAE+G KTACITKVFPTRSHTVAAQGGIAASL NM
Sbjct: 16  YTYVDHKFDVVVVGAGGAGLRATLGMAEQGLKTACITKVFPTRSHTVAAQGGIAASLKNM 75

Query: 71  TPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRPFG 130
            PDSWQWH+YDT+KGSDWLGD DA++YLA EAP +VYELEHYGVPFSR E GKIYQRPFG
Sbjct: 76  GPDSWQWHMYDTVKGSDWLGDTDAMEYLAREAPAAVYELEHYGVPFSRTEEGKIYQRPFG 135

Query: 131 GHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCCVG 190
           GHMQN+G+GPPVQRTCAAADRTGHAILHTLYGQ+LKNNA+FFIEYFALDLI+ ++G C G
Sbjct: 136 GHMQNFGDGPPVQRTCAAADRTGHAILHTLYGQSLKNNAQFFIEYFALDLIM-TDGVCTG 194

Query: 191 VVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDMEFV 250
           VVAW L+ G IHRFSAK+VVLATGGYGRAYFSATSAHTCTGDG GMVARAGLPLQDMEFV
Sbjct: 195 VVAWNLDDGTIHRFSAKMVVLATGGYGRAYFSATSAHTCTGDGGGMVARAGLPLQDMEFV 254

Query: 251 QFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEIRE 310
           QFHPTGIYGAGCLITEGARGEGGYLVNS+GERFMERYAPSAKDLASRDVVSRCM MEIR 
Sbjct: 255 QFHPTGIYGAGCLITEGARGEGGYLVNSEGERFMERYAPSAKDLASRDVVSRCMTMEIRA 314

Query: 311 GRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMGGI 370
           GRGVGK+KDHI L+L+HLDPAVL ERLPGISESA+IFAGVDVT++PIPV+PTVHYNMGGI
Sbjct: 315 GRGVGKNKDHIFLHLDHLDPAVLHERLPGISESAKIFAGVDVTKEPIPVLPTVHYNMGGI 374

Query: 371 PTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIRAS 430
           PTNYWGEVL+  + +P+R  PGLMA+GEAGCASVHGANRLGSNSLIDLVVFGRAA IRA 
Sbjct: 375 PTNYWGEVLNPTADDPDRVQPGLMAVGEAGCASVHGANRLGSNSLIDLVVFGRAAAIRAG 434

Query: 431 EMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQDSL 490
           ++ID+ S IP LD+++CDRIM+RFDRLR A+G  PTA LREKMQR MQ DA VFRT +SL
Sbjct: 435 QVIDRKSKIPDLDLAACDRIMERFDRLRFANGSQPTAELREKMQRTMQEDAAVFRTSESL 494

Query: 491 SDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRGSH 550
             G   +  LW E+ D+KV DRS+IWNSDLVETLEL+NLM NA+ TV SAEAR+ESRG+H
Sbjct: 495 KQGVERMEKLWHELPDIKVTDRSMIWNSDLVETLELENLMANALTTVVSAEARQESRGAH 554

Query: 551 AREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLC----GGVDYSKIAP 606
           A EDF D     R+D  WRKH+L W+  + GK+KLDYRPVH + L     GG+  +KIAP
Sbjct: 555 AHEDFPD-----RNDAEWRKHTLSWLSPD-GKVKLDYRPVHLDPLTTEEEGGISLAKIAP 608

Query: 607 KARVY 611
           K RVY
Sbjct: 609 KKRVY 613


>gi|256112237|ref|ZP_05453158.1| succinate dehydrogenase flavoprotein subunit [Brucella melitensis
           bv. 3 str. Ether]
 gi|265993665|ref|ZP_06106222.1| succinate dehydrogenase flavoprotein subunit [Brucella melitensis
           bv. 3 str. Ether]
 gi|262764646|gb|EEZ10567.1| succinate dehydrogenase flavoprotein subunit [Brucella melitensis
           bv. 3 str. Ether]
          Length = 613

 Score =  980 bits (2534), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 475/605 (78%), Positives = 532/605 (87%), Gaps = 11/605 (1%)

Query: 11  YTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLANM 70
           YTYVDH +DVVVVGAGGAGLRATLGMAE+G KTACITKVFPTRSHTVAAQGGIAASL NM
Sbjct: 16  YTYVDHKFDVVVVGAGGAGLRATLGMAEQGLKTACITKVFPTRSHTVAAQGGIAASLKNM 75

Query: 71  TPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRPFG 130
            PDSWQWH+YDT+KGSDWLGD DA++YL  EAP +VYELEHYGVPFSR E GKIYQRPFG
Sbjct: 76  GPDSWQWHMYDTVKGSDWLGDTDAMEYLTREAPAAVYELEHYGVPFSRTEEGKIYQRPFG 135

Query: 131 GHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCCVG 190
           GHMQN+G+GPPVQRTCAAADRTGHAILHTLYGQ+LKNNA+FFIEYFALDLI+ ++G C G
Sbjct: 136 GHMQNFGDGPPVQRTCAAADRTGHAILHTLYGQSLKNNAQFFIEYFALDLIM-TDGVCTG 194

Query: 191 VVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDMEFV 250
           VVAW L+ G IHRFSAK+VVLATGGYGRAYFSATSAHTCTGDG GMVARAGLPLQDMEFV
Sbjct: 195 VVAWNLDDGTIHRFSAKMVVLATGGYGRAYFSATSAHTCTGDGGGMVARAGLPLQDMEFV 254

Query: 251 QFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEIRE 310
           QFHPTGIYGAGCLITEGARGEGGYLVNS+GERFMERYAPSAKDLASRDVVSRCMMMEIR 
Sbjct: 255 QFHPTGIYGAGCLITEGARGEGGYLVNSEGERFMERYAPSAKDLASRDVVSRCMMMEIRA 314

Query: 311 GRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMGGI 370
           GRGVGK+KDHI+L+L+HLDPAVL ERLPGISESA+IFAGVDVT++PIPV+PTVHYNMGGI
Sbjct: 315 GRGVGKNKDHIYLHLDHLDPAVLHERLPGISESAKIFAGVDVTKEPIPVLPTVHYNMGGI 374

Query: 371 PTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIRAS 430
           PTNYWGEVL+   ++P+R  PGLMA+GEAGCASVHGANRLGSNSLIDLVVFGRAA IRA 
Sbjct: 375 PTNYWGEVLNPTKEDPDRVQPGLMAVGEAGCASVHGANRLGSNSLIDLVVFGRAAAIRAG 434

Query: 431 EMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQDSL 490
           ++ID+ S IP +DI++CD+IM+RFDRLR A+G  PTA LREKMQR MQ DA VFRT++SL
Sbjct: 435 QVIDRKSKIPDIDIAACDKIMERFDRLRFANGSTPTAVLREKMQRTMQEDAAVFRTEESL 494

Query: 491 SDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRGSH 550
             G   +  LW E+ D+KV DRS+IWNSDLVETLEL+NLM NA+ TV SAEAR+ESRG+H
Sbjct: 495 KQGAERMEKLWHELPDIKVTDRSMIWNSDLVETLELENLMANALTTVVSAEARQESRGAH 554

Query: 551 AREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLC----GGVDYSKIAP 606
           AREDF D     R+D  WRKH+L  +  + GK+ LDYRPVH + L     GG+  +KIAP
Sbjct: 555 AREDFPD-----RNDAEWRKHTLSRLSPD-GKVTLDYRPVHLDPLTTEEEGGISLAKIAP 608

Query: 607 KARVY 611
           K RVY
Sbjct: 609 KKRVY 613


>gi|153008288|ref|YP_001369503.1| succinate dehydrogenase flavoprotein subunit [Ochrobactrum anthropi
           ATCC 49188]
 gi|151560176|gb|ABS13674.1| succinate dehydrogenase, flavoprotein subunit [Ochrobactrum
           anthropi ATCC 49188]
          Length = 614

 Score =  978 bits (2528), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 476/605 (78%), Positives = 530/605 (87%), Gaps = 11/605 (1%)

Query: 11  YTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLANM 70
           YTYVDH +DVVVVGAGGAGLRATLGMAE+G KTACITKVFPTRSHTVAAQGGIAASL NM
Sbjct: 17  YTYVDHKFDVVVVGAGGAGLRATLGMAEQGLKTACITKVFPTRSHTVAAQGGIAASLKNM 76

Query: 71  TPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRPFG 130
            PDSWQWH+YDT+KGSDWLGD DA++YLA EAP +VYELEHYGVPFSR E GKIYQRPFG
Sbjct: 77  GPDSWQWHMYDTVKGSDWLGDTDAMEYLAREAPAAVYELEHYGVPFSRTEEGKIYQRPFG 136

Query: 131 GHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCCVG 190
           GHMQN+G+GPPVQRTCAAADRTGHAILHTLYGQ+LKNNA+FFIEYFALDLI+ ++G C G
Sbjct: 137 GHMQNFGDGPPVQRTCAAADRTGHAILHTLYGQSLKNNAQFFIEYFALDLIM-TDGVCTG 195

Query: 191 VVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDMEFV 250
           VVAW L+ G IHRFSAK+VVLATGGYGRAYFSATSAHTCTGDG GMVARAGLPLQDMEFV
Sbjct: 196 VVAWNLDDGTIHRFSAKMVVLATGGYGRAYFSATSAHTCTGDGGGMVARAGLPLQDMEFV 255

Query: 251 QFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEIRE 310
           QFHPTGIYGAGCLITEGARGEGGYLVNS+GERFMERYAPSAKDLASRDVVSRCM MEIR 
Sbjct: 256 QFHPTGIYGAGCLITEGARGEGGYLVNSEGERFMERYAPSAKDLASRDVVSRCMTMEIRA 315

Query: 311 GRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMGGI 370
           GRGVGK+KDHI L+L+HLDPAVL ERLPGISESA+IFAGVDVT++PIPV+PTVHYNMGGI
Sbjct: 316 GRGVGKAKDHIFLHLDHLDPAVLHERLPGISESAKIFAGVDVTKEPIPVLPTVHYNMGGI 375

Query: 371 PTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIRAS 430
           PTNYWGEVL+    +P+R  PGLMA+GEAGCASVHGANRLGSNSLIDLVVFGRAA IRA 
Sbjct: 376 PTNYWGEVLNPTEADPDRVQPGLMAVGEAGCASVHGANRLGSNSLIDLVVFGRAAAIRAG 435

Query: 431 EMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQDSL 490
           ++ID+ S IP LD+++CD+IM+RFDRLR A+G  PTA LREKMQR MQ DA VFRT +SL
Sbjct: 436 QVIDRKSKIPDLDVTACDKIMERFDRLRFANGSQPTAELREKMQRTMQEDAAVFRTSESL 495

Query: 491 SDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRGSH 550
             G   +  LW E+ D+KV DRS+IWNSDLVETLEL+NLM NA+ TV SAEAR+ESRG+H
Sbjct: 496 KQGVERMEKLWHELPDIKVTDRSMIWNSDLVETLELENLMANALTTVVSAEARQESRGAH 555

Query: 551 AREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLC----GGVDYSKIAP 606
           A EDF D     R+D  WRKH+L W+  + GK+KLDYRPVH + L     GG+  +KIAP
Sbjct: 556 AHEDFPD-----RNDAVWRKHTLSWLSPD-GKVKLDYRPVHLDPLTTEEEGGISLAKIAP 609

Query: 607 KARVY 611
           K RVY
Sbjct: 610 KKRVY 614


>gi|148559841|ref|YP_001259726.1| succinate dehydrogenase flavoprotein subunit [Brucella ovis ATCC
           25840]
 gi|161619819|ref|YP_001593706.1| succinate dehydrogenase flavoprotein subunit [Brucella canis ATCC
           23365]
 gi|163843925|ref|YP_001628329.1| succinate dehydrogenase flavoprotein subunit [Brucella suis ATCC
           23445]
 gi|225853339|ref|YP_002733572.1| succinate dehydrogenase flavoprotein subunit [Brucella melitensis
           ATCC 23457]
 gi|254700546|ref|ZP_05162374.1| succinate dehydrogenase flavoprotein subunit [Brucella suis bv. 5
           str. 513]
 gi|254704916|ref|ZP_05166744.1| succinate dehydrogenase flavoprotein subunit [Brucella suis bv. 3
           str. 686]
 gi|256059878|ref|ZP_05450065.1| succinate dehydrogenase flavoprotein subunit [Brucella neotomae
           5K33]
 gi|256263174|ref|ZP_05465706.1| succinate dehydrogenase [Brucella melitensis bv. 2 str. 63/9]
 gi|256370304|ref|YP_003107815.1| succinate dehydrogenase [Brucella microti CCM 4915]
 gi|260567609|ref|ZP_05838079.1| succinate dehydrogenase [Brucella suis bv. 4 str. 40]
 gi|261323849|ref|ZP_05963046.1| succinate dehydrogenase flavoprotein subunit [Brucella neotomae
           5K33]
 gi|261751050|ref|ZP_05994759.1| succinate dehydrogenase flavoprotein subunit [Brucella suis bv. 5
           str. 513]
 gi|261755612|ref|ZP_05999321.1| succinate dehydrogenase flavoprotein subunit [Brucella suis bv. 3
           str. 686]
 gi|294851143|ref|ZP_06791816.1| succinate dehydrogenase [Brucella sp. NVSL 07-0026]
 gi|148371098|gb|ABQ61077.1| succinate dehydrogenase, flavoprotein subunit [Brucella ovis ATCC
           25840]
 gi|161336630|gb|ABX62935.1| succinate dehydrogenase, flavoprotein subunit [Brucella canis ATCC
           23365]
 gi|163674648|gb|ABY38759.1| succinate dehydrogenase, flavoprotein subunit [Brucella suis ATCC
           23445]
 gi|225641704|gb|ACO01618.1| succinate dehydrogenase, flavoprotein subunit [Brucella melitensis
           ATCC 23457]
 gi|256000467|gb|ACU48866.1| succinate dehydrogenase [Brucella microti CCM 4915]
 gi|260157127|gb|EEW92207.1| succinate dehydrogenase [Brucella suis bv. 4 str. 40]
 gi|261299829|gb|EEY03326.1| succinate dehydrogenase flavoprotein subunit [Brucella neotomae
           5K33]
 gi|261740803|gb|EEY28729.1| succinate dehydrogenase flavoprotein subunit [Brucella suis bv. 5
           str. 513]
 gi|261745365|gb|EEY33291.1| succinate dehydrogenase flavoprotein subunit [Brucella suis bv. 3
           str. 686]
 gi|263093080|gb|EEZ17230.1| succinate dehydrogenase [Brucella melitensis bv. 2 str. 63/9]
 gi|294819732|gb|EFG36731.1| succinate dehydrogenase [Brucella sp. NVSL 07-0026]
 gi|326409903|gb|ADZ66968.1| succinate dehydrogenase flavoprotein subunit [Brucella melitensis
           M28]
 gi|326539616|gb|ADZ87831.1| succinate dehydrogenase, flavoprotein subunit [Brucella melitensis
           M5-90]
          Length = 613

 Score =  977 bits (2526), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 474/605 (78%), Positives = 531/605 (87%), Gaps = 11/605 (1%)

Query: 11  YTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLANM 70
           YTYVDH +DVVVVGAGGAGLRATLGMAE+G KTACITKVFPTRSHTVAAQGGIAASL NM
Sbjct: 16  YTYVDHKFDVVVVGAGGAGLRATLGMAEQGLKTACITKVFPTRSHTVAAQGGIAASLKNM 75

Query: 71  TPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRPFG 130
            PDSWQWH+YDT+KGSDWLGD DA++YL  EAP +VYELEHYGVPFSR E GKIYQRPFG
Sbjct: 76  GPDSWQWHMYDTVKGSDWLGDTDAMEYLTREAPAAVYELEHYGVPFSRTEEGKIYQRPFG 135

Query: 131 GHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCCVG 190
           GHMQN+G+GPPVQRTCAAADRTGHAILHTLYGQ+LKNNA+FFIEYFALDLI+ ++G C G
Sbjct: 136 GHMQNFGDGPPVQRTCAAADRTGHAILHTLYGQSLKNNAQFFIEYFALDLIM-TDGVCTG 194

Query: 191 VVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDMEFV 250
           VVAW L+ G IHRFSAK+VVLATGGYGRAYFSATSAHTCTGDG GMVARAGLPLQDMEFV
Sbjct: 195 VVAWNLDDGTIHRFSAKMVVLATGGYGRAYFSATSAHTCTGDGGGMVARAGLPLQDMEFV 254

Query: 251 QFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEIRE 310
           QFHPTGIYGAGCLITEGARGEGGYLVNS+GERFMERYAPSAKDLASRDVVSRCM MEIR 
Sbjct: 255 QFHPTGIYGAGCLITEGARGEGGYLVNSEGERFMERYAPSAKDLASRDVVSRCMTMEIRA 314

Query: 311 GRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMGGI 370
           GRGVGK+KDHI+L+L+HLDPAVL ERLPGISESA+IFAGVDVT++PIPV+PTVHYNMGGI
Sbjct: 315 GRGVGKNKDHIYLHLDHLDPAVLHERLPGISESAKIFAGVDVTKEPIPVLPTVHYNMGGI 374

Query: 371 PTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIRAS 430
           PTNYWGEVL+   ++P+R  PGLMA+GEAGCASVHGANRLGSNSLIDLVVFGRAA IRA 
Sbjct: 375 PTNYWGEVLNPTKEDPDRVQPGLMAVGEAGCASVHGANRLGSNSLIDLVVFGRAAAIRAG 434

Query: 431 EMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQDSL 490
           ++ID+ S IP +DI++CD+IM+RFDRLR A+G  PTA LREKMQR MQ DA VFRT++SL
Sbjct: 435 QVIDRKSKIPDIDIAACDKIMERFDRLRFANGSTPTAVLREKMQRTMQEDAAVFRTEESL 494

Query: 491 SDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRGSH 550
             G   +  LW E+ D+KV DRS+IWNSDLVETLEL+NLM NA+ TV SAEAR+ESRG+H
Sbjct: 495 KQGVERMEKLWHELPDIKVTDRSMIWNSDLVETLELENLMANALTTVVSAEARQESRGAH 554

Query: 551 AREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLC----GGVDYSKIAP 606
           AREDF D     R+D  WRKH+L  +  + GK+ LDYRPVH + L     GG+  +KIAP
Sbjct: 555 AREDFPD-----RNDAEWRKHTLSRLSPD-GKVTLDYRPVHLDPLTTEEEGGISLAKIAP 608

Query: 607 KARVY 611
           K RVY
Sbjct: 609 KKRVY 613


>gi|306842944|ref|ZP_07475578.1| succinate dehydrogenase, flavoprotein subunit [Brucella sp. BO2]
 gi|306286872|gb|EFM58397.1| succinate dehydrogenase, flavoprotein subunit [Brucella sp. BO2]
          Length = 613

 Score =  977 bits (2525), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 474/605 (78%), Positives = 531/605 (87%), Gaps = 11/605 (1%)

Query: 11  YTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLANM 70
           YTYVDH +DVVVVGAGGAGLRATLGMAE+G KTACITKVFPTRSHTVAAQGGIAASL NM
Sbjct: 16  YTYVDHKFDVVVVGAGGAGLRATLGMAEQGLKTACITKVFPTRSHTVAAQGGIAASLKNM 75

Query: 71  TPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRPFG 130
            PDSWQWH+YDT+KGSDWLGD DA++YL  EAP +VYELEHYGVPFSR E GKIYQRPFG
Sbjct: 76  GPDSWQWHMYDTVKGSDWLGDTDAMEYLTREAPAAVYELEHYGVPFSRTEEGKIYQRPFG 135

Query: 131 GHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCCVG 190
           GHMQN+G+GPPVQRTCAAADRTGHAILHTLYGQ+LKNNA+FFIEYFALDLI+ ++G C G
Sbjct: 136 GHMQNFGDGPPVQRTCAAADRTGHAILHTLYGQSLKNNAQFFIEYFALDLIM-TDGVCTG 194

Query: 191 VVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDMEFV 250
           VVAW L+ G IHRFSAK+VVLATGGYGRAYFSATSAHTCTGDG GMVARAGLPLQDMEFV
Sbjct: 195 VVAWNLDDGTIHRFSAKMVVLATGGYGRAYFSATSAHTCTGDGGGMVARAGLPLQDMEFV 254

Query: 251 QFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEIRE 310
           QFHPTGIYGAGCLITEGARGEGGYLVNS+GERFMERYAPSAKDLASRDVVSRCM MEIR 
Sbjct: 255 QFHPTGIYGAGCLITEGARGEGGYLVNSEGERFMERYAPSAKDLASRDVVSRCMTMEIRA 314

Query: 311 GRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMGGI 370
           GRGVGK+KDHI+L+L+HLDPAVL ERLPGISESA+IFAGVDVT++PIPV+PTVHYNMGGI
Sbjct: 315 GRGVGKNKDHIYLHLDHLDPAVLHERLPGISESAKIFAGVDVTKEPIPVLPTVHYNMGGI 374

Query: 371 PTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIRAS 430
           PTNYWGEVL+   ++P+R  PGLMA+GEAGCASVHGANRLGSNSLIDLVVFGRAA IRA 
Sbjct: 375 PTNYWGEVLNPTEEDPDRVQPGLMAVGEAGCASVHGANRLGSNSLIDLVVFGRAAAIRAG 434

Query: 431 EMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQDSL 490
           ++ID+ S IP +DI++CD+IM+RFDRLR A+G  PTA LREKMQR MQ DA VFRT++SL
Sbjct: 435 QVIDRKSKIPDIDIAACDKIMERFDRLRFANGSTPTAVLREKMQRTMQEDAAVFRTEESL 494

Query: 491 SDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRGSH 550
             G   +  LW E+ D+KV DRS+IWNSDLVETLEL+NLM NA+ TV SAEAR+ESRG+H
Sbjct: 495 KQGVERMEKLWHELPDIKVTDRSMIWNSDLVETLELENLMANALTTVVSAEARQESRGAH 554

Query: 551 AREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLC----GGVDYSKIAP 606
           AREDF D     R+D  WRKH+L  +  + GK+ LDYRPVH + L     GG+  +KIAP
Sbjct: 555 AREDFPD-----RNDAEWRKHTLSRLSPD-GKVTLDYRPVHLDPLTTEEEGGISLAKIAP 608

Query: 607 KARVY 611
           K RVY
Sbjct: 609 KKRVY 613


>gi|306843357|ref|ZP_07475958.1| succinate dehydrogenase, flavoprotein subunit [Brucella sp. BO1]
 gi|306276048|gb|EFM57748.1| succinate dehydrogenase, flavoprotein subunit [Brucella sp. BO1]
          Length = 613

 Score =  977 bits (2525), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 474/605 (78%), Positives = 531/605 (87%), Gaps = 11/605 (1%)

Query: 11  YTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLANM 70
           YTYVDH +DVVVVGAGGAGLRATLGMAE+G KTACITKVFPTRSHTVAAQGGIAASL NM
Sbjct: 16  YTYVDHKFDVVVVGAGGAGLRATLGMAEQGLKTACITKVFPTRSHTVAAQGGIAASLKNM 75

Query: 71  TPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRPFG 130
            PDSWQWH+YDT+KGSDWLGD DA++YL  EAP +VYELEHYGVPFSR E GKIYQRPFG
Sbjct: 76  GPDSWQWHMYDTVKGSDWLGDTDAMEYLTREAPAAVYELEHYGVPFSRTEEGKIYQRPFG 135

Query: 131 GHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCCVG 190
           GHMQN+G+GPPVQRTCAAADRTGHAILHTLYGQ+LKNNA+FFIEYFALDLI+ ++G C G
Sbjct: 136 GHMQNFGDGPPVQRTCAAADRTGHAILHTLYGQSLKNNAQFFIEYFALDLIM-TDGVCTG 194

Query: 191 VVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDMEFV 250
           VVAW L+ G IHRFSAK+VVLATGGYGRAYFSATSAHTCTGDG GMVARAGLPLQDMEFV
Sbjct: 195 VVAWNLDDGTIHRFSAKMVVLATGGYGRAYFSATSAHTCTGDGGGMVARAGLPLQDMEFV 254

Query: 251 QFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEIRE 310
           QFHPTGIYGAGCLITEGARGEGGYLVNS+GERFMERYAPSAKDLASRDVVSRCM MEIR 
Sbjct: 255 QFHPTGIYGAGCLITEGARGEGGYLVNSEGERFMERYAPSAKDLASRDVVSRCMTMEIRA 314

Query: 311 GRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMGGI 370
           GRGVGK+KDHI+L+L+HLDPAVL ERLPGISESA+IFAGVDVT++PIPV+PTVHYNMGGI
Sbjct: 315 GRGVGKNKDHIYLHLDHLDPAVLHERLPGISESAKIFAGVDVTKEPIPVLPTVHYNMGGI 374

Query: 371 PTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIRAS 430
           PTNYWGEVL+   ++P+R  PGLMA+GEAGCASVHGANRLGSNSLIDLVVFGRAA IRA 
Sbjct: 375 PTNYWGEVLNPTEEDPDRVQPGLMAVGEAGCASVHGANRLGSNSLIDLVVFGRAAAIRAG 434

Query: 431 EMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQDSL 490
           ++ID+ S IP +DI++CD+IM+RFDRLR A+G  PTA LREKMQR MQ DA VFRT++SL
Sbjct: 435 QVIDRKSKIPDIDIAACDKIMERFDRLRFANGSTPTAVLREKMQRTMQEDAAVFRTEESL 494

Query: 491 SDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRGSH 550
             G   +  LW E+ D+KV DRS+IWNSDLVETLEL+NLM NA+ TV SAEAR+ESRG+H
Sbjct: 495 KQGVERMEKLWHELPDIKVTDRSMIWNSDLVETLELENLMANALTTVVSAEARQESRGAH 554

Query: 551 AREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLC----GGVDYSKIAP 606
           AREDF D     R+D  WRKH+L  +  + GK+ LDYRPVH + L     GG+  +KIAP
Sbjct: 555 AREDFPD-----RNDAEWRKHTLSRLSPD-GKVTLDYRPVHLDPLTTEEEGGISLAKIAP 608

Query: 607 KARVY 611
           K RVY
Sbjct: 609 KKRVY 613


>gi|17986445|ref|NP_539079.1| succinate dehydrogenase flavoprotein subunit [Brucella melitensis
           bv. 1 str. 16M]
 gi|17982041|gb|AAL51343.1| succinate dehydrogenase flavoprotein subunit [Brucella melitensis
           bv. 1 str. 16M]
          Length = 630

 Score =  977 bits (2525), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 473/605 (78%), Positives = 530/605 (87%), Gaps = 11/605 (1%)

Query: 11  YTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLANM 70
           YTYVDH +DVVVVGAGGAGLRATLGMAE+G KTACITKVFPTRSHTVAAQGGIAASL NM
Sbjct: 33  YTYVDHKFDVVVVGAGGAGLRATLGMAEQGLKTACITKVFPTRSHTVAAQGGIAASLKNM 92

Query: 71  TPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRPFG 130
            PDSWQWH+YDT+KGSDWLGD DA++YL  EAP +VYELEHYGVPFSR E GKIYQRPFG
Sbjct: 93  GPDSWQWHMYDTVKGSDWLGDTDAMEYLTREAPAAVYELEHYGVPFSRTEEGKIYQRPFG 152

Query: 131 GHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCCVG 190
           GHMQN+G+GPPVQRTCAAADRTGHAILHTLYGQ+LKNNA+FFIEYFALDLI+ ++G C G
Sbjct: 153 GHMQNFGDGPPVQRTCAAADRTGHAILHTLYGQSLKNNAQFFIEYFALDLIM-TDGVCTG 211

Query: 191 VVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDMEFV 250
           VVAW L+ G IHRFSAK+VVLATGGYGR YFSATSAHTCTGDG GMVARAGLPLQDMEFV
Sbjct: 212 VVAWNLDDGTIHRFSAKMVVLATGGYGRGYFSATSAHTCTGDGGGMVARAGLPLQDMEFV 271

Query: 251 QFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEIRE 310
           QFHPTGIYGAGCLITEGARGEGGYLVNS+GERFMERYAPSAKDLASRDVVSRCM MEIR 
Sbjct: 272 QFHPTGIYGAGCLITEGARGEGGYLVNSEGERFMERYAPSAKDLASRDVVSRCMTMEIRA 331

Query: 311 GRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMGGI 370
           GRGVGK+KDHI+L+L+HLDPAVL ERLPGISESA+IFAGVDVT++PIPV+PTVHYNMGGI
Sbjct: 332 GRGVGKNKDHIYLHLDHLDPAVLHERLPGISESAKIFAGVDVTKEPIPVLPTVHYNMGGI 391

Query: 371 PTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIRAS 430
           PTNYWGEVL+   ++P+R  PGLMA+GEAGCASVHGANRLGSNSLIDLVVFGRAA IRA 
Sbjct: 392 PTNYWGEVLNPTKEDPDRVQPGLMAVGEAGCASVHGANRLGSNSLIDLVVFGRAAAIRAG 451

Query: 431 EMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQDSL 490
           ++ID+ S IP +DI++CD+IM+RFDRLR A+G  PTA LREKMQR MQ DA VFRT++SL
Sbjct: 452 QVIDRKSKIPDIDIAACDKIMERFDRLRFANGSTPTAVLREKMQRTMQEDAAVFRTEESL 511

Query: 491 SDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRGSH 550
             G   +  LW E+ D+KV DRS+IWNSDLVETLEL+NLM NA+ TV SAEAR+ESRG+H
Sbjct: 512 KQGVERMEKLWHELPDIKVTDRSMIWNSDLVETLELENLMANALTTVVSAEARQESRGAH 571

Query: 551 AREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLC----GGVDYSKIAP 606
           AREDF D     R+D  WRKH+L  +  + GK+ LDYRPVH + L     GG+  +KIAP
Sbjct: 572 AREDFPD-----RNDAEWRKHTLSRLSPD-GKVTLDYRPVHLDPLTTEEEGGISLAKIAP 625

Query: 607 KARVY 611
           K RVY
Sbjct: 626 KKRVY 630


>gi|256045510|ref|ZP_05448393.1| succinate dehydrogenase flavoprotein subunit [Brucella melitensis
           bv. 1 str. Rev.1]
 gi|260562819|ref|ZP_05833305.1| succinate dehydrogenase [Brucella melitensis bv. 1 str. 16M]
 gi|265991933|ref|ZP_06104490.1| succinate dehydrogenase flavoprotein subunit [Brucella melitensis
           bv. 1 str. Rev.1]
 gi|260152835|gb|EEW87927.1| succinate dehydrogenase [Brucella melitensis bv. 1 str. 16M]
 gi|263002999|gb|EEZ15292.1| succinate dehydrogenase flavoprotein subunit [Brucella melitensis
           bv. 1 str. Rev.1]
          Length = 613

 Score =  976 bits (2522), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 473/605 (78%), Positives = 530/605 (87%), Gaps = 11/605 (1%)

Query: 11  YTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLANM 70
           YTYVDH +DVVVVGAGGAGLRATLGMAE+G KTACITKVFPTRSHTVAAQGGIAASL NM
Sbjct: 16  YTYVDHKFDVVVVGAGGAGLRATLGMAEQGLKTACITKVFPTRSHTVAAQGGIAASLKNM 75

Query: 71  TPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRPFG 130
            PDSWQWH+YDT+KGSDWLGD DA++YL  EAP +VYELEHYGVPFSR E GKIYQRPFG
Sbjct: 76  GPDSWQWHMYDTVKGSDWLGDTDAMEYLTREAPAAVYELEHYGVPFSRTEEGKIYQRPFG 135

Query: 131 GHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCCVG 190
           GHMQN+G+GPPVQRTCAAADRTGHAILHTLYGQ+LKNNA+FFIEYFALDLI+ ++G C G
Sbjct: 136 GHMQNFGDGPPVQRTCAAADRTGHAILHTLYGQSLKNNAQFFIEYFALDLIM-TDGVCTG 194

Query: 191 VVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDMEFV 250
           VVAW L+ G IHRFSAK+VVLATGGYGR YFSATSAHTCTGDG GMVARAGLPLQDMEFV
Sbjct: 195 VVAWNLDDGTIHRFSAKMVVLATGGYGRGYFSATSAHTCTGDGGGMVARAGLPLQDMEFV 254

Query: 251 QFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEIRE 310
           QFHPTGIYGAGCLITEGARGEGGYLVNS+GERFMERYAPSAKDLASRDVVSRCM MEIR 
Sbjct: 255 QFHPTGIYGAGCLITEGARGEGGYLVNSEGERFMERYAPSAKDLASRDVVSRCMTMEIRA 314

Query: 311 GRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMGGI 370
           GRGVGK+KDHI+L+L+HLDPAVL ERLPGISESA+IFAGVDVT++PIPV+PTVHYNMGGI
Sbjct: 315 GRGVGKNKDHIYLHLDHLDPAVLHERLPGISESAKIFAGVDVTKEPIPVLPTVHYNMGGI 374

Query: 371 PTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIRAS 430
           PTNYWGEVL+   ++P+R  PGLMA+GEAGCASVHGANRLGSNSLIDLVVFGRAA IRA 
Sbjct: 375 PTNYWGEVLNPTKEDPDRVQPGLMAVGEAGCASVHGANRLGSNSLIDLVVFGRAAAIRAG 434

Query: 431 EMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQDSL 490
           ++ID+ S IP +DI++CD+IM+RFDRLR A+G  PTA LREKMQR MQ DA VFRT++SL
Sbjct: 435 QVIDRKSKIPDIDIAACDKIMERFDRLRFANGSTPTAVLREKMQRTMQEDAAVFRTEESL 494

Query: 491 SDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRGSH 550
             G   +  LW E+ D+KV DRS+IWNSDLVETLEL+NLM NA+ TV SAEAR+ESRG+H
Sbjct: 495 KQGVERMEKLWHELPDIKVTDRSMIWNSDLVETLELENLMANALTTVVSAEARQESRGAH 554

Query: 551 AREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLC----GGVDYSKIAP 606
           AREDF D     R+D  WRKH+L  +  + GK+ LDYRPVH + L     GG+  +KIAP
Sbjct: 555 AREDFPD-----RNDAEWRKHTLSRLSPD-GKVTLDYRPVHLDPLTTEEEGGISLAKIAP 608

Query: 607 KARVY 611
           K RVY
Sbjct: 609 KKRVY 613


>gi|225628102|ref|ZP_03786137.1| succinate dehydrogenase, flavoprotein subunit [Brucella ceti str.
           Cudo]
 gi|225616927|gb|EEH13974.1| succinate dehydrogenase, flavoprotein subunit [Brucella ceti str.
           Cudo]
          Length = 619

 Score =  976 bits (2522), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 473/605 (78%), Positives = 530/605 (87%), Gaps = 11/605 (1%)

Query: 11  YTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLANM 70
           YTYVDH +DVVVVGAGGAGLRATLGMAE+G KTACITKVFPTRSHTVAAQGGIAASL NM
Sbjct: 22  YTYVDHKFDVVVVGAGGAGLRATLGMAEQGLKTACITKVFPTRSHTVAAQGGIAASLKNM 81

Query: 71  TPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRPFG 130
            PDSWQWH+YDT+KGSDWLGD DA++YL  EAP +VYELEHYGVPFSR E GKIYQRPFG
Sbjct: 82  GPDSWQWHMYDTVKGSDWLGDTDAMEYLTREAPAAVYELEHYGVPFSRTEEGKIYQRPFG 141

Query: 131 GHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCCVG 190
           GHMQN+G+GPPVQRTCAAADRTGHAILHTLYGQ+LKNNA+FFIEYFALDLI+ ++G C G
Sbjct: 142 GHMQNFGDGPPVQRTCAAADRTGHAILHTLYGQSLKNNAQFFIEYFALDLIM-TDGVCTG 200

Query: 191 VVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDMEFV 250
           VVAW L+ G IHRFSAK+VVLA GGYGRAYFSATSAHTCTGDG GMVARAGLPLQDMEFV
Sbjct: 201 VVAWNLDDGTIHRFSAKMVVLAMGGYGRAYFSATSAHTCTGDGGGMVARAGLPLQDMEFV 260

Query: 251 QFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEIRE 310
           QFHPTGIYGAGCLITEGARGEGGYLVNS+GERFMERYAPSAKDLASRDVVSRCM MEIR 
Sbjct: 261 QFHPTGIYGAGCLITEGARGEGGYLVNSEGERFMERYAPSAKDLASRDVVSRCMTMEIRA 320

Query: 311 GRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMGGI 370
           GRGVGK+KDHI+L+L+HLDPAVL ERLPGISESA+IFAGVDVT++PIPV+PTVHYNMGGI
Sbjct: 321 GRGVGKNKDHIYLHLDHLDPAVLHERLPGISESAKIFAGVDVTKEPIPVLPTVHYNMGGI 380

Query: 371 PTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIRAS 430
           PTNYWGEVL+   ++P+R  PGLMA+GEAGCASVHGANRLGSNSLIDLVVFGRAA IRA 
Sbjct: 381 PTNYWGEVLNPTKEDPDRVQPGLMAVGEAGCASVHGANRLGSNSLIDLVVFGRAAAIRAG 440

Query: 431 EMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQDSL 490
           ++ID+ S IP +DI++CD+IM+RFDRLR A+G  PTA LREKMQR MQ DA VFRT++SL
Sbjct: 441 QVIDRKSKIPDIDIAACDKIMERFDRLRFANGSTPTAVLREKMQRTMQEDAAVFRTEESL 500

Query: 491 SDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRGSH 550
             G   +  LW E+ D+KV DRS+IWNSDLVETLEL+NLM NA+ TV SAEAR+ESRG+H
Sbjct: 501 KQGVERMEKLWHELPDIKVTDRSMIWNSDLVETLELENLMANALTTVVSAEARQESRGAH 560

Query: 551 AREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLC----GGVDYSKIAP 606
           AREDF D     R+D  WRKH+L  +  + GK+ LDYRPVH + L     GG+  +KIAP
Sbjct: 561 AREDFPD-----RNDAEWRKHTLSRLSPD-GKVTLDYRPVHLDPLTTEEEGGISLAKIAP 614

Query: 607 KARVY 611
           K RVY
Sbjct: 615 KKRVY 619


>gi|254717969|ref|ZP_05179780.1| succinate dehydrogenase flavoprotein subunit [Brucella sp. 83/13]
 gi|265982912|ref|ZP_06095647.1| succinate dehydrogenase flavoprotein subunit [Brucella sp. 83/13]
 gi|306838921|ref|ZP_07471748.1| succinate dehydrogenase, flavoprotein subunit [Brucella sp. NF
           2653]
 gi|264661504|gb|EEZ31765.1| succinate dehydrogenase flavoprotein subunit [Brucella sp. 83/13]
 gi|306405991|gb|EFM62243.1| succinate dehydrogenase, flavoprotein subunit [Brucella sp. NF
           2653]
          Length = 613

 Score =  975 bits (2521), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 473/605 (78%), Positives = 530/605 (87%), Gaps = 11/605 (1%)

Query: 11  YTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLANM 70
           YTYVDH +DVVVVGAGGAGLRATLGMAE+G KTACITKVFPTRSHTVAAQGGIAASL NM
Sbjct: 16  YTYVDHKFDVVVVGAGGAGLRATLGMAEQGLKTACITKVFPTRSHTVAAQGGIAASLKNM 75

Query: 71  TPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRPFG 130
            PDSWQWH+YDT+KGSDWLGD DA++YL  EAP +VYELEHYGVPFSR E GKIYQRPFG
Sbjct: 76  GPDSWQWHMYDTVKGSDWLGDTDAMEYLTREAPAAVYELEHYGVPFSRTEEGKIYQRPFG 135

Query: 131 GHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCCVG 190
           GHMQN+G+GPPVQRTCAAADRTGHAILHTLYGQ+LKNNA+FFIEYFALDLI+ ++G C G
Sbjct: 136 GHMQNFGDGPPVQRTCAAADRTGHAILHTLYGQSLKNNAQFFIEYFALDLIM-TDGVCTG 194

Query: 191 VVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDMEFV 250
           VVAW L+ G IHRFSAK+VVLATGGYGRAYFSATSAHTCTGDG GMVARAGLPLQDMEFV
Sbjct: 195 VVAWNLDDGTIHRFSAKMVVLATGGYGRAYFSATSAHTCTGDGGGMVARAGLPLQDMEFV 254

Query: 251 QFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEIRE 310
           QFHPTGIYGAGCLITEGARGEGGYLVNS+GERFMERYAPSAKDLASRDVVSRCM MEIR 
Sbjct: 255 QFHPTGIYGAGCLITEGARGEGGYLVNSEGERFMERYAPSAKDLASRDVVSRCMTMEIRA 314

Query: 311 GRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMGGI 370
           GRGVGK+KDHI+L+L+HLDPAVL ERLPGISESA+IFAGVDVT++PIPV+PTVHYNMGGI
Sbjct: 315 GRGVGKNKDHIYLHLDHLDPAVLHERLPGISESAKIFAGVDVTKEPIPVLPTVHYNMGGI 374

Query: 371 PTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIRAS 430
           PTNYWGEVL+   ++P+R  PGLMA+GEAGCASVHGANRLGSNSLIDLVVFGRAA IRA 
Sbjct: 375 PTNYWGEVLNPTEEDPDRVQPGLMAVGEAGCASVHGANRLGSNSLIDLVVFGRAAAIRAG 434

Query: 431 EMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQDSL 490
           ++ID+ S IP +DI++CD+ M+RFDRLR A+G  PTA LREKMQR MQ DA VFRT++SL
Sbjct: 435 QVIDRKSKIPDIDIAACDKTMERFDRLRFANGSTPTAVLREKMQRTMQEDAAVFRTEESL 494

Query: 491 SDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRGSH 550
             G   +  LW E+ D+KV DRS+IWNSDLVETLEL+NLM NA+ TV SAEAR+ESRG+H
Sbjct: 495 KQGVERMEKLWHELPDIKVTDRSMIWNSDLVETLELENLMANALTTVVSAEARQESRGAH 554

Query: 551 AREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLC----GGVDYSKIAP 606
           AREDF D     R+D  WRKH+L  +  + GK+ LDYRPVH + L     GG+  +KIAP
Sbjct: 555 AREDFPD-----RNDAEWRKHTLSRLSPD-GKVTLDYRPVHLDPLTTEEEGGISLAKIAP 608

Query: 607 KARVY 611
           K RVY
Sbjct: 609 KKRVY 613


>gi|319406313|emb|CBI79950.1| SdhA succinate dehydrogenase flavoprotein subunit [Bartonella sp.
           AR 15-3]
          Length = 614

 Score =  975 bits (2520), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 460/608 (75%), Positives = 528/608 (86%), Gaps = 11/608 (1%)

Query: 8   KSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASL 67
           +++Y+YVDH +DVVV+GAGGAGLRATLGMAE+G +TACITKVFPTRSHTVAAQGGIAASL
Sbjct: 14  RAAYSYVDHKFDVVVIGAGGAGLRATLGMAEQGLRTACITKVFPTRSHTVAAQGGIAASL 73

Query: 68  ANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQR 127
           +NM PD+WQWHLYDT+KGSDWLGD DA++YL   AP +VYELEHYGVPFSR + GKIYQR
Sbjct: 74  SNMGPDNWQWHLYDTVKGSDWLGDTDAMEYLVRNAPAAVYELEHYGVPFSRTQEGKIYQR 133

Query: 128 PFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGC 187
           PFGGH   +GEGPPVQRTCAAADRTGHAILHTLYGQ+LK+NA+FFIEYFALDL++ ++G 
Sbjct: 134 PFGGHTTEFGEGPPVQRTCAAADRTGHAILHTLYGQSLKHNAQFFIEYFALDLVM-TDGV 192

Query: 188 CVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDM 247
           C GVVAW L+ G IHRFSAK+VVLATGGYGRAYFSATSAHTCTGDG GM+ARAGLPLQDM
Sbjct: 193 CTGVVAWNLDDGTIHRFSAKMVVLATGGYGRAYFSATSAHTCTGDGGGMIARAGLPLQDM 252

Query: 248 EFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMME 307
           EFVQFHPTGIYG+GCLITEGARGEGGYLVNS+GERFMERYAPS KDLASRD+VSRC+ +E
Sbjct: 253 EFVQFHPTGIYGSGCLITEGARGEGGYLVNSEGERFMERYAPSFKDLASRDLVSRCITLE 312

Query: 308 IREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNM 367
           IREGRGVG  KDHIHL LNH+DPA+L ERLPGISESARIFAGVD+T++PIPV+PTVHYNM
Sbjct: 313 IREGRGVGAKKDHIHLVLNHIDPAILHERLPGISESARIFAGVDLTKEPIPVLPTVHYNM 372

Query: 368 GGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVI 427
           GGIPTNY+GEVL+  + +P+R  PGLMA+GEAGCASVHGANRLGSNSLIDLVVFGRAA I
Sbjct: 373 GGIPTNYYGEVLNPTTDSPDRVQPGLMAVGEAGCASVHGANRLGSNSLIDLVVFGRAAAI 432

Query: 428 RASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQ 487
           RA E+ID+++ IP L+ ++ D I+ RFDRLR A G VPTA LREKMQRAMQ DA VFRT 
Sbjct: 433 RAGEVIDRNAEIPVLNEAAVDEIIARFDRLRFAQGQVPTAMLREKMQRAMQEDAAVFRTA 492

Query: 488 DSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESR 547
           DSL  GC+ +S +WDE++DLKV DRSLIWNSDLVETLEL+NLM NAI TVYSA AR ESR
Sbjct: 493 DSLEQGCQRISKIWDELSDLKVTDRSLIWNSDLVETLELENLMANAITTVYSAAARLESR 552

Query: 548 GSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLC----GGVDYSK 603
           G+HARED+ +     RDD NWR+H+L  +  + GK+ L YRPVH + L     GG+D  +
Sbjct: 553 GAHAREDYPE-----RDDNNWRRHTLSHLSQD-GKVTLSYRPVHVDPLTPEEDGGIDLKR 606

Query: 604 IAPKARVY 611
           I PK RVY
Sbjct: 607 IMPKKRVY 614


>gi|254707570|ref|ZP_05169398.1| succinate dehydrogenase flavoprotein subunit [Brucella
           pinnipedialis M163/99/10]
 gi|254708893|ref|ZP_05170704.1| succinate dehydrogenase flavoprotein subunit [Brucella
           pinnipedialis B2/94]
 gi|254713682|ref|ZP_05175493.1| succinate dehydrogenase flavoprotein subunit [Brucella ceti
           M644/93/1]
 gi|254715967|ref|ZP_05177778.1| succinate dehydrogenase flavoprotein subunit [Brucella ceti
           M13/05/1]
 gi|256030419|ref|ZP_05444033.1| succinate dehydrogenase flavoprotein subunit [Brucella
           pinnipedialis M292/94/1]
 gi|260169330|ref|ZP_05756141.1| succinate dehydrogenase flavoprotein subunit [Brucella sp. F5/99]
 gi|261217731|ref|ZP_05932012.1| succinate dehydrogenase flavoprotein subunit [Brucella ceti
           M13/05/1]
 gi|261315055|ref|ZP_05954252.1| succinate dehydrogenase flavoprotein subunit [Brucella
           pinnipedialis M163/99/10]
 gi|261316388|ref|ZP_05955585.1| succinate dehydrogenase flavoprotein subunit [Brucella
           pinnipedialis B2/94]
 gi|261321421|ref|ZP_05960618.1| succinate dehydrogenase flavoprotein subunit [Brucella ceti
           M644/93/1]
 gi|261758845|ref|ZP_06002554.1| succinate dehydrogenase [Brucella sp. F5/99]
 gi|265987461|ref|ZP_06100018.1| succinate dehydrogenase flavoprotein subunit [Brucella
           pinnipedialis M292/94/1]
 gi|260922820|gb|EEX89388.1| succinate dehydrogenase flavoprotein subunit [Brucella ceti
           M13/05/1]
 gi|261294111|gb|EEX97607.1| succinate dehydrogenase flavoprotein subunit [Brucella ceti
           M644/93/1]
 gi|261295611|gb|EEX99107.1| succinate dehydrogenase flavoprotein subunit [Brucella
           pinnipedialis B2/94]
 gi|261304081|gb|EEY07578.1| succinate dehydrogenase flavoprotein subunit [Brucella
           pinnipedialis M163/99/10]
 gi|261738829|gb|EEY26825.1| succinate dehydrogenase [Brucella sp. F5/99]
 gi|264659658|gb|EEZ29919.1| succinate dehydrogenase flavoprotein subunit [Brucella
           pinnipedialis M292/94/1]
          Length = 613

 Score =  975 bits (2520), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 473/605 (78%), Positives = 530/605 (87%), Gaps = 11/605 (1%)

Query: 11  YTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLANM 70
           YTYVDH +DVVVVGAGGAGLRATLGMAE+G KTACITKVFPTRSHTVAAQGGIAASL NM
Sbjct: 16  YTYVDHKFDVVVVGAGGAGLRATLGMAEQGLKTACITKVFPTRSHTVAAQGGIAASLKNM 75

Query: 71  TPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRPFG 130
            PDSWQWH+YDT+KGSDWLGD DA++YL  EAP +VYELEHYGVPFSR E GKIYQRPFG
Sbjct: 76  GPDSWQWHMYDTVKGSDWLGDTDAMEYLTREAPAAVYELEHYGVPFSRTEEGKIYQRPFG 135

Query: 131 GHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCCVG 190
           GHMQN+G+GPPVQRTCAAADRTGHAILHTLYGQ+LKNNA+FFIEYFALDLI+ ++G C G
Sbjct: 136 GHMQNFGDGPPVQRTCAAADRTGHAILHTLYGQSLKNNAQFFIEYFALDLIM-TDGVCTG 194

Query: 191 VVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDMEFV 250
           VVAW L+ G IHRFSAK+VVLA GGYGRAYFSATSAHTCTGDG GMVARAGLPLQDMEFV
Sbjct: 195 VVAWNLDDGTIHRFSAKMVVLAMGGYGRAYFSATSAHTCTGDGGGMVARAGLPLQDMEFV 254

Query: 251 QFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEIRE 310
           QFHPTGIYGAGCLITEGARGEGGYLVNS+GERFMERYAPSAKDLASRDVVSRCM MEIR 
Sbjct: 255 QFHPTGIYGAGCLITEGARGEGGYLVNSEGERFMERYAPSAKDLASRDVVSRCMTMEIRA 314

Query: 311 GRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMGGI 370
           GRGVGK+KDHI+L+L+HLDPAVL ERLPGISESA+IFAGVDVT++PIPV+PTVHYNMGGI
Sbjct: 315 GRGVGKNKDHIYLHLDHLDPAVLHERLPGISESAKIFAGVDVTKEPIPVLPTVHYNMGGI 374

Query: 371 PTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIRAS 430
           PTNYWGEVL+   ++P+R  PGLMA+GEAGCASVHGANRLGSNSLIDLVVFGRAA IRA 
Sbjct: 375 PTNYWGEVLNPTKEDPDRVQPGLMAVGEAGCASVHGANRLGSNSLIDLVVFGRAAAIRAG 434

Query: 431 EMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQDSL 490
           ++ID+ S IP +DI++CD+IM+RFDRLR A+G  PTA LREKMQR MQ DA VFRT++SL
Sbjct: 435 QVIDRKSKIPDIDIAACDKIMERFDRLRFANGSTPTAVLREKMQRTMQEDAAVFRTEESL 494

Query: 491 SDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRGSH 550
             G   +  LW E+ D+KV DRS+IWNSDLVETLEL+NLM NA+ TV SAEAR+ESRG+H
Sbjct: 495 KQGVERMEKLWHELPDIKVTDRSMIWNSDLVETLELENLMANALTTVVSAEARQESRGAH 554

Query: 551 AREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLC----GGVDYSKIAP 606
           AREDF D     R+D  WRKH+L  +  + GK+ LDYRPVH + L     GG+  +KIAP
Sbjct: 555 AREDFPD-----RNDAEWRKHTLSRLSPD-GKVTLDYRPVHLDPLTTEEEGGISLAKIAP 608

Query: 607 KARVY 611
           K RVY
Sbjct: 609 KKRVY 613


>gi|260464204|ref|ZP_05812397.1| succinate dehydrogenase or fumarate reductase, flavoprotein subunit
           [Mesorhizobium opportunistum WSM2075]
 gi|259030007|gb|EEW31290.1| succinate dehydrogenase or fumarate reductase, flavoprotein subunit
           [Mesorhizobium opportunistum WSM2075]
          Length = 611

 Score =  974 bits (2519), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 468/607 (77%), Positives = 534/607 (87%), Gaps = 10/607 (1%)

Query: 9   SSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLA 68
           + YT+VDH +DVVVVGAGGAGLRATLGMAE+G +TACITKVFPTRSHTVAAQGGIAASLA
Sbjct: 11  AGYTFVDHKFDVVVVGAGGAGLRATLGMAEQGLRTACITKVFPTRSHTVAAQGGIAASLA 70

Query: 69  NMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRP 128
           NM PD+WQWHL+DT+KGSDWLGD+DA +Y+  +AP +VYELEHYGVPFSR E GKIYQRP
Sbjct: 71  NMGPDNWQWHLFDTVKGSDWLGDIDAQEYMVQQAPAAVYELEHYGVPFSRTEEGKIYQRP 130

Query: 129 FGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCC 188
           FGG M N+GEGPPVQRTCAAADRTGHA+LHTLYGQ+LK+NA+FFIEYFALDLI+  +G C
Sbjct: 131 FGGMMMNFGEGPPVQRTCAAADRTGHAMLHTLYGQSLKHNAQFFIEYFALDLIMEPDGTC 190

Query: 189 VGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDME 248
            GVVAW L+ G IHRFSAK+VVLATGGYGRAYFSATSAHTCTGDG GM ARAG PLQDME
Sbjct: 191 TGVVAWNLDDGTIHRFSAKMVVLATGGYGRAYFSATSAHTCTGDGGGMAARAGFPLQDME 250

Query: 249 FVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEI 308
           FVQFHPTGIYGAGCLITEGARGEGGYLVNS+GERFMERYAPSAKDLASRDVVSRCM +EI
Sbjct: 251 FVQFHPTGIYGAGCLITEGARGEGGYLVNSEGERFMERYAPSAKDLASRDVVSRCMTLEI 310

Query: 309 REGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMG 368
           REGRGVG  KDHI L+L+HLDPAVL ERLPGISESA+IFAGVD+T++PIPV+PTVHYNMG
Sbjct: 311 REGRGVGPKKDHIFLHLDHLDPAVLHERLPGISESAKIFAGVDLTKEPIPVLPTVHYNMG 370

Query: 369 GIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIR 428
           G+PTNYWGEVL+  ++NP+R +PGLMA+GEAGCASVHGANRLGSNSLIDLVVFGRAA IR
Sbjct: 371 GVPTNYWGEVLNPTAENPDRVSPGLMAVGEAGCASVHGANRLGSNSLIDLVVFGRAAAIR 430

Query: 429 ASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQD 488
           A ++ID++S IPS + +S ++IMDRFDRLRHA+G  PTA LREKMQ+AMQ DA VFRTQ+
Sbjct: 431 AGQVIDRNSAIPSPNEASVEKIMDRFDRLRHANGSTPTAVLREKMQKAMQEDAAVFRTQE 490

Query: 489 SLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRG 548
           SL +GC+ +S +W E+ D+KV DRS+IWNSDLVETLEL+NLM NAI TVY A ARKESRG
Sbjct: 491 SLDNGCKRVSQIWGELKDIKVSDRSMIWNSDLVETLELENLMANAITTVYGAAARKESRG 550

Query: 549 SHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTEL----LCGGVDYSKI 604
           +HAREDF       RDDV WRKH+L  ++   G++ L YRPVHTEL      GG++ +KI
Sbjct: 551 AHAREDFS-----ARDDVTWRKHTLARLN-EAGEVTLSYRPVHTELQRKEADGGINPAKI 604

Query: 605 APKARVY 611
           APKARVY
Sbjct: 605 APKARVY 611


>gi|237816264|ref|ZP_04595257.1| succinate dehydrogenase, flavoprotein subunit [Brucella abortus
           str. 2308 A]
 gi|237788331|gb|EEP62546.1| succinate dehydrogenase, flavoprotein subunit [Brucella abortus
           str. 2308 A]
          Length = 619

 Score =  974 bits (2518), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 473/605 (78%), Positives = 530/605 (87%), Gaps = 11/605 (1%)

Query: 11  YTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLANM 70
           YTYVDH +DVVVVGAGGAGLRATLGMAE+G KTACITKVFPTRSHTVAAQGGIAASL NM
Sbjct: 22  YTYVDHKFDVVVVGAGGAGLRATLGMAEQGLKTACITKVFPTRSHTVAAQGGIAASLKNM 81

Query: 71  TPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRPFG 130
            PDSWQWH+YDT+KGSDWLGD DA++YL  EAP +VYELEHYGVPFSR E GKIYQRPFG
Sbjct: 82  GPDSWQWHMYDTVKGSDWLGDTDAMEYLTREAPAAVYELEHYGVPFSRTEEGKIYQRPFG 141

Query: 131 GHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCCVG 190
           GHMQN+G+GPPVQRTCAAADRTGHAILHTLYGQ+LKNNA+FFIEYFALDLI+ ++G C G
Sbjct: 142 GHMQNFGDGPPVQRTCAAADRTGHAILHTLYGQSLKNNAQFFIEYFALDLIM-TDGVCTG 200

Query: 191 VVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDMEFV 250
           VVAW L+ G IHRFSAK+VVLATGGYGRAYFSATSAHTCTGDG GMVARAGL LQDMEFV
Sbjct: 201 VVAWNLDDGTIHRFSAKMVVLATGGYGRAYFSATSAHTCTGDGGGMVARAGLLLQDMEFV 260

Query: 251 QFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEIRE 310
           QFHPTGIYGAGCLITEGARGEGGYLVNS+GERFMERYAPSAKDLASRDVVSRCM MEIR 
Sbjct: 261 QFHPTGIYGAGCLITEGARGEGGYLVNSEGERFMERYAPSAKDLASRDVVSRCMTMEIRA 320

Query: 311 GRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMGGI 370
           GRGVGK+KDHI+L+L+HLDPAVL ERLPGISESA+IFAGVDVT++PIPV+PTVHYNMGGI
Sbjct: 321 GRGVGKNKDHIYLHLDHLDPAVLHERLPGISESAKIFAGVDVTKEPIPVLPTVHYNMGGI 380

Query: 371 PTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIRAS 430
           PTNYWGEVL+   ++P+R  PGLMA+GEAGCASVHGANRLGSNSLIDLVVFGRAA IRA 
Sbjct: 381 PTNYWGEVLNPTKEDPDRVQPGLMAVGEAGCASVHGANRLGSNSLIDLVVFGRAAAIRAG 440

Query: 431 EMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQDSL 490
           ++ID+ S IP +DI++CD+IM+RFDRLR A+G  PTA LREKMQR MQ DA VFRT++SL
Sbjct: 441 QVIDRKSKIPDIDIAACDKIMERFDRLRFANGSTPTAVLREKMQRTMQEDAAVFRTEESL 500

Query: 491 SDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRGSH 550
             G   +  LW E+ D+KV DRS+IWNSDLVETLEL+NLM NA+ TV SAEAR+ESRG+H
Sbjct: 501 KQGVERMEKLWHELPDIKVTDRSMIWNSDLVETLELENLMANALTTVVSAEARQESRGAH 560

Query: 551 AREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLC----GGVDYSKIAP 606
           AREDF D     R+D  WRKH+L  +  + GK+ LDYRPVH + L     GG+  +KIAP
Sbjct: 561 AREDFPD-----RNDAEWRKHTLSRLSPD-GKVTLDYRPVHLDPLTTEEEGGISVAKIAP 614

Query: 607 KARVY 611
           K RVY
Sbjct: 615 KKRVY 619


>gi|62290758|ref|YP_222551.1| succinate dehydrogenase flavoprotein subunit [Brucella abortus bv.
           1 str. 9-941]
 gi|82700669|ref|YP_415243.1| succinate dehydrogenase flavoprotein subunit [Brucella melitensis
           biovar Abortus 2308]
 gi|189024971|ref|YP_001935739.1| succinate dehydrogenase flavoprotein subunit [Brucella abortus S19]
 gi|254696160|ref|ZP_05157988.1| succinate dehydrogenase flavoprotein subunit [Brucella abortus bv.
           2 str. 86/8/59]
 gi|254731078|ref|ZP_05189656.1| succinate dehydrogenase flavoprotein subunit [Brucella abortus bv.
           4 str. 292]
 gi|260546023|ref|ZP_05821763.1| succinate dehydrogenase [Brucella abortus NCTC 8038]
 gi|260758807|ref|ZP_05871155.1| succinate dehydrogenase flavoprotein subunit [Brucella abortus bv.
           4 str. 292]
 gi|260760531|ref|ZP_05872874.1| succinate dehydrogenase flavoprotein subunit [Brucella abortus bv.
           2 str. 86/8/59]
 gi|62196890|gb|AAX75190.1| SdhA, succinate dehydrogenase, flavoprotein subunit [Brucella
           abortus bv. 1 str. 9-941]
 gi|82616770|emb|CAJ11857.1| FAD-dependent pyridine nucleotide-disulphide
           oxidoreductase:Fumarate reductase/succinate
           dehydrogenase, FAD-binding site:Fuma [Brucella
           melitensis biovar Abortus 2308]
 gi|189020543|gb|ACD73265.1| succinate dehydrogenase [Brucella abortus S19]
 gi|260096130|gb|EEW80006.1| succinate dehydrogenase [Brucella abortus NCTC 8038]
 gi|260669125|gb|EEX56065.1| succinate dehydrogenase flavoprotein subunit [Brucella abortus bv.
           4 str. 292]
 gi|260670963|gb|EEX57784.1| succinate dehydrogenase flavoprotein subunit [Brucella abortus bv.
           2 str. 86/8/59]
          Length = 613

 Score =  973 bits (2516), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 473/605 (78%), Positives = 530/605 (87%), Gaps = 11/605 (1%)

Query: 11  YTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLANM 70
           YTYVDH +DVVVVGAGGAGLRATLGMAE+G KTACITKVFPTRSHTVAAQGGIAASL NM
Sbjct: 16  YTYVDHKFDVVVVGAGGAGLRATLGMAEQGLKTACITKVFPTRSHTVAAQGGIAASLKNM 75

Query: 71  TPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRPFG 130
            PDSWQWH+YDT+KGSDWLGD DA++YL  EAP +VYELEHYGVPFSR E GKIYQRPFG
Sbjct: 76  GPDSWQWHMYDTVKGSDWLGDTDAMEYLTREAPAAVYELEHYGVPFSRTEEGKIYQRPFG 135

Query: 131 GHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCCVG 190
           GHMQN+G+GPPVQRTCAAADRTGHAILHTLYGQ+LKNNA+FFIEYFALDLI+ ++G C G
Sbjct: 136 GHMQNFGDGPPVQRTCAAADRTGHAILHTLYGQSLKNNAQFFIEYFALDLIM-TDGVCTG 194

Query: 191 VVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDMEFV 250
           VVAW L+ G IHRFSAK+VVLATGGYGRAYFSATSAHTCTGDG GMVARAGL LQDMEFV
Sbjct: 195 VVAWNLDDGTIHRFSAKMVVLATGGYGRAYFSATSAHTCTGDGGGMVARAGLLLQDMEFV 254

Query: 251 QFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEIRE 310
           QFHPTGIYGAGCLITEGARGEGGYLVNS+GERFMERYAPSAKDLASRDVVSRCM MEIR 
Sbjct: 255 QFHPTGIYGAGCLITEGARGEGGYLVNSEGERFMERYAPSAKDLASRDVVSRCMTMEIRA 314

Query: 311 GRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMGGI 370
           GRGVGK+KDHI+L+L+HLDPAVL ERLPGISESA+IFAGVDVT++PIPV+PTVHYNMGGI
Sbjct: 315 GRGVGKNKDHIYLHLDHLDPAVLHERLPGISESAKIFAGVDVTKEPIPVLPTVHYNMGGI 374

Query: 371 PTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIRAS 430
           PTNYWGEVL+   ++P+R  PGLMA+GEAGCASVHGANRLGSNSLIDLVVFGRAA IRA 
Sbjct: 375 PTNYWGEVLNPTKEDPDRVQPGLMAVGEAGCASVHGANRLGSNSLIDLVVFGRAAAIRAG 434

Query: 431 EMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQDSL 490
           ++ID+ S IP +DI++CD+IM+RFDRLR A+G  PTA LREKMQR MQ DA VFRT++SL
Sbjct: 435 QVIDRKSKIPDIDIAACDKIMERFDRLRFANGSTPTAVLREKMQRTMQEDAAVFRTEESL 494

Query: 491 SDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRGSH 550
             G   +  LW E+ D+KV DRS+IWNSDLVETLEL+NLM NA+ TV SAEAR+ESRG+H
Sbjct: 495 KQGVERMEKLWHELPDIKVTDRSMIWNSDLVETLELENLMANALTTVVSAEARQESRGAH 554

Query: 551 AREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLC----GGVDYSKIAP 606
           AREDF D     R+D  WRKH+L  +  + GK+ LDYRPVH + L     GG+  +KIAP
Sbjct: 555 AREDFPD-----RNDAEWRKHTLSRLSPD-GKVTLDYRPVHLDPLTTEEEGGISVAKIAP 608

Query: 607 KARVY 611
           K RVY
Sbjct: 609 KKRVY 613


>gi|256158403|ref|ZP_05456301.1| succinate dehydrogenase flavoprotein subunit [Brucella ceti
           M490/95/1]
 gi|256253823|ref|ZP_05459359.1| succinate dehydrogenase flavoprotein subunit [Brucella ceti B1/94]
 gi|261220957|ref|ZP_05935238.1| succinate dehydrogenase flavoprotein subunit [Brucella ceti B1/94]
 gi|265996916|ref|ZP_06109473.1| succinate dehydrogenase flavoprotein subunit [Brucella ceti
           M490/95/1]
 gi|260919541|gb|EEX86194.1| succinate dehydrogenase flavoprotein subunit [Brucella ceti B1/94]
 gi|262551384|gb|EEZ07374.1| succinate dehydrogenase flavoprotein subunit [Brucella ceti
           M490/95/1]
          Length = 613

 Score =  973 bits (2516), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 472/605 (78%), Positives = 530/605 (87%), Gaps = 11/605 (1%)

Query: 11  YTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLANM 70
           YTYVDH +DVVVVGAGGAGLRATLGMAE+G KTACITKVFPTRSHTVAAQGGIAASL NM
Sbjct: 16  YTYVDHKFDVVVVGAGGAGLRATLGMAEQGLKTACITKVFPTRSHTVAAQGGIAASLKNM 75

Query: 71  TPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRPFG 130
            PDSWQWH+YDT+KGSDWLGD DA++YL  EAP +VYELEHYGVPFSR E GKIYQRPFG
Sbjct: 76  GPDSWQWHMYDTVKGSDWLGDTDAMEYLTREAPAAVYELEHYGVPFSRTEEGKIYQRPFG 135

Query: 131 GHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCCVG 190
           GHMQN+G+GPPVQRTCAAADRTGHAILHTLYGQ+LKNNA+FFIEYFALDLI+ ++G C G
Sbjct: 136 GHMQNFGDGPPVQRTCAAADRTGHAILHTLYGQSLKNNAQFFIEYFALDLIM-TDGVCTG 194

Query: 191 VVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDMEFV 250
           VVAW L+ G IHRFSAK+VVLA GGYGRAYFSATSAHTCTGDG GMVARAGLPLQDMEFV
Sbjct: 195 VVAWNLDDGTIHRFSAKMVVLAMGGYGRAYFSATSAHTCTGDGGGMVARAGLPLQDMEFV 254

Query: 251 QFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEIRE 310
           QFHPTGIYGAGCLITEGARGEGGYLVNS+GERFMERYAPSAKDLASRDVVSRC+ MEIR 
Sbjct: 255 QFHPTGIYGAGCLITEGARGEGGYLVNSEGERFMERYAPSAKDLASRDVVSRCITMEIRA 314

Query: 311 GRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMGGI 370
           GRGVGK+KDHI+L+L+HLDPAVL ERLPGISESA+IFAGVDVT++PIPV+PTVHYNMGGI
Sbjct: 315 GRGVGKNKDHIYLHLDHLDPAVLHERLPGISESAKIFAGVDVTKEPIPVLPTVHYNMGGI 374

Query: 371 PTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIRAS 430
           PTNYWGEVL+   ++P+R  PGLMA+GEAGCASVHGANRLGSNSLIDLVVFGRAA IRA 
Sbjct: 375 PTNYWGEVLNPTKEDPDRVQPGLMAVGEAGCASVHGANRLGSNSLIDLVVFGRAAAIRAG 434

Query: 431 EMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQDSL 490
           ++ID+ S IP +DI++CD+IM+RFDRLR A+G  PTA LREKMQR MQ DA VFRT++SL
Sbjct: 435 QVIDRKSKIPDIDIAACDKIMERFDRLRFANGSTPTAVLREKMQRTMQEDAAVFRTEESL 494

Query: 491 SDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRGSH 550
             G   +  LW E+ D+KV DRS+IWNSDLVETLEL+NLM NA+ TV SAEAR+ESRG+H
Sbjct: 495 KQGVERMEKLWHELPDIKVTDRSMIWNSDLVETLELENLMANALTTVVSAEARQESRGAH 554

Query: 551 AREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLC----GGVDYSKIAP 606
           AREDF D     R+D  WRKH+L  +  + GK+ LDYRPVH + L     GG+  +KIAP
Sbjct: 555 AREDFPD-----RNDAEWRKHTLSRLSPD-GKVTLDYRPVHLDPLTTEEEGGISLAKIAP 608

Query: 607 KARVY 611
           K RVY
Sbjct: 609 KKRVY 613


>gi|254694535|ref|ZP_05156363.1| succinate dehydrogenase flavoprotein subunit [Brucella abortus bv.
           3 str. Tulya]
 gi|256258300|ref|ZP_05463836.1| succinate dehydrogenase flavoprotein subunit [Brucella abortus bv.
           9 str. C68]
 gi|260884607|ref|ZP_05896221.1| succinate dehydrogenase flavoprotein subunit [Brucella abortus bv.
           9 str. C68]
 gi|261214854|ref|ZP_05929135.1| succinate dehydrogenase flavoprotein subunit [Brucella abortus bv.
           3 str. Tulya]
 gi|297247145|ref|ZP_06930863.1| succinate dehydrogenase, flavoprotein subunit [Brucella abortus bv.
           5 str. B3196]
 gi|260874135|gb|EEX81204.1| succinate dehydrogenase flavoprotein subunit [Brucella abortus bv.
           9 str. C68]
 gi|260916461|gb|EEX83322.1| succinate dehydrogenase flavoprotein subunit [Brucella abortus bv.
           3 str. Tulya]
 gi|297174314|gb|EFH33661.1| succinate dehydrogenase, flavoprotein subunit [Brucella abortus bv.
           5 str. B3196]
          Length = 613

 Score =  973 bits (2515), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 473/605 (78%), Positives = 530/605 (87%), Gaps = 11/605 (1%)

Query: 11  YTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLANM 70
           YTYVDH +DVVVVGAGGAGLRATLGMAE+G KTACITKVFPTRSHTVAAQGGIAASL NM
Sbjct: 16  YTYVDHKFDVVVVGAGGAGLRATLGMAEQGLKTACITKVFPTRSHTVAAQGGIAASLKNM 75

Query: 71  TPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRPFG 130
            PDSWQWH+YDT+KGSDWLGD DA++YL  EAP +VYELEHYGVPFSR E GKIYQRPFG
Sbjct: 76  GPDSWQWHMYDTVKGSDWLGDTDAMEYLTREAPAAVYELEHYGVPFSRTEEGKIYQRPFG 135

Query: 131 GHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCCVG 190
           GHMQN+G+GPPVQRTCAAADRTGHAILHTLYGQ+LKNNA+FFIEYFALDLI+ ++G C G
Sbjct: 136 GHMQNFGDGPPVQRTCAAADRTGHAILHTLYGQSLKNNAQFFIEYFALDLIM-TDGVCTG 194

Query: 191 VVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDMEFV 250
           VVAW L+ G IHRFSAK+VVLATGGYGRAYFSATSAHTCTGDG GMVARAGL LQDMEFV
Sbjct: 195 VVAWNLDDGTIHRFSAKMVVLATGGYGRAYFSATSAHTCTGDGGGMVARAGLLLQDMEFV 254

Query: 251 QFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEIRE 310
           QFHPTGIYGAGCLITEGARGEGGYLVNS+GERFMERYAPSAKDLASRDVVSRCM MEIR 
Sbjct: 255 QFHPTGIYGAGCLITEGARGEGGYLVNSEGERFMERYAPSAKDLASRDVVSRCMTMEIRA 314

Query: 311 GRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMGGI 370
           GRGVGK+KDHI+L+L+HLDPAVL ERLPGISESA+IFAGVDVT++PIPV+PTVHYNMGGI
Sbjct: 315 GRGVGKNKDHIYLHLDHLDPAVLHERLPGISESAKIFAGVDVTKEPIPVLPTVHYNMGGI 374

Query: 371 PTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIRAS 430
           PTNYWGEVL+   ++P+R  PGLMA+GEAGCASVHGANRLGSNSLIDLVVFGRAA IRA 
Sbjct: 375 PTNYWGEVLNPTKEDPDRVQPGLMAVGEAGCASVHGANRLGSNSLIDLVVFGRAAAIRAG 434

Query: 431 EMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQDSL 490
           ++ID+ S IP +DI++CD+IM+RFDRLR A+G  PTA LREKMQR MQ DA VFRT++SL
Sbjct: 435 QVIDRKSKIPDIDIAACDKIMERFDRLRFANGSTPTAVLREKMQRTMQEDAAVFRTEESL 494

Query: 491 SDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRGSH 550
             G   +  LW E+ D+KV DRS+IWNSDLVETLEL+NLM NA+ TV SAEAR+ESRG+H
Sbjct: 495 KQGVERMEKLWHELPDIKVTDRSMIWNSDLVETLELENLMANALTTVVSAEARQESRGAH 554

Query: 551 AREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLC----GGVDYSKIAP 606
           AREDF D     R+D  WRKH+L  +  + GK+ LDYRPVH + L     GG+  +KIAP
Sbjct: 555 AREDFPD-----RNDAEWRKHTLSRLSPD-GKVTLDYRPVHLDPLTTEEEGGISLAKIAP 608

Query: 607 KARVY 611
           K RVY
Sbjct: 609 KKRVY 613


>gi|254470733|ref|ZP_05084136.1| succinate dehydrogenase, flavoprotein subunit [Pseudovibrio sp.
           JE062]
 gi|211959875|gb|EEA95072.1| succinate dehydrogenase, flavoprotein subunit [Pseudovibrio sp.
           JE062]
          Length = 621

 Score =  972 bits (2512), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 471/611 (77%), Positives = 528/611 (86%), Gaps = 5/611 (0%)

Query: 5   SNLKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIA 64
           S    +Y +VDH +DVVVVGAGGAGLRATLGMAE+G KTACI+KVFPTRSHTVAAQGGIA
Sbjct: 12  SQSGKAYEFVDHKFDVVVVGAGGAGLRATLGMAEQGLKTACISKVFPTRSHTVAAQGGIA 71

Query: 65  ASLANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKI 124
           ASL NMTPD WQWH+YDT+KGSDWLGD DA++YLA EAP++VYELEHYGVPFSR E GKI
Sbjct: 72  ASLKNMTPDCWQWHMYDTVKGSDWLGDTDAMEYLAREAPKAVYELEHYGVPFSRTEEGKI 131

Query: 125 YQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINS 184
           YQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQ+L++NA+FFIEYFALDLI++ 
Sbjct: 132 YQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQSLRHNADFFIEYFALDLIMSD 191

Query: 185 EGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPL 244
           +G C GV+AW L+ G IHRFSAK+VVLATGGYGRAYFSATSAHTCTGDG GM+ARAGLPL
Sbjct: 192 DGVCQGVIAWNLDDGTIHRFSAKMVVLATGGYGRAYFSATSAHTCTGDGGGMIARAGLPL 251

Query: 245 QDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCM 304
           QDMEFVQFHPTGIYG+GCLITEGARGEGGYLVNS+GERFMERYAPSAKDLASRDVVSRCM
Sbjct: 252 QDMEFVQFHPTGIYGSGCLITEGARGEGGYLVNSEGERFMERYAPSAKDLASRDVVSRCM 311

Query: 305 MMEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVH 364
            MEIREGRGVGK+KDHI L+L+HLDP +L ERLPGISESARIFAGVDVT+ PIPV+PTVH
Sbjct: 312 TMEIREGRGVGKNKDHIFLHLDHLDPDLLAERLPGISESARIFAGVDVTKAPIPVLPTVH 371

Query: 365 YNMGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRA 424
           YNMGGIPTNYWGEVL+    +P   APGLMA+GEAGCASVHGANRLGSNSLIDLVVFGRA
Sbjct: 372 YNMGGIPTNYWGEVLNPTKDDPNAVAPGLMAVGEAGCASVHGANRLGSNSLIDLVVFGRA 431

Query: 425 AVIRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVF 484
           A IRA E+ID+ +PIP  + +S  +IM RFD+LR A G  PTA LR KMQ+ MQ DA VF
Sbjct: 432 AAIRAGEVIDREAPIPEPNEASSQKIMARFDKLRFAKGGTPTADLRLKMQKTMQEDAAVF 491

Query: 485 RTQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARK 544
           RTQ+SL  GC  +S +W E++DL V D S+IWNSDLVETLEL+NLM NAI TVY AEARK
Sbjct: 492 RTQESLEQGCERISAIWGELSDLHVSDSSMIWNSDLVETLELENLMANAITTVYGAEARK 551

Query: 545 ESRGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLC----GGVD 600
           ESRG+HARED+KDG  GGR+D  WRKH++  +  + GK+ L YRPV  E L     GG+D
Sbjct: 552 ESRGAHAREDYKDGPLGGRNDDEWRKHTISHLSED-GKVTLSYRPVVLEPLTTYEQGGID 610

Query: 601 YSKIAPKARVY 611
             KIAPKARVY
Sbjct: 611 MKKIAPKARVY 621


>gi|23502753|ref|NP_698880.1| succinate dehydrogenase flavoprotein subunit [Brucella suis 1330]
 gi|23348771|gb|AAN30795.1| succinate dehydrogenase, flavoprotein subunit [Brucella suis 1330]
          Length = 613

 Score =  972 bits (2512), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 472/605 (78%), Positives = 530/605 (87%), Gaps = 11/605 (1%)

Query: 11  YTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLANM 70
           YTYVD+ +DVVVVGAGGAGLRATLGMAE+G KTACITKVFPTRSHTVAAQGGIAASL NM
Sbjct: 16  YTYVDYKFDVVVVGAGGAGLRATLGMAEQGLKTACITKVFPTRSHTVAAQGGIAASLKNM 75

Query: 71  TPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRPFG 130
            PDSWQWH+YDT+KGSDWLGD DA++YL  EAP +VYELEHYGVPFSR E GKIYQRPFG
Sbjct: 76  GPDSWQWHMYDTVKGSDWLGDTDAMEYLTREAPAAVYELEHYGVPFSRTEEGKIYQRPFG 135

Query: 131 GHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCCVG 190
           GHMQN+G+GPPVQRTCAAADRTGHAILHTLYGQ+LKNNA+FFIEYFALDLI+ ++G C G
Sbjct: 136 GHMQNFGDGPPVQRTCAAADRTGHAILHTLYGQSLKNNAQFFIEYFALDLIM-TDGVCTG 194

Query: 191 VVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDMEFV 250
           VVAW L+ G IHRFSAK+VVLATGGYGRAYFSATSAHTCTGDG GMVARAGLPLQDMEFV
Sbjct: 195 VVAWNLDDGTIHRFSAKMVVLATGGYGRAYFSATSAHTCTGDGGGMVARAGLPLQDMEFV 254

Query: 251 QFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEIRE 310
           QFHPTGIYGAGCLITEGARGEGGYLVNS+GERFMERYAPSAKDLASRDVVSRCM MEIR 
Sbjct: 255 QFHPTGIYGAGCLITEGARGEGGYLVNSEGERFMERYAPSAKDLASRDVVSRCMTMEIRA 314

Query: 311 GRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMGGI 370
           GRGVGK+KDHI+L+L+HLDPAVL ERLPGISESA+IFAGVDVT++PIPV+PTVHYNMGGI
Sbjct: 315 GRGVGKNKDHIYLHLDHLDPAVLHERLPGISESAKIFAGVDVTKEPIPVLPTVHYNMGGI 374

Query: 371 PTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIRAS 430
           PTNYWGEVL+   ++P+R  PGLMA+GEAGCASVHGANRLGSNSLIDLVVFGRAA IRA 
Sbjct: 375 PTNYWGEVLNPTKEDPDRVQPGLMAVGEAGCASVHGANRLGSNSLIDLVVFGRAAAIRAG 434

Query: 431 EMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQDSL 490
           ++ID+ S IP +DI++CD+IM+RFDRLR A+G  PTA LREKMQR MQ DA VFRT++SL
Sbjct: 435 QVIDRKSKIPDIDIAACDKIMERFDRLRFANGSTPTAVLREKMQRTMQEDAAVFRTEESL 494

Query: 491 SDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRGSH 550
             G   +  LW E+ D+KV DRS+IWNSDLVETLEL+NLM NA+ TV SAEAR+ESRG+H
Sbjct: 495 KQGVERMEKLWHELPDIKVTDRSMIWNSDLVETLELENLMANALTTVVSAEARQESRGAH 554

Query: 551 AREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLC----GGVDYSKIAP 606
           AREDF D     R+D  WRKH+L  +  + GK+ LDYR VH + L     GG+  +KIAP
Sbjct: 555 AREDFPD-----RNDAEWRKHTLSRLSPD-GKVTLDYRSVHLDPLTTEEEGGISLAKIAP 608

Query: 607 KARVY 611
           K RVY
Sbjct: 609 KKRVY 613


>gi|319899434|ref|YP_004159531.1| SdhA succinate dehydrogenase flavoprotein subunit [Bartonella
           clarridgeiae 73]
 gi|319403402|emb|CBI76970.1| SdhA succinate dehydrogenase flavoprotein subunit [Bartonella
           clarridgeiae 73]
          Length = 614

 Score =  971 bits (2510), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 456/607 (75%), Positives = 528/607 (86%), Gaps = 11/607 (1%)

Query: 9   SSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLA 68
           ++Y+YVDH +DVVV+GAGGAGLRATLGMAE+G +TACITKVFPTRSHTVAAQGGIAASL+
Sbjct: 15  AAYSYVDHKFDVVVIGAGGAGLRATLGMAEQGLRTACITKVFPTRSHTVAAQGGIAASLS 74

Query: 69  NMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRP 128
           NM PD+WQWHLYDT+KGSDWLGD DA++YL   AP +VYELEHYGVPFSR + GKIYQRP
Sbjct: 75  NMGPDNWQWHLYDTVKGSDWLGDTDAMEYLVRNAPAAVYELEHYGVPFSRTQEGKIYQRP 134

Query: 129 FGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCC 188
           FGGH   +GEGPPVQRTCAAADRTGHAILHTLYGQ+LK+NA+FFIEYFALDLI+ ++G C
Sbjct: 135 FGGHTTEFGEGPPVQRTCAAADRTGHAILHTLYGQSLKHNAQFFIEYFALDLIM-TDGVC 193

Query: 189 VGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDME 248
            GVVAW L+ G IHRFSAK+VVLATGGYGRAYFSATSAHTCTGDG GM+ARAGLPLQDME
Sbjct: 194 TGVVAWNLDDGTIHRFSAKMVVLATGGYGRAYFSATSAHTCTGDGGGMIARAGLPLQDME 253

Query: 249 FVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEI 308
           FVQFHPTGIYG+GCLITEGARGEGGYLVNS+GERFMERYAPS KDLASRD+VSRC+ +EI
Sbjct: 254 FVQFHPTGIYGSGCLITEGARGEGGYLVNSEGERFMERYAPSFKDLASRDLVSRCITLEI 313

Query: 309 REGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMG 368
           REGRGVG  KDHIHL LNH+DPA+L ERLPGISESARIFAGVD+T++P+PV+PTVHYNMG
Sbjct: 314 REGRGVGAKKDHIHLVLNHIDPAILHERLPGISESARIFAGVDLTKEPVPVLPTVHYNMG 373

Query: 369 GIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIR 428
           GIPTNY+GEVL+  + +P+R  PGLMA+GEAGCASVHGANRLGSNSLIDLVVFGRAA IR
Sbjct: 374 GIPTNYYGEVLNPTADSPDRVQPGLMAVGEAGCASVHGANRLGSNSLIDLVVFGRAAAIR 433

Query: 429 ASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQD 488
           A E+ID+++ IP+++ ++ D I+ RFDRLR A G +PTA LREKMQRAMQ DA VFRT +
Sbjct: 434 AGEVIDRNAEIPAINETAVDEIIARFDRLRFAQGQIPTAMLREKMQRAMQEDAAVFRTAN 493

Query: 489 SLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRG 548
           SL  GC+ +S +WDE++DLKV DRSLIWNSDLVETLEL+NLM NAI TVYSA AR ESRG
Sbjct: 494 SLEQGCQRVSKIWDELSDLKVTDRSLIWNSDLVETLELENLMANAITTVYSAAARLESRG 553

Query: 549 SHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLC----GGVDYSKI 604
           +HARED+ +     RDD NWR+H+L  +  + GK+ L YRPVH + L     GG+D  +I
Sbjct: 554 AHAREDYPE-----RDDKNWRRHTLSHLSKD-GKVTLSYRPVHIDPLTSQEDGGIDLKRI 607

Query: 605 APKARVY 611
            PK R+Y
Sbjct: 608 MPKKRIY 614


>gi|254690047|ref|ZP_05153301.1| succinate dehydrogenase flavoprotein subunit [Brucella abortus bv.
           6 str. 870]
 gi|260755581|ref|ZP_05867929.1| succinate dehydrogenase flavoprotein subunit [Brucella abortus bv.
           6 str. 870]
 gi|260675689|gb|EEX62510.1| succinate dehydrogenase flavoprotein subunit [Brucella abortus bv.
           6 str. 870]
          Length = 613

 Score =  969 bits (2505), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 472/605 (78%), Positives = 529/605 (87%), Gaps = 11/605 (1%)

Query: 11  YTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLANM 70
           YTYVDH +DVVVVGAGGAGLRATLGMAE+G KTACITKVFPTRSHTVAAQGGIAASL NM
Sbjct: 16  YTYVDHKFDVVVVGAGGAGLRATLGMAEQGLKTACITKVFPTRSHTVAAQGGIAASLKNM 75

Query: 71  TPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRPFG 130
            PDSWQWH+YDT+KGSDWLGD DA++YL  EAP +VYELEHYGVPFSR E GKIYQRPFG
Sbjct: 76  GPDSWQWHMYDTVKGSDWLGDTDAMEYLTREAPAAVYELEHYGVPFSRTEEGKIYQRPFG 135

Query: 131 GHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCCVG 190
           GHMQN+G+GPPVQRTCAAADRTGHAILHTLYGQ+LKNNA+FFIEYFALDLI+ ++G C G
Sbjct: 136 GHMQNFGDGPPVQRTCAAADRTGHAILHTLYGQSLKNNAQFFIEYFALDLIM-TDGVCTG 194

Query: 191 VVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDMEFV 250
           VVAW L+ G IHRFSAK+VVLATGGYGRAYFSATSAHTCTGDG GMVARAGL LQDMEFV
Sbjct: 195 VVAWNLDDGTIHRFSAKMVVLATGGYGRAYFSATSAHTCTGDGGGMVARAGLLLQDMEFV 254

Query: 251 QFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEIRE 310
           QFHPTGIYGAGCLITEGARGEGGYLVNS+GERFMERYAPSAKDLASRDVVSRCM MEIR 
Sbjct: 255 QFHPTGIYGAGCLITEGARGEGGYLVNSEGERFMERYAPSAKDLASRDVVSRCMTMEIRA 314

Query: 311 GRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMGGI 370
           GRGVGK+KDHI+L+L+HLDPAVL ERLPGISESA+IFAGVDVT++PIPV+PTVHYNMGGI
Sbjct: 315 GRGVGKNKDHIYLHLDHLDPAVLHERLPGISESAKIFAGVDVTKEPIPVLPTVHYNMGGI 374

Query: 371 PTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIRAS 430
           PTNYWGEVL+   ++P+R  PGLMA+GEAGCASVHGANRLGSNSLIDLVVFGRAA IRA 
Sbjct: 375 PTNYWGEVLNPTKEDPDRVQPGLMAVGEAGCASVHGANRLGSNSLIDLVVFGRAAAIRAG 434

Query: 431 EMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQDSL 490
           ++ID+ S I  +DI++CD+IM+RFDRLR A+G  PTA LREKMQR MQ DA VFRT++SL
Sbjct: 435 QVIDRKSKILDIDIAACDKIMERFDRLRFANGSTPTAVLREKMQRTMQEDAAVFRTEESL 494

Query: 491 SDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRGSH 550
             G   +  LW E+ D+KV DRS+IWNSDLVETLEL+NLM NA+ TV SAEAR+ESRG+H
Sbjct: 495 KQGVERMEKLWHELPDIKVTDRSMIWNSDLVETLELENLMANALTTVVSAEARQESRGAH 554

Query: 551 AREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLC----GGVDYSKIAP 606
           AREDF D     R+D  WRKH+L  +  + GK+ LDYRPVH + L     GG+  +KIAP
Sbjct: 555 AREDFPD-----RNDAEWRKHTLSRLSPD-GKVTLDYRPVHLDPLTTEEEGGISLAKIAP 608

Query: 607 KARVY 611
           K RVY
Sbjct: 609 KKRVY 613


>gi|110635573|ref|YP_675781.1| succinate dehydrogenase flavoprotein subunit [Mesorhizobium sp.
           BNC1]
 gi|110286557|gb|ABG64616.1| succinate dehydrogenase subunit A [Chelativorans sp. BNC1]
          Length = 611

 Score =  963 bits (2490), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 469/606 (77%), Positives = 534/606 (88%), Gaps = 10/606 (1%)

Query: 10  SYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLAN 69
           +YTYVDH +DVVVVGAGGAGLRATLGMAE+G KTACITKVFPTRSHTVAAQGGIAASL N
Sbjct: 12  AYTYVDHVFDVVVVGAGGAGLRATLGMAEQGLKTACITKVFPTRSHTVAAQGGIAASLRN 71

Query: 70  MTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRPF 129
           M PD WQWHLYDT+KGSDWLGDVDA++YLA EAP ++YELEHYGVPFSR + G+IYQRPF
Sbjct: 72  MGPDDWQWHLYDTVKGSDWLGDVDAMEYLAREAPAAIYELEHYGVPFSRTDDGRIYQRPF 131

Query: 130 GGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCCV 189
           GGHMQN+G+GPPVQRTCAAADRTGHAILHTLYGQ++K++A+FF+EYFALDLI++ +G C 
Sbjct: 132 GGHMQNFGDGPPVQRTCAAADRTGHAILHTLYGQSVKHHAQFFVEYFALDLIMSPDGVCT 191

Query: 190 GVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDMEF 249
           GVVAW LE G IHRF+AK+VVLATGGYGRAYFS TSAHTCTGDG GMVARAGLPLQDMEF
Sbjct: 192 GVVAWNLEDGTIHRFAAKMVVLATGGYGRAYFSCTSAHTCTGDGNGMVARAGLPLQDMEF 251

Query: 250 VQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEIR 309
           VQFHPTG+YGAG LITEGARGEGGYLVN++GERFMERYAPSAKDLASRDVVSRCM +EIR
Sbjct: 252 VQFHPTGVYGAGVLITEGARGEGGYLVNAEGERFMERYAPSAKDLASRDVVSRCMTLEIR 311

Query: 310 EGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMGG 369
           EGRGVG  KDHI L+L+HLDPAVL ERLPGI+ESARIFAGVD+TR+PIPV+PTVHYNMGG
Sbjct: 312 EGRGVGPKKDHIFLHLDHLDPAVLHERLPGITESARIFAGVDLTREPIPVLPTVHYNMGG 371

Query: 370 IPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIRA 429
           IPTNY GEVL+    NP+   PGLMA GEA CASVHGANRLGSNSL DLVVFGRAA IRA
Sbjct: 372 IPTNYHGEVLNPTLDNPDAIVPGLMAAGEAACASVHGANRLGSNSLTDLVVFGRAAAIRA 431

Query: 430 SEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQDS 489
             ++D+ S +P +D+++C++IMDRFDR+RHA G  PTAALREKMQRAMQ DA VFRTQ+S
Sbjct: 432 GMVVDRESKVPPIDLAACEKIMDRFDRIRHASGSTPTAALREKMQRAMQEDAAVFRTQES 491

Query: 490 LSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRGS 549
           L  GCR +S  W E++D+KV DRS+IWNSDL+ETLEL+NLM NAIATV+SAEARKESRG+
Sbjct: 492 LEQGCRRVSQAWGELSDIKVQDRSMIWNSDLMETLELENLMANAIATVFSAEARKESRGA 551

Query: 550 HAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLC----GGVDYSKIA 605
           HAREDF +     RDD NWRKH+L WVD + G ++LDYRPVHTE +     GG+D ++IA
Sbjct: 552 HAREDFTE-----RDDANWRKHTLSWVDPD-GTVRLDYRPVHTEPMLKPENGGIDPARIA 605

Query: 606 PKARVY 611
           PK RVY
Sbjct: 606 PKKRVY 611


>gi|319409391|emb|CBI83035.1| SdhA succinate dehydrogenase flavoprotein subunit [Bartonella
           schoenbuchensis R1]
          Length = 614

 Score =  962 bits (2488), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 457/607 (75%), Positives = 521/607 (85%), Gaps = 11/607 (1%)

Query: 9   SSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLA 68
           + Y YVDH +DVVV+GAGG+GLRATLGMAE+G +TACITKVFPTRSHTVAAQGGIAASLA
Sbjct: 15  APYHYVDHKFDVVVIGAGGSGLRATLGMAEQGLRTACITKVFPTRSHTVAAQGGIAASLA 74

Query: 69  NMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRP 128
           NM PD+WQWHLYDT+KGSDWLGD DA++YL   AP +VYELEHYGVPFSR + GKIYQRP
Sbjct: 75  NMGPDNWQWHLYDTVKGSDWLGDTDAMEYLVRNAPAAVYELEHYGVPFSRTQEGKIYQRP 134

Query: 129 FGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCC 188
           FGGH   +GEGPPVQRTCAAADRTGHAILH LYGQ+LK+NA+FFIEYFALDLI+ ++G C
Sbjct: 135 FGGHTTQFGEGPPVQRTCAAADRTGHAILHALYGQSLKHNAQFFIEYFALDLIM-TDGVC 193

Query: 189 VGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDME 248
            GVVAW L+ G IHRFSAK+VVLATGGYGRAYFSATSAHTCTGDG GM+ARAGLPLQDME
Sbjct: 194 TGVVAWNLDDGTIHRFSAKMVVLATGGYGRAYFSATSAHTCTGDGGGMIARAGLPLQDME 253

Query: 249 FVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEI 308
           FVQFHPTGIYG+GCLITEGARGEGGYL+NS+GERFMERYAPS KDLASRD+VSRC+ +EI
Sbjct: 254 FVQFHPTGIYGSGCLITEGARGEGGYLINSEGERFMERYAPSFKDLASRDLVSRCITLEI 313

Query: 309 REGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMG 368
           REGRGVG  KDHIHL LNH+DPA+L ERLPGISESARIFAGVDVT+DPIPV+PTVHYNMG
Sbjct: 314 REGRGVGAKKDHIHLVLNHIDPAILHERLPGISESARIFAGVDVTKDPIPVLPTVHYNMG 373

Query: 369 GIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIR 428
           GIPTNY+GEVL+  S +P+   PGLMA+GEAGCASVHGANRLGSNSLIDLVVFGRAA IR
Sbjct: 374 GIPTNYYGEVLNPTSDSPDCVQPGLMAVGEAGCASVHGANRLGSNSLIDLVVFGRAAAIR 433

Query: 429 ASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQD 488
           A ++ID+++ IP+++ ++ D IM RFDRLR A GH PTA LREKMQR MQ DA VFRT D
Sbjct: 434 AGKIIDRNAEIPAINETAVDEIMARFDRLRFAQGHTPTAVLREKMQRTMQEDAAVFRTAD 493

Query: 489 SLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRG 548
           SL  GC+ +S LW+E++DLKV D SLIWNSDLVETLEL+NLM NAI TV+SA AR ESRG
Sbjct: 494 SLEQGCQRVSKLWNELSDLKVTDHSLIWNSDLVETLELENLMANAITTVHSAAARLESRG 553

Query: 549 SHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLC----GGVDYSKI 604
           +HARED+ +     RDD NWR H+L  +  + GK+ L YRPVH + L     GG+D  +I
Sbjct: 554 AHAREDYPE-----RDDKNWRCHTLSHLSKD-GKVTLSYRPVHVDPLTSEADGGIDLKRI 607

Query: 605 APKARVY 611
            PK RVY
Sbjct: 608 VPKKRVY 614


>gi|319404828|emb|CBI78429.1| SdhA succinate dehydrogenase flavoprotein subunit [Bartonella
           rochalimae ATCC BAA-1498]
          Length = 614

 Score =  952 bits (2462), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 461/608 (75%), Positives = 526/608 (86%), Gaps = 11/608 (1%)

Query: 8   KSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASL 67
           +++Y YVDH +DVVVVGAGGAGLRATLGMAE+G +TACITKVFPTRSHTVAAQGGIAASL
Sbjct: 14  RAAYNYVDHKFDVVVVGAGGAGLRATLGMAEQGLRTACITKVFPTRSHTVAAQGGIAASL 73

Query: 68  ANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQR 127
           +NM PD+WQWHLYDT+KGSDWLGD DA++YL   AP +VYELEHYGVPFSR + GKIYQR
Sbjct: 74  SNMGPDNWQWHLYDTVKGSDWLGDTDAMEYLVRNAPAAVYELEHYGVPFSRTQEGKIYQR 133

Query: 128 PFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGC 187
           PFGGH   +GEGPPVQRTCAAADRTGHAILHTLYGQ+LK+NA+FF+EYFALDLI+ ++G 
Sbjct: 134 PFGGHTTEFGEGPPVQRTCAAADRTGHAILHTLYGQSLKHNAQFFVEYFALDLIM-TDGV 192

Query: 188 CVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDM 247
           C GVVAW L+ G IHRFSAK+VVLATGGYGRAYFSATSAHTCTGDG GM+ARAGLPLQDM
Sbjct: 193 CTGVVAWNLDDGTIHRFSAKMVVLATGGYGRAYFSATSAHTCTGDGGGMIARAGLPLQDM 252

Query: 248 EFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMME 307
           EFVQFHPTGIYG+GCLITEGARGEGGYLVNS+GERFMERYAPS KDLASRD+VSRC+ +E
Sbjct: 253 EFVQFHPTGIYGSGCLITEGARGEGGYLVNSEGERFMERYAPSFKDLASRDLVSRCITLE 312

Query: 308 IREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNM 367
           IREGRGVG  KDHIHL LNH+DPA+L ERLPGISESARIFAGVD+T++PIPV+PTVHYNM
Sbjct: 313 IREGRGVGAKKDHIHLVLNHIDPAILHERLPGISESARIFAGVDLTKEPIPVLPTVHYNM 372

Query: 368 GGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVI 427
           GGIPTNY+GEVL+    +P+R  PGLMA+GEAGCASVHGANRLGSNSLIDLVVFGRAA I
Sbjct: 373 GGIPTNYYGEVLNPTLDSPDRVQPGLMAVGEAGCASVHGANRLGSNSLIDLVVFGRAAAI 432

Query: 428 RASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQ 487
           RA E+ID+ + IP+L+ ++ D IM RFDRLR A G VPTA LREKMQRAMQ DA VFRT 
Sbjct: 433 RAGEVIDRDAEIPALNEAAVDAIMARFDRLRFAQGQVPTAMLREKMQRAMQEDAAVFRTA 492

Query: 488 DSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESR 547
           DSL  GC+ +S +WDE++DLKV DRSLIWNS+LVETLEL+NLM NAI TVYSA AR ESR
Sbjct: 493 DSLEQGCQRISKIWDELSDLKVTDRSLIWNSNLVETLELENLMANAITTVYSAAARLESR 552

Query: 548 GSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLC----GGVDYSK 603
           G+HARED+ +     RDD NWR+H+L  +  + GK+ L YRPVH + L     GG+D  +
Sbjct: 553 GAHAREDYPE-----RDDKNWRRHTLSHLSQD-GKVTLSYRPVHVDPLTFEEDGGIDLKR 606

Query: 604 IAPKARVY 611
           I PK RVY
Sbjct: 607 IMPKKRVY 614


>gi|260446907|emb|CBG76061.1| succinate dehydrogenase FAD subunit [Bartonella birtlesii]
          Length = 614

 Score =  951 bits (2457), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 464/608 (76%), Positives = 521/608 (85%), Gaps = 11/608 (1%)

Query: 8   KSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASL 67
            + Y  VDH +DVVVVGAGGAGLRATLGMAE+G KTACITKVFPTRSHTVAAQGGIAASL
Sbjct: 14  NAPYCTVDHKFDVVVVGAGGAGLRATLGMAEQGLKTACITKVFPTRSHTVAAQGGIAASL 73

Query: 68  ANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQR 127
           +NM PD+WQWHLYDT+KGSDWLGD DA++YL   AP +VYELEHYGVPFSR + GKIYQR
Sbjct: 74  SNMGPDNWQWHLYDTVKGSDWLGDTDAMEYLVRNAPAAVYELEHYGVPFSRTQEGKIYQR 133

Query: 128 PFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGC 187
           PFGGH   +GEGPPVQRTCAAADRTGHAILHTLYGQ+LK+NA+FFIEYFALDLI+ ++G 
Sbjct: 134 PFGGHTTQFGEGPPVQRTCAAADRTGHAILHTLYGQSLKHNAQFFIEYFALDLIM-TDGV 192

Query: 188 CVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDM 247
           C GVVAW L+ G IHRFSAK+VVLATGGYGRAYFSATSAHTCTGDG GM+ARAGLPLQDM
Sbjct: 193 CTGVVAWNLDDGTIHRFSAKMVVLATGGYGRAYFSATSAHTCTGDGGGMIARAGLPLQDM 252

Query: 248 EFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMME 307
           EFVQFHPTGIYG+GCLITEGARGEGGYL+NS+GERFMERYAPS KDLASRD+VSRC+ +E
Sbjct: 253 EFVQFHPTGIYGSGCLITEGARGEGGYLINSEGERFMERYAPSFKDLASRDLVSRCITLE 312

Query: 308 IREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNM 367
           IREGRGVG   DHIHL LNH+DPA+L ERLPGISESARIFAGVDVTR+PIP++PTVHYNM
Sbjct: 313 IREGRGVGPRLDHIHLVLNHIDPAILHERLPGISESARIFAGVDVTREPIPILPTVHYNM 372

Query: 368 GGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVI 427
           GGIPTNY+GEVL+  + +P+R  PGLMA+GEAGCASVHGANRLGSNSLIDLVVFGRAA I
Sbjct: 373 GGIPTNYYGEVLNPTADSPDRIQPGLMAVGEAGCASVHGANRLGSNSLIDLVVFGRAAAI 432

Query: 428 RASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQ 487
           RA E+ID+ + IP L+ ++ D IM RFDRLR A G  PTA LREKMQR MQ DA VFRT+
Sbjct: 433 RAGEVIDRDAEIPPLNEAAVDEIMARFDRLRFAQGATPTAVLREKMQRTMQEDAAVFRTE 492

Query: 488 DSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESR 547
           DSL  GCR +S +WD +ADLKV DRSLIWNSDLVETLEL+NLM NAI TVYSAEAR ESR
Sbjct: 493 DSLQQGCRRISQIWDGLADLKVTDRSLIWNSDLVETLELENLMANAITTVYSAEARLESR 552

Query: 548 GSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLC----GGVDYSK 603
           G+HARED+ +     RDD NWRKH+L  +    GK+ L YRPVH + L     GG+D  +
Sbjct: 553 GAHAREDYPE-----RDDKNWRKHTLSHLS-KEGKVTLSYRPVHVDPLTAEADGGIDLKR 606

Query: 604 IAPKARVY 611
           IAPK RVY
Sbjct: 607 IAPKKRVY 614


>gi|49476233|ref|YP_034274.1| succinate dehydrogenase flavoprotein subunit [Bartonella henselae
           str. Houston-1]
 gi|49239041|emb|CAF28341.1| Succinate dehydrogenase, flavoprotein subunit [Bartonella henselae
           str. Houston-1]
          Length = 614

 Score =  951 bits (2457), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 462/608 (75%), Positives = 523/608 (86%), Gaps = 11/608 (1%)

Query: 8   KSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASL 67
            + Y  VDH +DVVVVGAGGAGLRATLGMAE+G KTACITKVFPTRSHTVAAQGGIAASL
Sbjct: 14  NAPYRTVDHKFDVVVVGAGGAGLRATLGMAEQGLKTACITKVFPTRSHTVAAQGGIAASL 73

Query: 68  ANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQR 127
           +NM PD+WQWHLYDT+KGSDWLGD DA++YL   AP +VYELEHYGVPFSR + GKIYQR
Sbjct: 74  SNMGPDNWQWHLYDTVKGSDWLGDTDAMEYLVRNAPAAVYELEHYGVPFSRTQEGKIYQR 133

Query: 128 PFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGC 187
           PFGGH   +GEGPPVQRTCAAADRTGHAILHTLYGQ+LK+NA+FFIEYFALDLI+ ++G 
Sbjct: 134 PFGGHTTQFGEGPPVQRTCAAADRTGHAILHTLYGQSLKHNAQFFIEYFALDLIM-TDGV 192

Query: 188 CVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDM 247
           C GVVAW L+ G IHRF+AK+VVLATGGYGRAYFSATSAHTCTGDG GM+ARAGLPLQDM
Sbjct: 193 CTGVVAWNLDDGVIHRFAAKMVVLATGGYGRAYFSATSAHTCTGDGGGMIARAGLPLQDM 252

Query: 248 EFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMME 307
           EFVQFHPTGIYG+GCLITEGARGEGGYL+NS+GERFMERYAPS KDLASRD+VSRC+ +E
Sbjct: 253 EFVQFHPTGIYGSGCLITEGARGEGGYLINSEGERFMERYAPSFKDLASRDLVSRCITLE 312

Query: 308 IREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNM 367
           IREGRGVG  KDHIHL LNH+DPA+L ERLPGISESARIFAGVDVT++PIP++PTVHYNM
Sbjct: 313 IREGRGVGPRKDHIHLVLNHIDPAILHERLPGISESARIFAGVDVTKEPIPILPTVHYNM 372

Query: 368 GGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVI 427
           GGIPTNY+GEVL+    +P+R  PGLMA+GEAGCASVHGANRLGSNSLIDLVVFGRAA I
Sbjct: 373 GGIPTNYYGEVLNPTPDSPDRVQPGLMAVGEAGCASVHGANRLGSNSLIDLVVFGRAAAI 432

Query: 428 RASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQ 487
           RA E+ID+++ IP L+  + D IM RFDRLR A G +PTA LREKMQR MQ DA VFRT+
Sbjct: 433 RAGEVIDRNAEIPPLNEVAIDEIMTRFDRLRFAQGAIPTAVLREKMQRTMQEDAAVFRTE 492

Query: 488 DSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESR 547
           DSL  GC+ +S +W E+ADLKV DRSLIWNSDLVETLEL+NLM NAI TVYSAEAR ESR
Sbjct: 493 DSLQQGCQRISQIWGELADLKVTDRSLIWNSDLVETLELENLMANAITTVYSAEARLESR 552

Query: 548 GSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLC----GGVDYSK 603
           G+HARED+ +     RDD NWRKH+L  +  + GK+ L YRPVH + L     GG+D  +
Sbjct: 553 GAHAREDYPE-----RDDKNWRKHTLSHLSKD-GKVTLSYRPVHIDPLTSEADGGIDLKR 606

Query: 604 IAPKARVY 611
           IAPK RVY
Sbjct: 607 IAPKKRVY 614


>gi|319407788|emb|CBI81439.1| SdhA succinate dehydrogenase flavoprotein subunit [Bartonella sp.
           1-1C]
          Length = 614

 Score =  950 bits (2456), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 460/608 (75%), Positives = 526/608 (86%), Gaps = 11/608 (1%)

Query: 8   KSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASL 67
           +++Y YVDH +DVVVVGAGGAGLRATLGMAE+G +TACITKVFPTRSHTVAAQGGIAASL
Sbjct: 14  RAAYNYVDHKFDVVVVGAGGAGLRATLGMAEQGLRTACITKVFPTRSHTVAAQGGIAASL 73

Query: 68  ANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQR 127
           +NM PD+WQWHLYDT+KGSDWLGD DA++YL   AP +VYELEHYGVPFSR + GKIYQR
Sbjct: 74  SNMGPDNWQWHLYDTVKGSDWLGDTDAMEYLVRNAPAAVYELEHYGVPFSRTQEGKIYQR 133

Query: 128 PFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGC 187
           PFGGH   +GEGPPVQRTCAAADRTGHAILHTLYGQ+LK+NA+FF+EYFALDLI+ ++G 
Sbjct: 134 PFGGHTTEFGEGPPVQRTCAAADRTGHAILHTLYGQSLKHNAQFFVEYFALDLIM-TDGV 192

Query: 188 CVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDM 247
           C GVVAW L+ G IHRFSAK+VVLATGGYGRAYFSATSAHTCTGDG GM+ARAGLPLQDM
Sbjct: 193 CTGVVAWNLDDGTIHRFSAKMVVLATGGYGRAYFSATSAHTCTGDGGGMIARAGLPLQDM 252

Query: 248 EFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMME 307
           EFVQFHPTGIYG+GCLITEGARGEGGYLVNS+GERFMERYAPS KDLASRD+VSRC+ +E
Sbjct: 253 EFVQFHPTGIYGSGCLITEGARGEGGYLVNSEGERFMERYAPSFKDLASRDLVSRCITLE 312

Query: 308 IREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNM 367
           IREGRGVG  KDHIHL LNH+DPA+L ERLPGISESARIFAGVD+T++PIPV+PTVHYNM
Sbjct: 313 IREGRGVGAKKDHIHLVLNHIDPAILHERLPGISESARIFAGVDLTKEPIPVLPTVHYNM 372

Query: 368 GGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVI 427
           GGIPTNY+GEVL+    +P+R  PGLMA+GEAGCASVHGANRLGSNSLIDLVVFGRAA I
Sbjct: 373 GGIPTNYYGEVLNPTLDSPDRVQPGLMAVGEAGCASVHGANRLGSNSLIDLVVFGRAAAI 432

Query: 428 RASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQ 487
           RA E+ID+ + IP+L+ ++ D I+ RFDRLR A G VPTA LREKMQRAMQ DA VFRT 
Sbjct: 433 RAGEVIDRDAEIPALNEAAVDAIIARFDRLRFAQGQVPTAMLREKMQRAMQEDAAVFRTA 492

Query: 488 DSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESR 547
           DSL  GC+ +S +WDE++DLKV DRSLIWNSDL+ETLEL+NLM NAI TVYSA AR ESR
Sbjct: 493 DSLEQGCQRISKIWDELSDLKVTDRSLIWNSDLMETLELENLMANAITTVYSAAARLESR 552

Query: 548 GSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLC----GGVDYSK 603
           G+HARED+ +     RDD NWR+H+L  +  + GK+ L YRPVH + L     GG+D  +
Sbjct: 553 GAHAREDYPE-----RDDKNWRRHTLSHLSQD-GKVILSYRPVHVDPLTSEEDGGIDLKR 606

Query: 604 IAPKARVY 611
           I PK RVY
Sbjct: 607 IMPKKRVY 614


>gi|163869246|ref|YP_001610502.1| succinate dehydrogenase flavoprotein subunit [Bartonella tribocorum
           CIP 105476]
 gi|161018949|emb|CAK02507.1| SdhA succinate dehydrogenase flavoprotein subunit [Bartonella
           tribocorum CIP 105476]
          Length = 614

 Score =  949 bits (2454), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 461/608 (75%), Positives = 523/608 (86%), Gaps = 11/608 (1%)

Query: 8   KSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASL 67
            + Y  VDH +DVVVVGAGGAGLRATLGMAE+G KTACITKVFPTRSHTVAAQGGIAASL
Sbjct: 14  NAPYHTVDHKFDVVVVGAGGAGLRATLGMAEQGLKTACITKVFPTRSHTVAAQGGIAASL 73

Query: 68  ANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQR 127
           +NM PD+WQWHLYDT+KGSDWLGD DA++YL   AP +VYELEHYGVPFSR + GKIYQR
Sbjct: 74  SNMGPDNWQWHLYDTVKGSDWLGDTDAMEYLVRNAPAAVYELEHYGVPFSRTQEGKIYQR 133

Query: 128 PFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGC 187
           PFGGH   +GEGPPVQRTCAAADRTGHAILHTLYGQ+LK+NA+FFIEYFALDLI+ ++G 
Sbjct: 134 PFGGHTTQFGEGPPVQRTCAAADRTGHAILHTLYGQSLKHNAQFFIEYFALDLIM-TDGV 192

Query: 188 CVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDM 247
           C GVVAW L+ G IHRFSAK+VVLATGGYGRAYFSATSAHTCTGDG GM+ARAGLPLQDM
Sbjct: 193 CTGVVAWNLDDGTIHRFSAKMVVLATGGYGRAYFSATSAHTCTGDGGGMIARAGLPLQDM 252

Query: 248 EFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMME 307
           EFVQFHPTGIYG+GCLITEGARGEGGYL+NS+GERFMERYAPS KDLASRD+VSRC+ +E
Sbjct: 253 EFVQFHPTGIYGSGCLITEGARGEGGYLINSEGERFMERYAPSFKDLASRDLVSRCITLE 312

Query: 308 IREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNM 367
           IREGRGVG  KDHIHL LNH+DPA+L ERLPGISESARIFAGVDVT++PIP++PTVHYNM
Sbjct: 313 IREGRGVGPKKDHIHLVLNHIDPAILHERLPGISESARIFAGVDVTKEPIPILPTVHYNM 372

Query: 368 GGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVI 427
           GGIPTNY+GEVL+  + +P+R  PGLMA+GEAGCASVHGANRLGSNSLIDLVVFGRAA I
Sbjct: 373 GGIPTNYYGEVLNPTADSPDRIQPGLMAVGEAGCASVHGANRLGSNSLIDLVVFGRAAAI 432

Query: 428 RASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQ 487
           RA E+ID+++ IP L+  + D IM RFDRLR A G  PTA LREKMQR MQ DA VFRT+
Sbjct: 433 RAGEVIDRNAEIPPLNEEAVDEIMARFDRLRFAQGTTPTAVLREKMQRTMQEDAAVFRTE 492

Query: 488 DSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESR 547
           DSL  GC+ ++ +W E++DLKV DRSLIWNSDLVETLEL+NLM NAI TV+SAEAR ESR
Sbjct: 493 DSLKQGCQRMNKIWGELSDLKVTDRSLIWNSDLVETLELENLMANAIMTVHSAEARLESR 552

Query: 548 GSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLC----GGVDYSK 603
           G+HARED+ +     RDD NWRKH+L  +  + GK+ L YRPVH E L     GG+D  +
Sbjct: 553 GAHAREDYPE-----RDDKNWRKHTLSHLSKD-GKVTLSYRPVHVEPLTSEADGGIDLKR 606

Query: 604 IAPKARVY 611
           IAPK RVY
Sbjct: 607 IAPKKRVY 614


>gi|240851318|ref|YP_002972721.1| succinate dehydrogenase, flavoprotein subunit [Bartonella grahamii
           as4aup]
 gi|240268441|gb|ACS52029.1| succinate dehydrogenase, flavoprotein subunit [Bartonella grahamii
           as4aup]
          Length = 614

 Score =  944 bits (2441), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 458/608 (75%), Positives = 523/608 (86%), Gaps = 11/608 (1%)

Query: 8   KSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASL 67
            + Y  VDH +DVVVVGAGGAGLRATLGMAE+G KTACITKVFPTRSHTVAAQGGIAASL
Sbjct: 14  NAPYRTVDHKFDVVVVGAGGAGLRATLGMAEQGLKTACITKVFPTRSHTVAAQGGIAASL 73

Query: 68  ANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQR 127
           +NM PD+WQWHLYDT+KGSDWLGD DA++YL   AP +VYELEHYGVPFSR + GKIYQR
Sbjct: 74  SNMGPDNWQWHLYDTVKGSDWLGDTDAMEYLVRNAPAAVYELEHYGVPFSRTQEGKIYQR 133

Query: 128 PFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGC 187
           PFGGH   +GEGPPVQRTCAAADRTGHAILHTLYGQ+LK+NA+FFIEYFALDLI+ ++G 
Sbjct: 134 PFGGHTTQFGEGPPVQRTCAAADRTGHAILHTLYGQSLKHNAQFFIEYFALDLIM-TDGV 192

Query: 188 CVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDM 247
           C GVVAW L+ G IHRFSAK+VVLATGGYGRAYFSATSAHTCTGDG GMVARAGLPLQDM
Sbjct: 193 CTGVVAWDLDDGTIHRFSAKMVVLATGGYGRAYFSATSAHTCTGDGGGMVARAGLPLQDM 252

Query: 248 EFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMME 307
           EFVQFHPTGIYG+GCLITEGARGEGGYL+NS+GERFMERYAPS KDLASRD+VSRC+ +E
Sbjct: 253 EFVQFHPTGIYGSGCLITEGARGEGGYLINSEGERFMERYAPSFKDLASRDLVSRCITLE 312

Query: 308 IREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNM 367
           IREGRGVG  KDHIHL LNH+DPA+L ERLPGISESARIFAGVDVT++PIP++PTVHYNM
Sbjct: 313 IREGRGVGPKKDHIHLVLNHIDPAILHERLPGISESARIFAGVDVTKEPIPILPTVHYNM 372

Query: 368 GGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVI 427
           GGIPTNY+GEVL+  + +P+R  PGLMA+GEAGCASVHGANRLGSNSLIDLVVFGRAA I
Sbjct: 373 GGIPTNYYGEVLNPTADSPDRIQPGLMAVGEAGCASVHGANRLGSNSLIDLVVFGRAAAI 432

Query: 428 RASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQ 487
           RA E+ID+++ IP ++  + D I+ RFDRLR A G +PTA LREKMQR MQ DA VFRT+
Sbjct: 433 RAGEVIDRNAEIPPINEEAVDEIIARFDRLRFAQGAIPTAPLREKMQRTMQEDAAVFRTE 492

Query: 488 DSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESR 547
           DSL  GC+ ++ +W E++DLKV DRSLIWNSDLVETLEL+NLM NAI TV+SA+AR ESR
Sbjct: 493 DSLQQGCQRMNKIWGELSDLKVTDRSLIWNSDLVETLELENLMANAIMTVHSAQARLESR 552

Query: 548 GSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLC----GGVDYSK 603
           G+HARED+ +     RDD NWRKH+L  +    GK+ L YRPVH + L     GG+D  +
Sbjct: 553 GAHAREDYPE-----RDDKNWRKHTLSHLS-KEGKVTLSYRPVHVDPLTSEADGGIDLKR 606

Query: 604 IAPKARVY 611
           IAPK RVY
Sbjct: 607 IAPKKRVY 614


>gi|49474755|ref|YP_032797.1| succinate dehydrogenase flavoprotein subunit [Bartonella quintana
           str. Toulouse]
 gi|49240259|emb|CAF26729.1| Succinate dehydrogenase, flavoprotein subunit [Bartonella quintana
           str. Toulouse]
          Length = 613

 Score =  944 bits (2441), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 461/605 (76%), Positives = 518/605 (85%), Gaps = 11/605 (1%)

Query: 11  YTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLANM 70
           Y YVDH +DVVVVGAGGAGLRATLGMAE+G KTACITKVFPTRSHTVAAQGGIAASL+NM
Sbjct: 16  YHYVDHKFDVVVVGAGGAGLRATLGMAEQGLKTACITKVFPTRSHTVAAQGGIAASLSNM 75

Query: 71  TPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRPFG 130
            PD+WQWHLYDT+KGSDWLGD DA++YL   AP +VYELEHYGVPFSR + GKIYQRPFG
Sbjct: 76  GPDNWQWHLYDTVKGSDWLGDTDAMEYLVRNAPAAVYELEHYGVPFSRTQEGKIYQRPFG 135

Query: 131 GHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCCVG 190
           GH   +GEGPPVQRTCAAADRTGHAILHTLYGQ+LK+NA+FFIEYFALDLI+  +  C G
Sbjct: 136 GHTTEFGEGPPVQRTCAAADRTGHAILHTLYGQSLKHNAQFFIEYFALDLIMTDD-VCTG 194

Query: 191 VVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDMEFV 250
           VVAW L+ G +HRFSAK+VVLATGGYGRAYFSATSAHTCTGDG GM+ARAGLPLQDMEFV
Sbjct: 195 VVAWNLDDGTMHRFSAKMVVLATGGYGRAYFSATSAHTCTGDGGGMIARAGLPLQDMEFV 254

Query: 251 QFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEIRE 310
           QFHPTGIYG+GCLITEGARGEGGYLVNS+GERFMERYAPS KDLASRD+VSRC+ +EIRE
Sbjct: 255 QFHPTGIYGSGCLITEGARGEGGYLVNSEGERFMERYAPSFKDLASRDLVSRCITLEIRE 314

Query: 311 GRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMGGI 370
           GRGVG  KDHIHL LNH+DP +L ERLPGISESARIFAGVDVT++PIP++PTVHYNMGGI
Sbjct: 315 GRGVGPKKDHIHLVLNHIDPMILHERLPGISESARIFAGVDVTKEPIPILPTVHYNMGGI 374

Query: 371 PTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIRAS 430
           PTNY+GEVL+  + +P+   PGLMA+GEAGCASVHGANRLGSNSLIDLVVFGRAA IRA 
Sbjct: 375 PTNYYGEVLNPTADSPDHVQPGLMAVGEAGCASVHGANRLGSNSLIDLVVFGRAAAIRAG 434

Query: 431 EMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQDSL 490
           E+ID+ + IP L+  + D IM RFDRLR ADG  PTA LREKMQR MQ DA VFRT DSL
Sbjct: 435 EVIDRDAEIPPLNEEAVDEIMARFDRLRFADGATPTAILREKMQRTMQEDAAVFRTADSL 494

Query: 491 SDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRGSH 550
             GC+ +S +W E++DLKV DRSLIWNSDLVETLEL+NLM NAI TVYSAEAR ESRG+H
Sbjct: 495 QQGCQRISQIWGELSDLKVTDRSLIWNSDLVETLELENLMANAIMTVYSAEARLESRGAH 554

Query: 551 AREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLC----GGVDYSKIAP 606
           ARED+ +     RDD NWRKH+L  +  + GK+ L YRPVH + L     GG+D  +IAP
Sbjct: 555 AREDYPE-----RDDENWRKHTLSHLSKD-GKVALSYRPVHVDPLTAEADGGIDLKRIAP 608

Query: 607 KARVY 611
           K RVY
Sbjct: 609 KKRVY 613


>gi|121602021|ref|YP_988428.1| succinate dehydrogenase flavoprotein subunit [Bartonella
           bacilliformis KC583]
 gi|120614198|gb|ABM44799.1| succinate dehydrogenase, flavoprotein subunit [Bartonella
           bacilliformis KC583]
          Length = 615

 Score =  942 bits (2435), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 455/607 (74%), Positives = 520/607 (85%), Gaps = 11/607 (1%)

Query: 9   SSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLA 68
           + Y YVDH +DVVVVGAGGAGLRATLGMAE+G KTACITKVFPTRSHTVAAQGGIAASL 
Sbjct: 16  APYRYVDHEFDVVVVGAGGAGLRATLGMAEQGLKTACITKVFPTRSHTVAAQGGIAASLG 75

Query: 69  NMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRP 128
           NM PD+WQWHLYDT+KGSDWLGD DA++YL   AP +VYELEHYGVPFSR + GKIYQRP
Sbjct: 76  NMGPDNWQWHLYDTVKGSDWLGDTDAMEYLVRNAPAAVYELEHYGVPFSRTQEGKIYQRP 135

Query: 129 FGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCC 188
           FGGH   +GEGPPVQRTCAAADRTGHAILHTLYGQ+LK+NA+FFIEYFALDLI+ ++G C
Sbjct: 136 FGGHTTEFGEGPPVQRTCAAADRTGHAILHTLYGQSLKHNAQFFIEYFALDLIM-TDGVC 194

Query: 189 VGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDME 248
            GVVAW L+ G IHRF+AK+VVLATGGYGRAYFSATSAHTCTGDG GMVARAGLPLQDME
Sbjct: 195 TGVVAWNLDDGTIHRFAAKMVVLATGGYGRAYFSATSAHTCTGDGGGMVARAGLPLQDME 254

Query: 249 FVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEI 308
           FVQFHPTGIYG+GCLITEGARGEGGYL+NS+GERFMERYAPS KDLASRD+VSRC+ +EI
Sbjct: 255 FVQFHPTGIYGSGCLITEGARGEGGYLINSEGERFMERYAPSFKDLASRDLVSRCITLEI 314

Query: 309 REGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMG 368
           REGRGVG  KDHIHL L+H+DPA+L ERLPGISESARIFAGVDVT+DPIP++PTVHYNMG
Sbjct: 315 REGRGVGAKKDHIHLVLHHIDPAILHERLPGISESARIFAGVDVTKDPIPILPTVHYNMG 374

Query: 369 GIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIR 428
           GIPTNY GEVL+    +P+   PGLMA+GEAGCASVHGANRLGSNSLIDLVVFGRAA IR
Sbjct: 375 GIPTNYHGEVLNPTPDSPDHVQPGLMAVGEAGCASVHGANRLGSNSLIDLVVFGRAAAIR 434

Query: 429 ASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQD 488
           A E+ID+ + IP ++  + D+IM RFD+LR A+GH+PTA LREKMQR MQ DA VFRT D
Sbjct: 435 AGEVIDRDAKIPPINEEAVDKIMARFDKLRFANGHIPTAELREKMQRTMQEDAAVFRTSD 494

Query: 489 SLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRG 548
           SL  GC+ +S +W+++ DLKV DRS+IWNSDLVETLEL+NLM NA+ TVYSAEAR ESRG
Sbjct: 495 SLKQGCQRISKVWEQLFDLKVTDRSMIWNSDLVETLELENLMANAVTTVYSAEARLESRG 554

Query: 549 SHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLC----GGVDYSKI 604
           +HARED+ +     RDD  WR+H+L  +  + GK+ L YRPVH + L     GG+D  +I
Sbjct: 555 AHAREDYPE-----RDDKEWRRHTLAHLSKD-GKVTLSYRPVHVDPLTAEEDGGIDLKRI 608

Query: 605 APKARVY 611
            PK RVY
Sbjct: 609 VPKKRVY 615


>gi|310814648|ref|YP_003962612.1| succinate dehydrogenase [Ketogulonicigenium vulgare Y25]
 gi|308753383|gb|ADO41312.1| succinate dehydrogenase [Ketogulonicigenium vulgare Y25]
          Length = 601

 Score =  928 bits (2399), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 450/607 (74%), Positives = 516/607 (85%), Gaps = 11/607 (1%)

Query: 9   SSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLA 68
           ++YTY  H YDVVVVGAGGAGLRATLGMAE+G +TACI+KVFPTRSHTVAAQGGIAASL 
Sbjct: 2   AAYTYETHEYDVVVVGAGGAGLRATLGMAEQGLRTACISKVFPTRSHTVAAQGGIAASLG 61

Query: 69  NMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRP 128
           NM PDSWQWH+YDT+KGSDWLGD DA++YLA EAP++VYELEHYGVPFSR E GKIYQRP
Sbjct: 62  NMGPDSWQWHMYDTVKGSDWLGDTDAMEYLAREAPKAVYELEHYGVPFSRTEEGKIYQRP 121

Query: 129 FGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCC 188
           FGGH   YGEGPPVQRTCAAADRTGHAILHTLYGQ+LK  AEF+IEYFALDLI++ +G C
Sbjct: 122 FGGHTTEYGEGPPVQRTCAAADRTGHAILHTLYGQSLKQQAEFYIEYFALDLIMSEDGVC 181

Query: 189 VGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDME 248
            GV+AW+L+ G  H FSAK+VVLATGGYGRAYFSATSAHTCTGDG GMVARAGLPLQDME
Sbjct: 182 TGVLAWKLDDGTFHVFSAKMVVLATGGYGRAYFSATSAHTCTGDGGGMVARAGLPLQDME 241

Query: 249 FVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEI 308
           FVQFHPTGIYG+GCLITEGARGEGGYL N+ GERFMERYAP+ KDLASRDVVSRCM +EI
Sbjct: 242 FVQFHPTGIYGSGCLITEGARGEGGYLTNAAGERFMERYAPTYKDLASRDVVSRCMTIEI 301

Query: 309 REGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMG 368
           REGRGVG +KDHI+L+LNHL P  L ERLPGISESARIFAGVD+T++PIPV+PTVHYNMG
Sbjct: 302 REGRGVGPNKDHIYLHLNHLPPETLHERLPGISESARIFAGVDLTKEPIPVLPTVHYNMG 361

Query: 369 GIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIR 428
           GIPTNYWGEVL+  + NP+R  PGLMA+GEAGCASVHGANRLGSNSLIDLVVFGRAA IR
Sbjct: 362 GIPTNYWGEVLNPTADNPDRVQPGLMAVGEAGCASVHGANRLGSNSLIDLVVFGRAAAIR 421

Query: 429 ASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQD 488
           A +++   +P  + ++ S  +  DRFD LR+A+G   TA LR +MQRAMQ DA VFRT  
Sbjct: 422 AGQIVQAGTPNAAPNLHSIAKAFDRFDALRYANGGTTTADLRLEMQRAMQADAAVFRTDK 481

Query: 489 SLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRG 548
           +L++G   ++ +  ++ADLKV DRSL+WNSDL+ETLEL NLM NA+AT+ +AEARKESRG
Sbjct: 482 TLAEGVEKMTAVAAKVADLKVSDRSLVWNSDLMETLELTNLMPNALATIVAAEARKESRG 541

Query: 549 SHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLC----GGVDYSKI 604
           +HA ED+ +     RDDVNWRKHSL WV+ NT  + LDYRPVH + L     GG+D  KI
Sbjct: 542 AHAHEDYPE-----RDDVNWRKHSLAWVEGNT--VSLDYRPVHLDPLTTVEEGGIDLKKI 594

Query: 605 APKARVY 611
           APKARVY
Sbjct: 595 APKARVY 601


>gi|119383321|ref|YP_914377.1| succinate dehydrogenase flavoprotein subunit [Paracoccus
           denitrificans PD1222]
 gi|2494616|sp|Q59661|DHSA_PARDE RecName: Full=Succinate dehydrogenase flavoprotein subunit
 gi|975318|gb|AAA75177.1| succinate dehydrogenase flavoprotein subunit [Paracoccus
           denitrificans]
 gi|119373088|gb|ABL68681.1| succinate dehydrogenase subunit A [Paracoccus denitrificans PD1222]
          Length = 600

 Score =  921 bits (2381), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 449/607 (73%), Positives = 514/607 (84%), Gaps = 12/607 (1%)

Query: 9   SSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLA 68
           ++Y Y  H YDVVVVGAGGAGLRATLGMAE+G +TAC+TKVFPTRSHTVAAQGGIAASL+
Sbjct: 2   AAYKYETHEYDVVVVGAGGAGLRATLGMAEQGLRTACVTKVFPTRSHTVAAQGGIAASLS 61

Query: 69  NMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRP 128
           NM PD+WQWH+YDT+KGSDWLGD DA++YLA EAP++VYELEHYGVPFSR E GKIYQRP
Sbjct: 62  NMGPDNWQWHMYDTVKGSDWLGDTDAMEYLAREAPKAVYELEHYGVPFSRTEEGKIYQRP 121

Query: 129 FGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCC 188
           FGGH   +GEGPPVQRTCAAADRTGHAILHTLYGQ+LK  AEFFIEYFALDLII ++G C
Sbjct: 122 FGGHTTEFGEGPPVQRTCAAADRTGHAILHTLYGQSLKEKAEFFIEYFALDLII-TDGAC 180

Query: 189 VGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDME 248
            GVV W+L+ G IH F+AK+VVLATGGYGRAYFSATSAHTCTGDG GMVARAGLPLQDME
Sbjct: 181 TGVVCWKLDDGTIHVFNAKMVVLATGGYGRAYFSATSAHTCTGDGGGMVARAGLPLQDME 240

Query: 249 FVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEI 308
           FVQFHPTGIYG+GCLITEGARGEGGYL NS+GERFMERYAP+ KDLASRDVVSRC+ +EI
Sbjct: 241 FVQFHPTGIYGSGCLITEGARGEGGYLTNSEGERFMERYAPTYKDLASRDVVSRCITIEI 300

Query: 309 REGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMG 368
           REGRGVG  KDH+HL L HL P  L ERLPGISESA+IFAGVDVTR+PIP++PTVHYNMG
Sbjct: 301 REGRGVGPHKDHMHLNLMHLPPESLAERLPGISESAKIFAGVDVTREPIPILPTVHYNMG 360

Query: 369 GIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIR 428
           GIPTNYWGEVL+    NP++  PGLMA+GEAGCASVHGANRLGSNSLIDLVVFGRAA IR
Sbjct: 361 GIPTNYWGEVLNPTQDNPDQVFPGLMAVGEAGCASVHGANRLGSNSLIDLVVFGRAAAIR 420

Query: 429 ASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQD 488
           A ++ID+ + IP+ +    D+ +DRFDR+R+ADG V TA LR +MQR MQ DA VFRT  
Sbjct: 421 AGQVIDREAQIPTTNKEQVDKALDRFDRIRNADGSVSTADLRLEMQRTMQADAAVFRTDK 480

Query: 489 SLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRG 548
           +L++G   +  +  +++DLKV DRSLIWNSDL+ETLEL NLM NA+AT+ +AEARKESRG
Sbjct: 481 TLAEGVDKMRVIAGKLSDLKVTDRSLIWNSDLMETLELTNLMPNALATIVAAEARKESRG 540

Query: 549 SHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLC----GGVDYSKI 604
           +HA ED+ +     RDD NWRKHSL W++ N   +KL YRPVH E L     GG+D  KI
Sbjct: 541 AHAHEDYPE-----RDDANWRKHSLAWIEGN--DVKLAYRPVHLEPLTRQDEGGIDLKKI 593

Query: 605 APKARVY 611
           APKARVY
Sbjct: 594 APKARVY 600


>gi|159045405|ref|YP_001534199.1| succinate dehydrogenase flavoprotein subunit [Dinoroseobacter
           shibae DFL 12]
 gi|157913165|gb|ABV94598.1| succinate dehydrogenas flavoprotein subunit [Dinoroseobacter shibae
           DFL 12]
          Length = 600

 Score =  917 bits (2371), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 448/607 (73%), Positives = 514/607 (84%), Gaps = 12/607 (1%)

Query: 9   SSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLA 68
           S+Y Y  H+YDVVVVGAGGAGLRATLGMAE+G +TACI+KVFPTRSHTVAAQGGIAASL+
Sbjct: 2   SAYEYETHNYDVVVVGAGGAGLRATLGMAEQGLRTACISKVFPTRSHTVAAQGGIAASLS 61

Query: 69  NMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRP 128
           NM PD WQWH+YDT+KGSDWLGD DA++YLA EAP++VYELEHYGVPFSR E GKIYQRP
Sbjct: 62  NMGPDHWQWHMYDTVKGSDWLGDTDAMEYLAREAPKAVYELEHYGVPFSRTEEGKIYQRP 121

Query: 129 FGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCC 188
           FGGH   +GEGPPVQRTCAAADRTGHAILHTLYGQ+LKNNAEFFIEYFA+DLI++ +G C
Sbjct: 122 FGGHTTEFGEGPPVQRTCAAADRTGHAILHTLYGQSLKNNAEFFIEYFAIDLIMSEDGQC 181

Query: 189 VGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDME 248
            GVV W+L+ G IH F+AK+ VLATGGYGRAYFSATSAHTCTGDG GMVAR GLPLQDME
Sbjct: 182 QGVVCWKLDDGTIHVFNAKMTVLATGGYGRAYFSATSAHTCTGDGGGMVARQGLPLQDME 241

Query: 249 FVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEI 308
           FVQFHPTGIYGAGCLITEGARGEGGYL NS+GERFMERYAP+ KDLASRDVVSRCM MEI
Sbjct: 242 FVQFHPTGIYGAGCLITEGARGEGGYLTNSEGERFMERYAPTYKDLASRDVVSRCMTMEI 301

Query: 309 REGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMG 368
           REGRGVG   DHIHL+LNHL P  L  RLPGISESARIFAGVDV ++PIPV+PTVHYNMG
Sbjct: 302 REGRGVGPDGDHIHLHLNHLPPETLALRLPGISESARIFAGVDVNKEPIPVLPTVHYNMG 361

Query: 369 GIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIR 428
           GIPTNYWGEVL+  +++P+R APGLMA+GEAGCASVHGANRLGSNSLIDLVVFGRAA I+
Sbjct: 362 GIPTNYWGEVLNPTAEDPDRIAPGLMAVGEAGCASVHGANRLGSNSLIDLVVFGRAAAIK 421

Query: 429 ASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQD 488
           A +++D +   P+L+ +S D  + RFD LRHA G+V TA LR +MQ+ MQ DA VFRT  
Sbjct: 422 AGQVVDPTVSNPTLNQASIDAALARFDGLRHAKGNVSTAELRLEMQKTMQADAAVFRTDK 481

Query: 489 SLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRG 548
           +L++G + +  +  ++ D+KV DRSL+WNSDL+ETLEL NLM NA+AT+ SAEARKESRG
Sbjct: 482 TLAEGVQKMYGVAGKVDDIKVTDRSLVWNSDLMETLELTNLMPNALATIVSAEARKESRG 541

Query: 549 SHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLC----GGVDYSKI 604
           +HA ED+ D     RDD NWRKH+L +V+   GK+ LDYRPVH   L     GG+D  KI
Sbjct: 542 AHAHEDYAD-----RDDENWRKHTLAYVN---GKVDLDYRPVHLNPLLGHNEGGIDLKKI 593

Query: 605 APKARVY 611
           APKARVY
Sbjct: 594 APKARVY 600


>gi|126734841|ref|ZP_01750587.1| succinate dehydrogenase, flavoprotein subunit [Roseobacter sp.
           CCS2]
 gi|126715396|gb|EBA12261.1| succinate dehydrogenase, flavoprotein subunit [Roseobacter sp.
           CCS2]
          Length = 601

 Score =  911 bits (2354), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 438/607 (72%), Positives = 498/607 (82%), Gaps = 11/607 (1%)

Query: 9   SSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLA 68
           ++Y Y  H+YD +VVGAGGAGLRATLG+AE+G +TACITKVFPTRSHTVAAQGGIAASL 
Sbjct: 2   AAYEYETHTYDAIVVGAGGAGLRATLGLAEQGLRTACITKVFPTRSHTVAAQGGIAASLG 61

Query: 69  NMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRP 128
           NM PDSWQWH+YDT+KGSDWLGD DA++YLA EAP++VYELEHYGVPFSR E GKIYQRP
Sbjct: 62  NMGPDSWQWHMYDTVKGSDWLGDTDAMEYLAREAPKAVYELEHYGVPFSRTEEGKIYQRP 121

Query: 129 FGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCC 188
           FGGH   +GEGPPVQRTCAAADRTGHAILHTLYGQ+LK  AEF+IEYFALDLI++ +G C
Sbjct: 122 FGGHTTEFGEGPPVQRTCAAADRTGHAILHTLYGQSLKQQAEFYIEYFALDLIMSDDGIC 181

Query: 189 VGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDME 248
            GV+AW+L+ G +H F+AK VVLATGGYGRAYFSATSAHTCTGDG GMVAR GLPLQDME
Sbjct: 182 QGVIAWKLDDGTMHVFNAKTVVLATGGYGRAYFSATSAHTCTGDGGGMVARQGLPLQDME 241

Query: 249 FVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEI 308
           FVQFHPTGIYGAGCLITEGARGEGGYL NS+GERFMERYAP+ KDLA RD VSRCM MEI
Sbjct: 242 FVQFHPTGIYGAGCLITEGARGEGGYLTNSEGERFMERYAPNYKDLAPRDYVSRCMTMEI 301

Query: 309 REGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMG 368
           REGRGVG + DHI L LNHL    L ERLPGISESARIFAGVDVT++ IPV+PTVHYNMG
Sbjct: 302 REGRGVGANGDHISLNLNHLPKEALAERLPGISESARIFAGVDVTKEAIPVLPTVHYNMG 361

Query: 369 GIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIR 428
           GIPTNY GEVL+   K+P    PGLMA+GEAGCASVHGANRLGSNSLIDLVVFGRAA IR
Sbjct: 362 GIPTNYHGEVLNPTKKDPTAVVPGLMAVGEAGCASVHGANRLGSNSLIDLVVFGRAAAIR 421

Query: 429 ASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQD 488
           A E++D+ +P P+L+ +S D   DRFD LRHA G V TA LR +MQ+AMQ DA VFRT  
Sbjct: 422 AGEVVDRDAPNPTLNQASVDACFDRFDGLRHAKGTVGTAELRLEMQKAMQADAAVFRTDK 481

Query: 489 SLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRG 548
           +L +G   ++ + ++M DL V DRSL+WNSDL+ETLEL NLM NA+AT+  AEARKESRG
Sbjct: 482 TLGEGVEKMTAIAEKMDDLYVTDRSLVWNSDLMETLELTNLMPNALATIVGAEARKESRG 541

Query: 549 SHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLC----GGVDYSKI 604
           +HA ED+       RDD  WR H+L  VD    K+KL YRPV TE L     GG+  +KI
Sbjct: 542 AHAHEDYAT-----RDDEKWRVHTLSHVD--AAKVKLSYRPVITEGLTTEAEGGISKAKI 594

Query: 605 APKARVY 611
           APK R +
Sbjct: 595 APKERTF 601


>gi|89068121|ref|ZP_01155538.1| succinate dehydrogenase [Oceanicola granulosus HTCC2516]
 gi|89046360|gb|EAR52417.1| succinate dehydrogenase [Oceanicola granulosus HTCC2516]
          Length = 601

 Score =  904 bits (2337), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 442/607 (72%), Positives = 508/607 (83%), Gaps = 11/607 (1%)

Query: 9   SSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLA 68
           ++Y Y  H YDVVVVGAGGAGLRATLGMAE+G +TACITKVFPTRSHTVAAQGGIAASL+
Sbjct: 2   AAYEYETHEYDVVVVGAGGAGLRATLGMAEQGLRTACITKVFPTRSHTVAAQGGIAASLS 61

Query: 69  NMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRP 128
           NM PD+WQWH+YDT+KGSDWLGD DA++YLA EAP++VYELEHYGVPFSR E GKIYQRP
Sbjct: 62  NMGPDNWQWHMYDTVKGSDWLGDTDAMEYLAREAPKAVYELEHYGVPFSRTEEGKIYQRP 121

Query: 129 FGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCC 188
           FGGH   +GEGPPVQRTCAAADRTGHAILHTLYGQ+LK  AEF+IEYFA+DL+++ +G C
Sbjct: 122 FGGHTTEFGEGPPVQRTCAAADRTGHAILHTLYGQSLKEQAEFYIEYFAIDLLMSEDGQC 181

Query: 189 VGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDME 248
            GV+AW+L+ G +H F+AK+VVLATGGYGRAYFSATSAHTCTGDG GM+ARAGLPLQDME
Sbjct: 182 RGVLAWKLDDGTMHVFAAKMVVLATGGYGRAYFSATSAHTCTGDGGGMIARAGLPLQDME 241

Query: 249 FVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEI 308
           FVQFHPTGIYG+GCLITEGARGEGGYL NS+GERFMERYAP+ KDLASRDVVSRCM +EI
Sbjct: 242 FVQFHPTGIYGSGCLITEGARGEGGYLTNSEGERFMERYAPTYKDLASRDVVSRCMTLEI 301

Query: 309 REGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMG 368
           REGRGVG   DHIHL+LNHL P  L ERLPGISESARIFAGVD+T++PIPV+PTVHYNMG
Sbjct: 302 REGRGVGPDGDHIHLHLNHLPPETLAERLPGISESARIFAGVDLTKEPIPVLPTVHYNMG 361

Query: 369 GIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIR 428
           GIPTNYWGEVL+  + +P+  APGLMA+GEAGCASVHGANRLGSNSLIDLVVFGRAA IR
Sbjct: 362 GIPTNYWGEVLNPTADDPDAIAPGLMAVGEAGCASVHGANRLGSNSLIDLVVFGRAAAIR 421

Query: 429 ASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQD 488
           A +++D    +     ++ D   +RFD  RHADG  PTA LR +MQRAMQ DA VFRT  
Sbjct: 422 AGKVVDPHISVAPPPRAAIDAAFERFDGFRHADGGTPTAELRLEMQRAMQSDAAVFRTDK 481

Query: 489 SLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRG 548
           +L++G   +  +  ++ D+KV DRSL+WNSDL+ETLEL NLM NA+ATV +AEARKESRG
Sbjct: 482 TLAEGVDKMEKIAGKLDDVKVTDRSLVWNSDLMETLELANLMPNALATVVAAEARKESRG 541

Query: 549 SHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLC----GGVDYSKI 604
           +HA ED+ D     RDD  WRKHSL  VD    K+ LDYRPVH + L     GG+D  KI
Sbjct: 542 AHAHEDYPD-----RDDETWRKHSLARVD--GAKVTLDYRPVHLDPLTAEDEGGIDLKKI 594

Query: 605 APKARVY 611
           APKARVY
Sbjct: 595 APKARVY 601


>gi|126725051|ref|ZP_01740894.1| succinate dehydrogenase flavoprotein subunit [Rhodobacterales
           bacterium HTCC2150]
 gi|126706215|gb|EBA05305.1| succinate dehydrogenase flavoprotein subunit [Rhodobacterales
           bacterium HTCC2150]
          Length = 601

 Score =  902 bits (2332), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 441/607 (72%), Positives = 507/607 (83%), Gaps = 11/607 (1%)

Query: 9   SSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLA 68
           ++Y Y  H YDVVVVGAGGAGLRATLGMAE+G KTAC+TKVFPTRSHTVAAQGGIAASL+
Sbjct: 2   AAYEYETHDYDVVVVGAGGAGLRATLGMAEQGLKTACVTKVFPTRSHTVAAQGGIAASLS 61

Query: 69  NMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRP 128
           NM PD+WQWH+YDT+KGSDWLGD DA++YLA EAP++VYELEHYGVPFSR E GKIYQRP
Sbjct: 62  NMGPDNWQWHMYDTVKGSDWLGDTDAMEYLAREAPKAVYELEHYGVPFSRTEDGKIYQRP 121

Query: 129 FGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCC 188
           FGGH   +GEGPPVQRTCAAADRTGHAILHTLYGQ+LKN+AEF+IEYFA+DL+++ +G C
Sbjct: 122 FGGHTTEFGEGPPVQRTCAAADRTGHAILHTLYGQSLKNDAEFYIEYFAIDLLMSDDGQC 181

Query: 189 VGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDME 248
            GVV W+L+ G IH F+AK+VVLATGGYGRAYFSATSAHTCTGDG GM ARAGL LQDME
Sbjct: 182 TGVVCWKLDDGTIHVFNAKMVVLATGGYGRAYFSATSAHTCTGDGGGMAARAGLALQDME 241

Query: 249 FVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEI 308
           FVQFHPTGIYG+GCLITEGARGEGGYL NS+GERFMERYAP+ KDLASRDVVSRCM MEI
Sbjct: 242 FVQFHPTGIYGSGCLITEGARGEGGYLTNSEGERFMERYAPTYKDLASRDVVSRCMTMEI 301

Query: 309 REGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMG 368
           REGRGVG   DHIHL+LNHL P  L  RLPGISESARIFAGVD+T++PIPV+PTVHYNMG
Sbjct: 302 REGRGVGAEGDHIHLHLNHLPPETLALRLPGISESARIFAGVDLTKEPIPVLPTVHYNMG 361

Query: 369 GIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIR 428
           GIPTNYWGEVL+    +P    PGLMA+GEAGCASVHGANRLGSNSLIDLVVFGRAA I+
Sbjct: 362 GIPTNYWGEVLNPTKDDPNAITPGLMAVGEAGCASVHGANRLGSNSLIDLVVFGRAAAIK 421

Query: 429 ASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQD 488
           A E++D S+P+P+L+  + D  + RFD LRHA G V TA LR +MQ+ MQ DA VFRT  
Sbjct: 422 AGEIVDPSTPVPALNEKAVDAALARFDGLRHAIGGVTTAELRLEMQKNMQADAAVFRTDK 481

Query: 489 SLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRG 548
           +L++G   +S +  ++ DLKV DRSLIWNSDL+ETLEL NLM NA+AT+  AEARKESRG
Sbjct: 482 TLAEGVEKMSGVAAKLDDLKVSDRSLIWNSDLMETLELTNLMPNALATIVGAEARKESRG 541

Query: 549 SHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLC----GGVDYSKI 604
           +HA ED+ D     RDD NWR H++  V+ N  K +L YRPV  + L     GG+D  +I
Sbjct: 542 AHAHEDYAD-----RDDKNWRVHTIARVEGN--KTELSYRPVTVDPLTEEKDGGIDLKRI 594

Query: 605 APKARVY 611
           APKARVY
Sbjct: 595 APKARVY 601


>gi|254439036|ref|ZP_05052530.1| succinate dehydrogenase, flavoprotein subunit [Octadecabacter
           antarcticus 307]
 gi|198254482|gb|EDY78796.1| succinate dehydrogenase, flavoprotein subunit [Octadecabacter
           antarcticus 307]
          Length = 601

 Score =  902 bits (2331), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 430/607 (70%), Positives = 494/607 (81%), Gaps = 11/607 (1%)

Query: 9   SSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLA 68
           + Y Y  H YD VVVGAGGAGLRATLGMAE+G +TACI+KVFPTRSHTVAAQGGIAASL 
Sbjct: 2   AEYEYETHDYDCVVVGAGGAGLRATLGMAEQGLRTACISKVFPTRSHTVAAQGGIAASLG 61

Query: 69  NMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRP 128
           NM PDSWQWH+YDT+KGSDWLGD DA++YLA EAP++VYELEHYGVPFSR E GKIYQRP
Sbjct: 62  NMGPDSWQWHMYDTVKGSDWLGDTDAMEYLAREAPKAVYELEHYGVPFSRTEEGKIYQRP 121

Query: 129 FGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCC 188
           FGGH   +GEGP VQRTCAAADRTGHAILHTLYGQ+LK  AEF+IEYFA+DLI++ +G C
Sbjct: 122 FGGHTTEFGEGPAVQRTCAAADRTGHAILHTLYGQSLKQKAEFYIEYFAIDLIMSDDGVC 181

Query: 189 VGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDME 248
            GVV W+L+ G +H F+AK+VVLATGGYGRAYFSATSAHTCTGDG GM ARAGLP+QDME
Sbjct: 182 TGVVCWKLDDGTMHVFNAKMVVLATGGYGRAYFSATSAHTCTGDGGGMAARAGLPMQDME 241

Query: 249 FVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEI 308
           FVQFHPTGIYG+GCLITEGARGEGGYL NS+GERFMERYAP+ KDLA RD VSRCM MEI
Sbjct: 242 FVQFHPTGIYGSGCLITEGARGEGGYLTNSEGERFMERYAPNYKDLAPRDYVSRCMTMEI 301

Query: 309 REGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMG 368
           REGRGVG  KDHIHL LNHL    L ERLPGISESA+IFAGVDV ++PIPV+PTVHYNMG
Sbjct: 302 REGRGVGAGKDHIHLNLNHLPKEALAERLPGISESAKIFAGVDVNKEPIPVLPTVHYNMG 361

Query: 369 GIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIR 428
           GIPTNY+GEVL     NP    PGLMA+GEAGCASVHGANRLGSNSLIDLVVFGRAA IR
Sbjct: 362 GIPTNYFGEVLHPTKDNPNAVVPGLMAVGEAGCASVHGANRLGSNSLIDLVVFGRAAAIR 421

Query: 429 ASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQD 488
           A  ++D+ + IP+    S D+  DRFD+LRHA+G  PTA LR +MQ+AMQ DA VFRT  
Sbjct: 422 AGTVVDRDAAIPATHKPSVDKAFDRFDKLRHANGANPTADLRLEMQKAMQEDAAVFRTDK 481

Query: 489 SLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRG 548
           +L +G   ++ +  +M D+ V DRSL+WN+DL+ETLEL NLM NA+AT+ SAEARKESRG
Sbjct: 482 TLKEGVEKMTSITGKMDDIHVTDRSLVWNTDLMETLELGNLMPNALATIVSAEARKESRG 541

Query: 549 SHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLC----GGVDYSKI 604
           +HA ED+       RDD NWR H++  VD    K+ L +RPV T+ L     GG+D  +I
Sbjct: 542 AHAHEDYAT-----RDDKNWRVHTISHVDG--AKVTLSHRPVITKPLSTEKEGGIDLKRI 594

Query: 605 APKARVY 611
           APK R +
Sbjct: 595 APKVRTF 601


>gi|260431519|ref|ZP_05785490.1| succinate dehydrogenase, flavoprotein subunit [Silicibacter
           lacuscaerulensis ITI-1157]
 gi|260415347|gb|EEX08606.1| succinate dehydrogenase, flavoprotein subunit [Silicibacter
           lacuscaerulensis ITI-1157]
          Length = 601

 Score =  902 bits (2331), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 438/607 (72%), Positives = 507/607 (83%), Gaps = 11/607 (1%)

Query: 9   SSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLA 68
           ++Y Y  H YDVVVVGAGGAGLRATLGMAE+G +TAC+TKVFPTRSHTVAAQGGIAASL+
Sbjct: 2   AAYEYETHEYDVVVVGAGGAGLRATLGMAEQGLRTACVTKVFPTRSHTVAAQGGIAASLS 61

Query: 69  NMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRP 128
           NM PD WQWH+YDT+KGSDWLGD DA++YLA EAP++VYELEHYGVPFSR E GKIYQRP
Sbjct: 62  NMGPDHWQWHMYDTVKGSDWLGDTDAMEYLAREAPKAVYELEHYGVPFSRTEEGKIYQRP 121

Query: 129 FGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCC 188
           FGGH   +GEGPPVQRTCAAADRTGHAILHTLYGQ+LKNNAEF+IEYFA+DLI++ +G C
Sbjct: 122 FGGHTTEFGEGPPVQRTCAAADRTGHAILHTLYGQSLKNNAEFYIEYFAIDLIMSEDGQC 181

Query: 189 VGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDME 248
            GVV W+L+ G +H F+AK+VVLATGGYGRAYFSATSAHTCTGDG GMVARAGLPLQDME
Sbjct: 182 QGVVCWKLDDGTMHVFNAKMVVLATGGYGRAYFSATSAHTCTGDGGGMVARAGLPLQDME 241

Query: 249 FVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEI 308
           FVQFHPTGIYG+GCLITEGARGEGGYL NS+GERFMERYAP  KDLA RD VSRCM MEI
Sbjct: 242 FVQFHPTGIYGSGCLITEGARGEGGYLTNSEGERFMERYAPHYKDLAPRDYVSRCMTMEI 301

Query: 309 REGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMG 368
           REGRGVGK+KDHIHL L+HL    L ERLPGISESA+IFAGVDVT++PIPV+PTVHYNMG
Sbjct: 302 REGRGVGKNKDHIHLNLSHLPAEALAERLPGISESAKIFAGVDVTKEPIPVLPTVHYNMG 361

Query: 369 GIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIR 428
           GIPTNYWGEVL+  + NP    PGLMA+GEAGCASVHGANRLGSNSLIDLVVFGRAA IR
Sbjct: 362 GIPTNYWGEVLNPTADNPTAVVPGLMAVGEAGCASVHGANRLGSNSLIDLVVFGRAAAIR 421

Query: 429 ASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQD 488
           A +++D  +P P L+ +S D+  DRFD LR+A+G  PTA LR +MQ+ MQ DA VFRT +
Sbjct: 422 AGKVVDPEAPNPVLNKASVDKAFDRFDALRNANGSTPTAELRLEMQKTMQEDAAVFRTAE 481

Query: 489 SLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRG 548
           +L+ G   ++ +  ++ DLKV DRSL+WNSDL+ETLEL NLM NA+AT+  AEARKESRG
Sbjct: 482 TLAQGVEKMTAIAAKLNDLKVTDRSLVWNSDLMETLELTNLMPNALATIVGAEARKESRG 541

Query: 549 SHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLC----GGVDYSKI 604
           +HA EDF +     RDD NWR H++  V+ N+  ++L YRPV  + L     GG+   KI
Sbjct: 542 AHAHEDFPE-----RDDENWRVHTVARVEGNS--VELSYRPVIVDPLTPEEQGGISLEKI 594

Query: 605 APKARVY 611
           APKAR +
Sbjct: 595 APKARTF 601


>gi|260576581|ref|ZP_05844569.1| succinate dehydrogenase or fumarate reductase, flavoprotein subunit
           [Rhodobacter sp. SW2]
 gi|259021185|gb|EEW24493.1| succinate dehydrogenase or fumarate reductase, flavoprotein subunit
           [Rhodobacter sp. SW2]
          Length = 600

 Score =  901 bits (2329), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 444/607 (73%), Positives = 506/607 (83%), Gaps = 12/607 (1%)

Query: 9   SSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLA 68
           ++Y Y  H YDVVVVGAGGAGLRATLGMAE+G +TAC+TKVFPTRSHTVAAQGGIAASL+
Sbjct: 2   AAYEYETHDYDVVVVGAGGAGLRATLGMAEQGLRTACVTKVFPTRSHTVAAQGGIAASLS 61

Query: 69  NMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRP 128
           NM PDSWQWH+YDT+KGSDWLGD DA++YLA EAP++VYELEHYGVPFSR E GKIYQRP
Sbjct: 62  NMGPDSWQWHMYDTVKGSDWLGDTDAMEYLAREAPKAVYELEHYGVPFSRTEDGKIYQRP 121

Query: 129 FGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCC 188
           FGGH   YGEGPPVQRTCAAADRTGHA+LHTLYGQ+LKNNAEFFIEYFALDL+I ++G C
Sbjct: 122 FGGHTTEYGEGPPVQRTCAAADRTGHAMLHTLYGQSLKNNAEFFIEYFALDLMI-TDGRC 180

Query: 189 VGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDME 248
            GVVAW+L+ G +H F+AK+ VLATGGYGRAYFSATSAHTCTGDG GMVARAGLPLQDME
Sbjct: 181 TGVVAWKLDDGTLHVFNAKMTVLATGGYGRAYFSATSAHTCTGDGGGMVARAGLPLQDME 240

Query: 249 FVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEI 308
           FVQFHPTGIYG+GCLITEGARGEGGYL NS GERFMERYAP+ KDLASRDVVSRCM +EI
Sbjct: 241 FVQFHPTGIYGSGCLITEGARGEGGYLTNSNGERFMERYAPTYKDLASRDVVSRCMTIEI 300

Query: 309 REGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMG 368
           REGRGVG +KDHIHL L+HL    L  RLPGI+ESA+IFAGVD+T++PIPV+PTVHYNMG
Sbjct: 301 REGRGVGPNKDHIHLNLSHLPRETLDLRLPGITESAKIFAGVDLTKEPIPVLPTVHYNMG 360

Query: 369 GIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIR 428
           GIPTNYWGEVL+    NP+   PGLMA+GEA CASVHGANRLGSNSLIDLVVFGRAA IR
Sbjct: 361 GIPTNYWGEVLNPTPANPDAVFPGLMAVGEAACASVHGANRLGSNSLIDLVVFGRAASIR 420

Query: 429 ASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQD 488
           AS+++D  + +P     S D  + RFD  RHA+G +PTA LR +MQR MQ DA VFRT  
Sbjct: 421 ASKVVDAGADVPVTHKPSVDAALTRFDAARHANGAIPTAHLRLEMQRTMQADAAVFRTDK 480

Query: 489 SLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRG 548
           +L++G   ++ +  +MADLKV DRSLIWNSDL+ETLEL NLM NA+AT+ +AEARKESRG
Sbjct: 481 TLAEGVAKMTAVAGKMADLKVTDRSLIWNSDLMETLELANLMPNALATIVAAEARKESRG 540

Query: 549 SHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLC----GGVDYSKI 604
           +HA+ED  +     RDD  WR HSL  VD    K+ L  RPVH E L     GG+D +KI
Sbjct: 541 AHAQEDHPN-----RDDAKWRVHSLAVVD--GAKVTLSTRPVHLEPLTKFEDGGIDLAKI 593

Query: 605 APKARVY 611
           APKARVY
Sbjct: 594 APKARVY 600


>gi|114769284|ref|ZP_01446910.1| succinate dehydrogenase [alpha proteobacterium HTCC2255]
 gi|114550201|gb|EAU53082.1| succinate dehydrogenase [alpha proteobacterium HTCC2255]
          Length = 606

 Score =  900 bits (2326), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 443/612 (72%), Positives = 510/612 (83%), Gaps = 16/612 (2%)

Query: 9   SSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLA 68
           SSY Y+DH YDVVVVGAGGAGLRATLGMAE+G KTAC++KVFPTRSHTVAAQGGIAASLA
Sbjct: 2   SSYEYIDHEYDVVVVGAGGAGLRATLGMAEQGLKTACVSKVFPTRSHTVAAQGGIAASLA 61

Query: 69  NM----TP-DSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGK 123
           NM    +P D WQWH+YDT+KGSDWLGD DA++YL  EAP++VYELEHYGVPFSR E GK
Sbjct: 62  NMDVGTSPNDHWQWHMYDTVKGSDWLGDTDAMEYLVREAPKAVYELEHYGVPFSRTEEGK 121

Query: 124 IYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIIN 183
           IYQRPFGGH   +GEGP VQRTCAAADRTGHAILHTLYGQ+LK+NAEF+IEYFA DLI+ 
Sbjct: 122 IYQRPFGGHTTQFGEGPSVQRTCAAADRTGHAILHTLYGQSLKHNAEFYIEYFATDLIMT 181

Query: 184 SEGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLP 243
            +G C G++AW+L+ G IHRF+AK+VVLATGGYGRAYFSATSAHTCTGDG GMVAR GL 
Sbjct: 182 EDGRCQGIIAWKLDDGTIHRFNAKMVVLATGGYGRAYFSATSAHTCTGDGGGMVARQGLA 241

Query: 244 LQDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRC 303
           LQDMEFVQFHPTGIYG+GCLITEGARGEGGYL NS+GERFMERYAP+ KDLASRDVVSRC
Sbjct: 242 LQDMEFVQFHPTGIYGSGCLITEGARGEGGYLTNSEGERFMERYAPTYKDLASRDVVSRC 301

Query: 304 MMMEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTV 363
           M MEIREGRG+G   DHIHL+LNHL P  L ERLPGISESA+IFAGVDV ++PIPV+PTV
Sbjct: 302 MTMEIREGRGIGPDGDHIHLHLNHLPPETLAERLPGISESAKIFAGVDVNKEPIPVLPTV 361

Query: 364 HYNMGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGR 423
           HYNMGGIPTNYWGEVLD    + ++  PGLMA+GEAGCASVHGANRLGSNSLIDLVVFGR
Sbjct: 362 HYNMGGIPTNYWGEVLDPTDGDHDKILPGLMAVGEAGCASVHGANRLGSNSLIDLVVFGR 421

Query: 424 AAVIRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGV 483
           AA IRA++++D ++    L+  S ++ M RFD +RHA+G VPTA LR +MQ+ MQ DA V
Sbjct: 422 AAAIRAAKVVDPNTSNEPLNEKSVEKSMARFDGIRHANGSVPTAELRLEMQKNMQADAAV 481

Query: 484 FRTQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEAR 543
           FRT ++LS+G   +  +  ++ADL V DRSLIWNSDL+ETLEL NLM NA+AT+  AEAR
Sbjct: 482 FRTNETLSEGVDKMVEVAKKVADLNVTDRSLIWNSDLMETLELTNLMPNALATIVGAEAR 541

Query: 544 KESRGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLC----GGV 599
           KESRG+HA ED+ +     RDD+NWRKH+LC VD    K+ + YR VH E L     GG+
Sbjct: 542 KESRGAHAHEDYAE-----RDDINWRKHTLCRVD--NEKVDISYRNVHLEPLTSIEEGGI 594

Query: 600 DYSKIAPKARVY 611
           D  KIAPKARVY
Sbjct: 595 DMKKIAPKARVY 606


>gi|221640467|ref|YP_002526729.1| succinate dehydrogenase flavoprotein subunit [Rhodobacter
           sphaeroides KD131]
 gi|221161248|gb|ACM02228.1| Succinate dehydrogenase subunit A precursor [Rhodobacter
           sphaeroides KD131]
          Length = 600

 Score =  899 bits (2323), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 447/607 (73%), Positives = 503/607 (82%), Gaps = 12/607 (1%)

Query: 9   SSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLA 68
           ++YTY  H YDVVVVGAGGAGLRATLGMAE+G +TAC+TKVFPTRSHTVAAQGGIAASLA
Sbjct: 2   AAYTYETHDYDVVVVGAGGAGLRATLGMAEQGLRTACVTKVFPTRSHTVAAQGGIAASLA 61

Query: 69  NMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRP 128
           NM PD+WQWH+YDT+KGSDWLGD DA++YLA EAP++VYELEHYGVPFSR E GKIYQRP
Sbjct: 62  NMGPDNWQWHMYDTVKGSDWLGDTDAMEYLAREAPKAVYELEHYGVPFSRTEEGKIYQRP 121

Query: 129 FGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCC 188
           FGGH   +GEGPPVQRTCAAADRTGHAILHTLYGQ++KNNAEFFIEYFALDLII  +G C
Sbjct: 122 FGGHTTQFGEGPPVQRTCAAADRTGHAILHTLYGQSVKNNAEFFIEYFALDLIIQ-DGRC 180

Query: 189 VGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDME 248
            GVVAW+LE G IH F+AKL VLATGGYGRAYFSATSAHTCTGDG GMVARAGLPLQDME
Sbjct: 181 TGVVAWKLEDGTIHVFNAKLTVLATGGYGRAYFSATSAHTCTGDGGGMVARAGLPLQDME 240

Query: 249 FVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEI 308
           FVQFHPTGIYG+GCLITEGARGEGGYL NS GERFMERYAP+ KDLASRDVVSRCM +EI
Sbjct: 241 FVQFHPTGIYGSGCLITEGARGEGGYLTNSNGERFMERYAPTYKDLASRDVVSRCMTLEI 300

Query: 309 REGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMG 368
           REGRGVG+  DHIHL+LNHL P  L  RLPGISESA+IFAGVD+ ++PIPV+PTVHYNMG
Sbjct: 301 REGRGVGEHGDHIHLHLNHLPPETLALRLPGISESAKIFAGVDLHKEPIPVLPTVHYNMG 360

Query: 369 GIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIR 428
           GIPTNYWGEVL     +P+R  PGLMA+GEAGCASVHGANRLGSNSLIDLVVFGRAA IR
Sbjct: 361 GIPTNYWGEVLAPTEGDPDRVFPGLMAVGEAGCASVHGANRLGSNSLIDLVVFGRAAAIR 420

Query: 429 ASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQD 488
           A +++      P +     D I+ RFD LRHA+G VPTA LR +MQR MQ DA VFRT  
Sbjct: 421 AGQIVKPHEFHPDVPKGQVDEILGRFDDLRHANGAVPTAELRLEMQRTMQADAAVFRTDK 480

Query: 489 SLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRG 548
           +L++G   +  +  ++ DLKV DRSLIWNSDL+ETLEL NLM NA+AT+ +AEARKESRG
Sbjct: 481 TLAEGVEKMKGIAAKLGDLKVTDRSLIWNSDLMETLELTNLMPNALATIVAAEARKESRG 540

Query: 549 SHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLC----GGVDYSKI 604
           +HA ED+ +     RDD NWR HSL  V  N  ++ L  RPVH + L     GG+D  KI
Sbjct: 541 AHAHEDWPN-----RDDENWRVHSLAVVKGN--EVTLTTRPVHLDPLTKQTEGGIDLKKI 593

Query: 605 APKARVY 611
           APKARVY
Sbjct: 594 APKARVY 600


>gi|77464556|ref|YP_354060.1| succinate dehydrogenase flavoprotein subunit [Rhodobacter
           sphaeroides 2.4.1]
 gi|126463396|ref|YP_001044510.1| succinate dehydrogenase flavoprotein subunit [Rhodobacter
           sphaeroides ATCC 17029]
 gi|332559449|ref|ZP_08413771.1| succinate dehydrogenase flavoprotein subunit [Rhodobacter
           sphaeroides WS8N]
 gi|77388974|gb|ABA80159.1| succinate dehydrogenase subunit A [Rhodobacter sphaeroides 2.4.1]
 gi|126105060|gb|ABN77738.1| succinate dehydrogenase subunit A [Rhodobacter sphaeroides ATCC
           17029]
 gi|332277161|gb|EGJ22476.1| succinate dehydrogenase flavoprotein subunit [Rhodobacter
           sphaeroides WS8N]
          Length = 600

 Score =  899 bits (2322), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 447/607 (73%), Positives = 503/607 (82%), Gaps = 12/607 (1%)

Query: 9   SSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLA 68
           ++YTY  H YDVVVVGAGGAGLRATLGMAE+G +TAC+TKVFPTRSHTVAAQGGIAASLA
Sbjct: 2   AAYTYETHDYDVVVVGAGGAGLRATLGMAEQGLRTACVTKVFPTRSHTVAAQGGIAASLA 61

Query: 69  NMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRP 128
           NM PD+WQWH+YDT+KGSDWLGD DA++YLA EAP++VYELEHYGVPFSR E GKIYQRP
Sbjct: 62  NMGPDNWQWHMYDTVKGSDWLGDTDAMEYLAREAPKAVYELEHYGVPFSRTEEGKIYQRP 121

Query: 129 FGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCC 188
           FGGH   +GEGPPVQRTCAAADRTGHAILHTLYGQ++KNNAEFFIEYFALDLII  +G C
Sbjct: 122 FGGHTTQFGEGPPVQRTCAAADRTGHAILHTLYGQSVKNNAEFFIEYFALDLIIQ-DGRC 180

Query: 189 VGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDME 248
            GVVAW+LE G IH F+AKL VLATGGYGRAYFSATSAHTCTGDG GMVARAGLPLQDME
Sbjct: 181 TGVVAWKLEDGTIHVFNAKLTVLATGGYGRAYFSATSAHTCTGDGGGMVARAGLPLQDME 240

Query: 249 FVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEI 308
           FVQFHPTGIYG+GCLITEGARGEGGYL NS GERFMERYAP+ KDLASRDVVSRCM +EI
Sbjct: 241 FVQFHPTGIYGSGCLITEGARGEGGYLTNSNGERFMERYAPTYKDLASRDVVSRCMTLEI 300

Query: 309 REGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMG 368
           REGRGVG+  DHIHL+LNHL P  L  RLPGISESA+IFAGVD+ ++PIPV+PTVHYNMG
Sbjct: 301 REGRGVGEHGDHIHLHLNHLPPETLALRLPGISESAKIFAGVDLHKEPIPVLPTVHYNMG 360

Query: 369 GIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIR 428
           GIPTNYWGEVL     +P+R  PGLMA+GEAGCASVHGANRLGSNSLIDLVVFGRAA IR
Sbjct: 361 GIPTNYWGEVLAPTEGDPDRVFPGLMAVGEAGCASVHGANRLGSNSLIDLVVFGRAAAIR 420

Query: 429 ASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQD 488
           A +++      P +     D I+ RFD LRHA+G VPTA LR +MQR MQ DA VFRT  
Sbjct: 421 AGQIVKPHEFHPDVPKVQVDEILGRFDDLRHANGAVPTAELRLEMQRTMQADAAVFRTDK 480

Query: 489 SLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRG 548
           +L++G   +  +  ++ DLKV DRSLIWNSDL+ETLEL NLM NA+AT+ +AEARKESRG
Sbjct: 481 TLAEGVEKMKGIAAKLGDLKVTDRSLIWNSDLMETLELTNLMPNALATIVAAEARKESRG 540

Query: 549 SHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLC----GGVDYSKI 604
           +HA ED+ +     RDD NWR HSL  V  N  ++ L  RPVH + L     GG+D  KI
Sbjct: 541 AHAHEDWPN-----RDDENWRVHSLAVVKGN--EVTLTTRPVHLDPLTKQTEGGIDLKKI 593

Query: 605 APKARVY 611
           APKARVY
Sbjct: 594 APKARVY 600


>gi|294676290|ref|YP_003576905.1| succinate dehydrogenase, flavoprotein subunit [Rhodobacter
           capsulatus SB 1003]
 gi|294475110|gb|ADE84498.1| succinate dehydrogenase, flavoprotein subunit [Rhodobacter
           capsulatus SB 1003]
          Length = 601

 Score =  898 bits (2321), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 443/607 (72%), Positives = 502/607 (82%), Gaps = 11/607 (1%)

Query: 9   SSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLA 68
           +SYTY  H+YDVVVVGAGGAGLRATLGMAE+G +TAC+TKVFPTRSHTVAAQGGIAASL 
Sbjct: 2   ASYTYETHNYDVVVVGAGGAGLRATLGMAEQGLRTACVTKVFPTRSHTVAAQGGIAASLG 61

Query: 69  NMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRP 128
           NM PDSWQWH++DT+KGSDWLGD DA++YLA  AP +VYELEHYGVPFSR EAGKIYQRP
Sbjct: 62  NMGPDSWQWHMFDTVKGSDWLGDTDAMEYLARSAPAAVYELEHYGVPFSRTEAGKIYQRP 121

Query: 129 FGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCC 188
           FGGH   +G+GPPVQRTCAAADRTGHAILHTLYGQ+LKNNAEFFIEYFALDLI++ +G C
Sbjct: 122 FGGHTTEFGDGPPVQRTCAAADRTGHAILHTLYGQSLKNNAEFFIEYFALDLIMSEDGVC 181

Query: 189 VGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDME 248
            GVV W+L+ G  H F+AK+ VLATGGYGRAYFSATSAHTCTGDG GMVARAGL LQDME
Sbjct: 182 QGVVCWKLDDGTFHVFNAKMTVLATGGYGRAYFSATSAHTCTGDGGGMVARAGLALQDME 241

Query: 249 FVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEI 308
           FVQFHPTGIYG+GCLITEGARGEGGYL NS+GERFMERYAP  KDLA RD VSRCM +EI
Sbjct: 242 FVQFHPTGIYGSGCLITEGARGEGGYLTNSQGERFMERYAPHYKDLAPRDYVSRCMTLEI 301

Query: 309 REGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMG 368
           REGRGVG+ KDHIHL L+HL    L ERLPGISESA+IFAGVDVT++PIPV+PTVHYNMG
Sbjct: 302 REGRGVGEHKDHIHLNLSHLPKEALAERLPGISESAKIFAGVDVTKEPIPVLPTVHYNMG 361

Query: 369 GIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIR 428
           GIPTNYWGE L+  + NP    PGLMA+GEAGCASVHGANRLGSNSLIDLVVFGRAA IR
Sbjct: 362 GIPTNYWGEALNPTADNPNAIVPGLMAVGEAGCASVHGANRLGSNSLIDLVVFGRAAAIR 421

Query: 429 ASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQD 488
           A E++D  +   + + +S D+   RFD LRHA GH PTA LR +MQR MQ DA VFRT  
Sbjct: 422 AGEIVDPKARPAAYNQASVDKCFARFDGLRHAKGHTPTADLRLEMQRTMQADAAVFRTDK 481

Query: 489 SLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRG 548
           +L++G   ++ +  ++ADLKV DRSLIWNSDL+ETLEL NLM NA+AT+  AEARKESRG
Sbjct: 482 TLAEGKAKMTEIAAKVADLKVTDRSLIWNSDLMETLELTNLMPNALATIVGAEARKESRG 541

Query: 549 SHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLC----GGVDYSKI 604
           +HA ED        RDDVNWRKHS+  V+ N  K+ L YRPV TE L     GG+  +KI
Sbjct: 542 AHASEDHAT-----RDDVNWRKHSIMRVEDN--KVDLSYRPVITEPLTTEAEGGISLAKI 594

Query: 605 APKARVY 611
           APKAR +
Sbjct: 595 APKARTF 601


>gi|255263086|ref|ZP_05342428.1| succinate dehydrogenase, flavoprotein subunit [Thalassiobium sp.
           R2A62]
 gi|255105421|gb|EET48095.1| succinate dehydrogenase, flavoprotein subunit [Thalassiobium sp.
           R2A62]
          Length = 601

 Score =  898 bits (2320), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 437/607 (71%), Positives = 504/607 (83%), Gaps = 11/607 (1%)

Query: 9   SSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLA 68
           ++Y Y  H YDVVVVGAGGAGLRATLGMAE+G +TAC+TKVFPTRSHTVAAQGGIAASL+
Sbjct: 2   AAYEYETHDYDVVVVGAGGAGLRATLGMAEQGLRTACVTKVFPTRSHTVAAQGGIAASLS 61

Query: 69  NMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRP 128
           NM PD WQWH+YDT+KGSDWLGD DA++YLA EAP++VYELEHYGVPFSR E G+IYQRP
Sbjct: 62  NMGPDHWQWHMYDTVKGSDWLGDTDAMEYLAREAPKAVYELEHYGVPFSRTEKGEIYQRP 121

Query: 129 FGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCC 188
           FGGH   +GEGPPVQRTCAAADRTGHAILHTLYGQ+LKNNAEF+IEYFA+DLI++ +G C
Sbjct: 122 FGGHTTEFGEGPPVQRTCAAADRTGHAILHTLYGQSLKNNAEFYIEYFAIDLIMSEDGQC 181

Query: 189 VGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDME 248
            GVV W+L+ G +H F+AK+VVLATGGYGRAYFSATSAHTCTGDG GM AR GLPLQDME
Sbjct: 182 QGVVCWKLDDGTMHVFNAKMVVLATGGYGRAYFSATSAHTCTGDGGGMAARQGLPLQDME 241

Query: 249 FVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEI 308
           FVQFHPTGIYGAGCLITEGARGEGGYL NS+GERFMERYAP+ KDLASRDVVSRCM MEI
Sbjct: 242 FVQFHPTGIYGAGCLITEGARGEGGYLTNSEGERFMERYAPTYKDLASRDVVSRCMTMEI 301

Query: 309 REGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMG 368
           REGRGVG   DHIHL+LNHL    L  RLPGISESARIFAGVDVT++PIPV+PTVHYNMG
Sbjct: 302 REGRGVGTDSDHIHLHLNHLPAEALNLRLPGISESARIFAGVDVTKEPIPVLPTVHYNMG 361

Query: 369 GIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIR 428
           GIPTNYWGEVL+  + + +   PGLMA+GEAGCASVHGANRLGSNSLIDLVVFGRAA I+
Sbjct: 362 GIPTNYWGEVLNPTADDSDAVCPGLMAVGEAGCASVHGANRLGSNSLIDLVVFGRAAAIK 421

Query: 429 ASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQD 488
           A +++D  +P P+L+ +S D   DRFD LRHA+G   TA LR +MQ+ MQ DA VFRT  
Sbjct: 422 AGQVVDAEAPNPTLNQASIDAAFDRFDGLRHANGGTGTAELRLEMQKTMQADAAVFRTDK 481

Query: 489 SLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRG 548
           +L++G   +  + ++M+DL V D+SL+WNSDL+ETLEL NLM NA+AT+  AEARKESRG
Sbjct: 482 TLAEGVTKMEAVAEKMSDLHVTDKSLVWNSDLMETLELTNLMPNALATIVGAEARKESRG 541

Query: 549 SHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLC----GGVDYSKI 604
           +HA ED+ +     RDD NWR HSL +V+    K  L  RPVH + L     GG+D  KI
Sbjct: 542 AHAHEDYSE-----RDDKNWRVHSLAYVE--GAKTTLKTRPVHLDPLTTEDEGGIDLKKI 594

Query: 605 APKARVY 611
           APKARVY
Sbjct: 595 APKARVY 601


>gi|146276145|ref|YP_001166304.1| succinate dehydrogenase flavoprotein subunit [Rhodobacter
           sphaeroides ATCC 17025]
 gi|145554386|gb|ABP68999.1| succinate dehydrogenase subunit A [Rhodobacter sphaeroides ATCC
           17025]
          Length = 600

 Score =  897 bits (2319), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 445/607 (73%), Positives = 505/607 (83%), Gaps = 12/607 (1%)

Query: 9   SSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLA 68
           ++YTY  H YDVVVVGAGGAGLRATLGMAE+G +TAC+TKVFPTRSHTVAAQGGIAASLA
Sbjct: 2   AAYTYETHDYDVVVVGAGGAGLRATLGMAEQGLRTACVTKVFPTRSHTVAAQGGIAASLA 61

Query: 69  NMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRP 128
           NM PD+WQWH+YDT+KGSDWLGD DA++YLA EAP++VYELEHYGVPFSR E GKIYQRP
Sbjct: 62  NMGPDNWQWHMYDTVKGSDWLGDTDAMEYLAREAPKAVYELEHYGVPFSRTEEGKIYQRP 121

Query: 129 FGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCC 188
           FGGH   +GEGPPVQRTCAAADRTGHAILHTLYGQ++KNNAEFFIEYFALDLII  +G C
Sbjct: 122 FGGHTTQFGEGPPVQRTCAAADRTGHAILHTLYGQSVKNNAEFFIEYFALDLIIQ-DGRC 180

Query: 189 VGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDME 248
            GVVAW+LE G IH F+AKL VLATGGYGRAYFSATSAHTCTGDG GMVARAGLPLQDME
Sbjct: 181 TGVVAWRLEDGTIHVFNAKLTVLATGGYGRAYFSATSAHTCTGDGGGMVARAGLPLQDME 240

Query: 249 FVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEI 308
           FVQFHPTGIYG+GCLITEGARGEGGYL N+ GERFMERYAP+ KDLASRDVVSRCM +EI
Sbjct: 241 FVQFHPTGIYGSGCLITEGARGEGGYLTNANGERFMERYAPTYKDLASRDVVSRCMTLEI 300

Query: 309 REGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMG 368
           REGRGVG+  DHIHL+LNHL P  L  RLPGISESA+IFAGVDV ++PIPV+PTVHYNMG
Sbjct: 301 REGRGVGEHGDHIHLHLNHLPPETLALRLPGISESAKIFAGVDVHKEPIPVLPTVHYNMG 360

Query: 369 GIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIR 428
           GIPTNYWGEVL   + +P+R  PGLMA+GEAGCASVHGANRLGSNSLIDLVVFGRAA IR
Sbjct: 361 GIPTNYWGEVLAPTADDPDRVFPGLMAVGEAGCASVHGANRLGSNSLIDLVVFGRAAAIR 420

Query: 429 ASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQD 488
           A +++        +  +  D I+ RFD LRHA+G +PTA LR +MQR MQ DA VFRT  
Sbjct: 421 AGQIVKPHEFHADVPKAQVDEILGRFDDLRHANGAIPTADLRLEMQRTMQADAAVFRTDK 480

Query: 489 SLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRG 548
           +L++G   +  +  +++DLKV DRSLIWNSDL+ETLEL NLM NA+AT+ +AEARKESRG
Sbjct: 481 TLAEGVEKMKGIAAKLSDLKVTDRSLIWNSDLMETLELTNLMPNALATIVAAEARKESRG 540

Query: 549 SHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLC----GGVDYSKI 604
           +HA ED+ +     RDD NWR HSL  V  N  ++ L  RPVH + L     GG+D  KI
Sbjct: 541 AHAHEDWPN-----RDDENWRVHSLATVKGN--EVTLASRPVHLDPLTKQSEGGIDLKKI 593

Query: 605 APKARVY 611
           APKARVY
Sbjct: 594 APKARVY 600


>gi|83943851|ref|ZP_00956308.1| succinate dehydrogenase [Sulfitobacter sp. EE-36]
 gi|83953492|ref|ZP_00962214.1| succinate dehydrogenase [Sulfitobacter sp. NAS-14.1]
 gi|83842460|gb|EAP81628.1| succinate dehydrogenase [Sulfitobacter sp. NAS-14.1]
 gi|83845098|gb|EAP82978.1| succinate dehydrogenase [Sulfitobacter sp. EE-36]
          Length = 601

 Score =  897 bits (2318), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 444/607 (73%), Positives = 508/607 (83%), Gaps = 11/607 (1%)

Query: 9   SSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLA 68
           ++Y Y  H YDVVVVGAGGAGLRATLGMAE+G KTAC+TKVFPTRSHTVAAQGGIAASL+
Sbjct: 2   AAYEYETHEYDVVVVGAGGAGLRATLGMAEQGLKTACVTKVFPTRSHTVAAQGGIAASLS 61

Query: 69  NMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRP 128
           NM PD+WQWH+YDT+KGSDWLGD DA++YLA EAP++VYELEHYGVPFSR EAGKIYQRP
Sbjct: 62  NMGPDNWQWHMYDTVKGSDWLGDTDAMEYLAREAPKAVYELEHYGVPFSRTEAGKIYQRP 121

Query: 129 FGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCC 188
           FGGH   +GEGPPVQRTCAAADRTGHAILHTLYGQ+LK+NAEF+IEYFA+DLI++ +G C
Sbjct: 122 FGGHTTEFGEGPPVQRTCAAADRTGHAILHTLYGQSLKHNAEFYIEYFAIDLIMSDDGVC 181

Query: 189 VGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDME 248
            GV+ W+L+ G +H FSAK+VVLATGGYGRAYFSATSAHTCTGDG GM ARAGLPLQDME
Sbjct: 182 QGVLCWKLDDGTMHLFSAKMVVLATGGYGRAYFSATSAHTCTGDGGGMAARAGLPLQDME 241

Query: 249 FVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEI 308
           FVQFHPTGIYGAGCLITEGARGEGGYL NS+GERFMERYAP+ KDLASRDVVSRCM MEI
Sbjct: 242 FVQFHPTGIYGAGCLITEGARGEGGYLTNSEGERFMERYAPTYKDLASRDVVSRCMTMEI 301

Query: 309 REGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMG 368
           REGRGVG++KDHIHL+LNHL    L  RLPGISESARIFAGVD+T++PIPV+PTVHYNMG
Sbjct: 302 REGRGVGENKDHIHLHLNHLPKETLDLRLPGISESARIFAGVDLTKEPIPVLPTVHYNMG 361

Query: 369 GIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIR 428
           GIPTNYWGEVL      P+R APGLMA+GEAGCASVHGANRLGSNSLIDLVVFGRAA IR
Sbjct: 362 GIPTNYWGEVLAPTEDAPDRVAPGLMAVGEAGCASVHGANRLGSNSLIDLVVFGRAAAIR 421

Query: 429 ASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQD 488
           A E++D  +P+P+ +  S D   +RFD LR+A G +PTA LR +MQ+ MQ DA VFRT  
Sbjct: 422 AKEVVDAEAPVPTPNQKSVDAAFERFDSLRYAKGQIPTAELRLEMQKTMQADAAVFRTDK 481

Query: 489 SLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRG 548
           +L++G   +  +  ++ADL V D SL+WNSDL+ETLEL NLM NA+AT+ +A ARKESRG
Sbjct: 482 TLNEGKVKMDEVAGKIADLHVTDTSLVWNSDLMETLELTNLMPNAVATITAAAARKESRG 541

Query: 549 SHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLC----GGVDYSKI 604
           +HA ED+ D     RDD NWRKHSL + D N     L YR VH + L     GG+D  KI
Sbjct: 542 AHAHEDYPD-----RDDENWRKHSLAYFDGNAA--TLSYRGVHLDPLTEESEGGIDMKKI 594

Query: 605 APKARVY 611
           APKARVY
Sbjct: 595 APKARVY 601


>gi|84515885|ref|ZP_01003246.1| succinate dehydrogenase [Loktanella vestfoldensis SKA53]
 gi|84510327|gb|EAQ06783.1| succinate dehydrogenase [Loktanella vestfoldensis SKA53]
          Length = 601

 Score =  896 bits (2315), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 430/607 (70%), Positives = 495/607 (81%), Gaps = 11/607 (1%)

Query: 9   SSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLA 68
           ++Y Y  H+YD +VVGAGGAGLRATLG+AE+G +TACITKVFPTRSHTVAAQGGIAASL 
Sbjct: 2   AAYDYETHTYDAIVVGAGGAGLRATLGLAEQGLRTACITKVFPTRSHTVAAQGGIAASLG 61

Query: 69  NMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRP 128
           NM PDSWQWH++DT+KGSD+LGD DA++YLA EAP++VYELEHYGVPFSR E GKIYQRP
Sbjct: 62  NMGPDSWQWHMFDTVKGSDYLGDTDAMEYLAREAPKAVYELEHYGVPFSRTEEGKIYQRP 121

Query: 129 FGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCC 188
           FGGH   +GEGP VQRTCAAADRTGHAILHTLYGQ+LK  AEF+IEYFALDLI++ +G C
Sbjct: 122 FGGHTTQFGEGPAVQRTCAAADRTGHAILHTLYGQSLKQKAEFYIEYFALDLIMSDDGVC 181

Query: 189 VGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDME 248
            GV+AW+L+ G +H F+AK+VVLATGGYGRAYFSATSAHTCTGDG GMVAR GL LQDME
Sbjct: 182 QGVIAWKLDDGTMHVFNAKMVVLATGGYGRAYFSATSAHTCTGDGGGMVARQGLALQDME 241

Query: 249 FVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEI 308
           FVQFHPTGIYGAGCLITEGARGEGGYL NS+GERFMERYAP+ KDLA RD VSRCM MEI
Sbjct: 242 FVQFHPTGIYGAGCLITEGARGEGGYLTNSEGERFMERYAPNYKDLAPRDYVSRCMTMEI 301

Query: 309 REGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMG 368
           REGRGVG + DHIHL LNHL    L ERLPGISESA+IFAGVDVT++PIPV+PTVHYNMG
Sbjct: 302 REGRGVGANGDHIHLNLNHLPKEALAERLPGISESAKIFAGVDVTKEPIPVLPTVHYNMG 361

Query: 369 GIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIR 428
           GIPTNY GEVL+    +P    PGLMA+GEAGCASVHGANRLGSNSLIDLVVFGRAA IR
Sbjct: 362 GIPTNYHGEVLNPTKDDPTAIVPGLMAVGEAGCASVHGANRLGSNSLIDLVVFGRAAAIR 421

Query: 429 ASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQD 488
           A  ++D+ +  P+L+ +S D    RFD+LRHA G+V TA LR +MQRAMQ DA VFRT  
Sbjct: 422 AGHVVDRKAANPTLNKASVDASFGRFDQLRHAKGNVGTAELRLEMQRAMQEDAAVFRTDK 481

Query: 489 SLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRG 548
           +L++G   ++ +  +M DLKV DRSL+WNSDL+ETLEL NLM NA+AT+  AEARKESRG
Sbjct: 482 TLAEGVAKMTAIAGKMDDLKVTDRSLVWNSDLMETLELDNLMPNALATIVGAEARKESRG 541

Query: 549 SHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLC----GGVDYSKI 604
           +HA ED+ D     RDD  WR H+L  VD    K  L YRPV T+ L     GG+   +I
Sbjct: 542 AHAHEDYPD-----RDDAKWRVHTLAHVDG--AKTTLSYRPVITKPLTSEAEGGIAEDRI 594

Query: 605 APKARVY 611
            PK R +
Sbjct: 595 KPKVRTF 601


>gi|254488709|ref|ZP_05101914.1| succinate dehydrogenase, flavoprotein subunit [Roseobacter sp.
           GAI101]
 gi|214045578|gb|EEB86216.1| succinate dehydrogenase, flavoprotein subunit [Roseobacter sp.
           GAI101]
          Length = 601

 Score =  896 bits (2315), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 444/607 (73%), Positives = 510/607 (84%), Gaps = 11/607 (1%)

Query: 9   SSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLA 68
           ++Y Y  H YDVVVVGAGGAGLRATLGMAE+G KTAC+TKVFPTRSHTVAAQGGIAASL+
Sbjct: 2   AAYDYETHEYDVVVVGAGGAGLRATLGMAEQGLKTACVTKVFPTRSHTVAAQGGIAASLS 61

Query: 69  NMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRP 128
           NM PD+WQWH+YDT+KGSDWLGD DA++YLA EAP++VYELEHYGVPFSR EAGKIYQRP
Sbjct: 62  NMGPDNWQWHMYDTVKGSDWLGDTDAMEYLAREAPKAVYELEHYGVPFSRTEAGKIYQRP 121

Query: 129 FGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCC 188
           FGGH   +GEGPPVQRTCAAADRTGHAILHTLYGQ+LK+NAEF+IEYFA+DLI++ +G C
Sbjct: 122 FGGHTTEFGEGPPVQRTCAAADRTGHAILHTLYGQSLKHNAEFYIEYFAIDLIMSDDGVC 181

Query: 189 VGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDME 248
            GV+ W+L+ G +H FSAK+VVLATGGYGRAYFSATSAHTCTGDG GM ARAGLPLQDME
Sbjct: 182 QGVLCWKLDDGTMHLFSAKMVVLATGGYGRAYFSATSAHTCTGDGGGMTARAGLPLQDME 241

Query: 249 FVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEI 308
           FVQFHPTGIYGAGCLITEGARGEGGYL NS+GERFMERYAP+ KDLASRDVVSRCM MEI
Sbjct: 242 FVQFHPTGIYGAGCLITEGARGEGGYLTNSEGERFMERYAPTYKDLASRDVVSRCMTMEI 301

Query: 309 REGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMG 368
           REGRGVG+SKDHIHL+LNHL    L  RLPGISESARIFAGVD+T++PIPV+PTVHYNMG
Sbjct: 302 REGRGVGESKDHIHLHLNHLPKETLDLRLPGISESARIFAGVDLTKEPIPVLPTVHYNMG 361

Query: 369 GIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIR 428
           GIPTNYWGEVL   +  P+  +PGLMA+GEAGCASVHGANRLGSNSLIDLVVFGRAA IR
Sbjct: 362 GIPTNYWGEVLAPTADKPDNVSPGLMAVGEAGCASVHGANRLGSNSLIDLVVFGRAAAIR 421

Query: 429 ASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQD 488
           A E++D S+P+P+ +  S +    RFD LR+A GHV TA LR +MQ+ MQ DA VFRT  
Sbjct: 422 AKEIVDPSTPVPTPNTRSIEAAFSRFDGLRYAKGHVATAELRLEMQKTMQADAAVFRTDK 481

Query: 489 SLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRG 548
           +L++G   +  +  +++DLKV D+SL+WNSDL+ETLEL NLM NA+AT+ +A ARKESRG
Sbjct: 482 TLNEGKVKMDEVAGKISDLKVTDKSLVWNSDLMETLELTNLMPNAVATISAAAARKESRG 541

Query: 549 SHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLC----GGVDYSKI 604
           +HA ED+ D     RDD NWRKHSL W   N  +  L YR VH + L     GG+D  KI
Sbjct: 542 AHAHEDYPD-----RDDENWRKHSLVWFKGN--EATLGYRGVHLQPLTSHNDGGIDLKKI 594

Query: 605 APKARVY 611
           APKARVY
Sbjct: 595 APKARVY 601


>gi|110678934|ref|YP_681941.1| succinate dehydrogenase flavoprotein subunit [Roseobacter
           denitrificans OCh 114]
 gi|109455050|gb|ABG31255.1| succinate dehydrogenase, flavoprotein subunit [Roseobacter
           denitrificans OCh 114]
          Length = 601

 Score =  895 bits (2314), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 435/607 (71%), Positives = 504/607 (83%), Gaps = 11/607 (1%)

Query: 9   SSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLA 68
           + Y Y  H YDVVVVGAGGAGLRATLGMAE+G +TAC+TKVFPTRSHTVAAQGGIAASLA
Sbjct: 2   AEYEYETHEYDVVVVGAGGAGLRATLGMAEQGLRTACVTKVFPTRSHTVAAQGGIAASLA 61

Query: 69  NMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRP 128
           NM PD+WQWH+YDT+KGSDWLGD DA++YLA EAP++VYELEHYGVPFSR E GKIYQRP
Sbjct: 62  NMGPDNWQWHMYDTVKGSDWLGDTDAMEYLAREAPKAVYELEHYGVPFSRTEEGKIYQRP 121

Query: 129 FGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCC 188
           FGGH   +GEGP VQRTCAAADRTGHAILHTLYGQ+LKNNAEF+IEYFA+DLI++ +G C
Sbjct: 122 FGGHTTEFGEGPAVQRTCAAADRTGHAILHTLYGQSLKNNAEFYIEYFAIDLIMSDDGIC 181

Query: 189 VGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDME 248
            GV+ W+L+ G +H FS+K+VVLATGGYGRAYFSATSAHTCTGDG GM ARAGLPLQDME
Sbjct: 182 QGVLCWKLDDGTLHLFSSKMVVLATGGYGRAYFSATSAHTCTGDGGGMTARAGLPLQDME 241

Query: 249 FVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEI 308
           FVQFHPTGIYGAGCLITEGARGEGGYL NS+GERFMERYAP  KDLA RD VSRCM MEI
Sbjct: 242 FVQFHPTGIYGAGCLITEGARGEGGYLTNSEGERFMERYAPQYKDLAPRDYVSRCMTMEI 301

Query: 309 REGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMG 368
           REGRGVG + DHIHL LNHL P  L+ RLPGISESAR+FAGV++ ++PIPV+PTVHYNMG
Sbjct: 302 REGRGVGANGDHIHLNLNHLPPETLKLRLPGISESARVFAGVNLNKEPIPVLPTVHYNMG 361

Query: 369 GIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIR 428
           GIPTNYWGEVL     +P+R +PGLMA+GEAGCASVHGANRLGSNSLIDLVVFGRAA IR
Sbjct: 362 GIPTNYWGEVLAPTPDDPDRISPGLMAVGEAGCASVHGANRLGSNSLIDLVVFGRAAAIR 421

Query: 429 ASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQD 488
           A +++D +SP+PS +  S +  +DRFD  R+A GH+PTAALR +MQ+ MQ DA VFR  +
Sbjct: 422 AGKIVDPNSPVPSPNQKSVEAALDRFDNARYAKGHMPTAALRLEMQQTMQKDAAVFRANE 481

Query: 489 SLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRG 548
           +L++G + +  + D+ +D+ V DRSL+WNSDL+ETLEL NL+ NA+AT+  AEARKESRG
Sbjct: 482 TLAEGKKAMEEVADKWSDVGVTDRSLVWNSDLMETLELANLIPNAVATITGAEARKESRG 541

Query: 549 SHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLC----GGVDYSKI 604
           +HA EDF +     RDD NWRKHSL W   N  K  L YR VH + L     GG+D  KI
Sbjct: 542 AHAHEDFPE-----RDDENWRKHSLIWFKGN--KASLGYRGVHEQALTSHNDGGIDPKKI 594

Query: 605 APKARVY 611
           APK R +
Sbjct: 595 APKKRTF 601


>gi|84684217|ref|ZP_01012119.1| succinate dehydrogenase [Maritimibacter alkaliphilus HTCC2654]
 gi|84667970|gb|EAQ14438.1| succinate dehydrogenase [Rhodobacterales bacterium HTCC2654]
          Length = 601

 Score =  895 bits (2312), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 438/607 (72%), Positives = 499/607 (82%), Gaps = 11/607 (1%)

Query: 9   SSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLA 68
           + Y Y  H YDVVVVGAGGAGLRATLGMAE+G KTAC+TKVFPTRSHTVAAQGGIAASL+
Sbjct: 2   AEYEYETHEYDVVVVGAGGAGLRATLGMAEQGLKTACVTKVFPTRSHTVAAQGGIAASLS 61

Query: 69  NMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRP 128
           NM PD+WQWH+YDT+KGSDWLGD DA++YLA EAP +VYELEHYGVPFSR E GKIYQRP
Sbjct: 62  NMGPDNWQWHMYDTVKGSDWLGDTDAMEYLAREAPAAVYELEHYGVPFSRTEEGKIYQRP 121

Query: 129 FGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCC 188
           FGGH   +GEGP VQRTCAAADRTGHAILHTLYGQ+LKNNAEF+IEYFA+DLI++ +G C
Sbjct: 122 FGGHTTEFGEGPAVQRTCAAADRTGHAILHTLYGQSLKNNAEFYIEYFAIDLIMSDDGVC 181

Query: 189 VGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDME 248
            GVV W+L+ G +H F+AK+VVLATGGYGRAYFSATSAHTCTGDG GMVARAGL LQDME
Sbjct: 182 QGVVCWKLDDGTMHVFNAKMVVLATGGYGRAYFSATSAHTCTGDGGGMVARAGLALQDME 241

Query: 249 FVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEI 308
           FVQFHPTGIYG+GCLITEGARGEGGYL NS+GERFMERYAP  KDLA RD VSR M MEI
Sbjct: 242 FVQFHPTGIYGSGCLITEGARGEGGYLTNSEGERFMERYAPQYKDLAPRDYVSRSMTMEI 301

Query: 309 REGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMG 368
           REGRGVG   DHIHL L+HL    L ERLPGISESA+IFAGVDVT++PIPV+PTVHYNMG
Sbjct: 302 REGRGVGAEGDHIHLNLSHLPAEALAERLPGISESAKIFAGVDVTKEPIPVLPTVHYNMG 361

Query: 369 GIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIR 428
           GIPTNY+GEVL+  + NP    PGLMA+GEAGCASVHGANRLGSNSLIDLVVFGRAA IR
Sbjct: 362 GIPTNYYGEVLNPTADNPNAVVPGLMAVGEAGCASVHGANRLGSNSLIDLVVFGRAAAIR 421

Query: 429 ASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQD 488
           A E++D  SP+P+ + +S D   DRFD LRHADG  PTA LR +MQ+ MQ DA VFRT  
Sbjct: 422 AGEVVDAKSPVPTPNQASIDAAFDRFDGLRHADGGTPTAELRLEMQKTMQADAAVFRTDK 481

Query: 489 SLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRG 548
           +L +G   ++ +  ++ADLKV DRSL+WNSDL+ETLEL NLM NA+AT+  AEARKESRG
Sbjct: 482 TLKEGVEKMTAIAGKLADLKVTDRSLVWNSDLMETLELTNLMPNALATIVGAEARKESRG 541

Query: 549 SHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLC----GGVDYSKI 604
           +HA ED        RDD NWRKH++  VD +  K+ L YRPV  + L     GG++  KI
Sbjct: 542 AHAMEDHT-----ARDDENWRKHTISRVDGD--KVTLSYRPVILDPLTKEDQGGIELKKI 594

Query: 605 APKARVY 611
           APKAR +
Sbjct: 595 APKARTF 601


>gi|163734148|ref|ZP_02141589.1| succinate dehydrogenase flavoprotein subunit [Roseobacter litoralis
           Och 149]
 gi|161392684|gb|EDQ17012.1| succinate dehydrogenase flavoprotein subunit [Roseobacter litoralis
           Och 149]
          Length = 601

 Score =  894 bits (2310), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 435/607 (71%), Positives = 500/607 (82%), Gaps = 11/607 (1%)

Query: 9   SSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLA 68
           + Y Y  H YDVVVVGAGGAGLRATLGMAE+G +TAC+TKVFPTRSHTVAAQGGIAASLA
Sbjct: 2   AEYEYETHEYDVVVVGAGGAGLRATLGMAEQGLRTACVTKVFPTRSHTVAAQGGIAASLA 61

Query: 69  NMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRP 128
           NM PD+WQWH+YDT+KGSDWLGD DA++YLA EAP++VYELEHYGVPFSR E GKIYQRP
Sbjct: 62  NMGPDNWQWHMYDTVKGSDWLGDTDAMEYLAREAPKAVYELEHYGVPFSRTEEGKIYQRP 121

Query: 129 FGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCC 188
           FGGH   +GEGP VQRTCAAADRTGHAILHTLYGQ+LKNNAEF+IEYFA+DLI++ +G C
Sbjct: 122 FGGHTTEFGEGPAVQRTCAAADRTGHAILHTLYGQSLKNNAEFYIEYFAIDLIMSDDGVC 181

Query: 189 VGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDME 248
            GV+ W+L+ G +H FS+K+VVLATGGYGRAYFSATSAHTCTGDG GM ARAGLPLQDME
Sbjct: 182 QGVMCWKLDDGTLHLFSSKMVVLATGGYGRAYFSATSAHTCTGDGGGMTARAGLPLQDME 241

Query: 249 FVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEI 308
           FVQFHPTGIYGAGCLITEGARGEGGYL NS+GERFMERYAP  KDLA RD VSRCM MEI
Sbjct: 242 FVQFHPTGIYGAGCLITEGARGEGGYLTNSEGERFMERYAPQYKDLAPRDYVSRCMTMEI 301

Query: 309 REGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMG 368
           REGRGVG + DHIHL LNHL P  L+ RLPGISESAR+FAGV++ ++PIPV+PTVHYNMG
Sbjct: 302 REGRGVGANGDHIHLNLNHLPPETLKLRLPGISESARVFAGVNLNKEPIPVLPTVHYNMG 361

Query: 369 GIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIR 428
           GIPTNYWGEVL      P+R +PGLMA+GEAGCASVHGANRLGSNSLIDLVVFGRAA IR
Sbjct: 362 GIPTNYWGEVLAPTPNEPDRISPGLMAVGEAGCASVHGANRLGSNSLIDLVVFGRAAAIR 421

Query: 429 ASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQD 488
           A +++D  SP+PS +  S +  +DRFD  R+A GH+PTA LR +MQ+ MQ DA VFR  +
Sbjct: 422 AGKIVDPDSPVPSPNQKSVEAALDRFDNARYAKGHMPTAELRLEMQQTMQKDAAVFRANE 481

Query: 489 SLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRG 548
           +L++G   +  + D+ AD+ V DRSL+WNSDL+ETLEL NL+ NA+AT+  AEARKESRG
Sbjct: 482 TLAEGKTAMEEVADKWADVGVTDRSLVWNSDLMETLELSNLIPNAVATITGAEARKESRG 541

Query: 549 SHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLC----GGVDYSKI 604
           +HA EDF +     RDD NWRKHSL W   N  K  L YR VH + L     GG+D  KI
Sbjct: 542 AHAHEDFPE-----RDDENWRKHSLIWFKGN--KASLGYRGVHEQALTSHNDGGIDPKKI 594

Query: 605 APKARVY 611
           APK R +
Sbjct: 595 APKKRTF 601


>gi|89053300|ref|YP_508751.1| succinate dehydrogenase flavoprotein subunit [Jannaschia sp. CCS1]
 gi|88862849|gb|ABD53726.1| succinate dehydrogenase subunit A [Jannaschia sp. CCS1]
          Length = 606

 Score =  891 bits (2302), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 438/615 (71%), Positives = 507/615 (82%), Gaps = 13/615 (2%)

Query: 1   MKNSSNLKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQ 60
           MK++++   +Y    H+YDVVVVGAGG+GLRATLGMAE+G KTACI+KVFPTRSHTVAAQ
Sbjct: 1   MKDTTS--PAYALTHHTYDVVVVGAGGSGLRATLGMAEQGLKTACISKVFPTRSHTVAAQ 58

Query: 61  GGIAASLANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNE 120
           GGIAASL NM PD W WH+YDT+KGSDWLGD DA++YLA EAP++VYELEHYGVPFSR E
Sbjct: 59  GGIAASLGNMGPDHWHWHMYDTVKGSDWLGDTDAMEYLAREAPKAVYELEHYGVPFSRTE 118

Query: 121 AGKIYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDL 180
            GKIYQRPFGGH   +GEGPPVQRTCAAADRTGHAILHTLYGQ+LKN+AEFFIEYFA DL
Sbjct: 119 EGKIYQRPFGGHTTEFGEGPPVQRTCAAADRTGHAILHTLYGQSLKNDAEFFIEYFATDL 178

Query: 181 IINSEGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARA 240
           +++ EG CVGVVAW+L+ G +H F +K+ VLATGGYGRAYFSATSAHTCTGDG GMVARA
Sbjct: 179 LMDDEGQCVGVVAWKLDDGTMHVFHSKMTVLATGGYGRAYFSATSAHTCTGDGGGMVARA 238

Query: 241 GLPLQDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVV 300
           GLPLQDMEFVQFHPTGIYGAGCLITEGARGEGGYL NS+GERFMERYAP+ KDLASRDVV
Sbjct: 239 GLPLQDMEFVQFHPTGIYGAGCLITEGARGEGGYLTNSEGERFMERYAPTYKDLASRDVV 298

Query: 301 SRCMMMEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVI 360
           SRCM MEIR+GRGVG++ DHIHL+LNHL    L  RLPGISESARIFAGVD+T++PIPV+
Sbjct: 299 SRCMTMEIRDGRGVGENGDHIHLHLNHLPKETLDLRLPGISESARIFAGVDLTKEPIPVL 358

Query: 361 PTVHYNMGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVV 420
           PTVHYNMGGIPTNY GEVL+  + +P +  PGLMA+GEAGCASVHGANRLGSNSLIDLVV
Sbjct: 359 PTVHYNMGGIPTNYLGEVLNPTADDPMKTVPGLMAVGEAGCASVHGANRLGSNSLIDLVV 418

Query: 421 FGRAAVIRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLD 480
           FGRAA I+A E++D ++  P +     D+ + RFD +RHADG  PTA LR +MQ+ MQ D
Sbjct: 419 FGRAAAIKAGEIVDPNAKNPDVPQHQIDKALARFDDVRHADGGTPTAELRLEMQKTMQAD 478

Query: 481 AGVFRTQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSA 540
           A VFRT  +L++G   ++ +  +M D+ V DRS+IWNSDL+ETLEL NLM NA+AT+  A
Sbjct: 479 AAVFRTDKTLAEGLEKMTGVAGKMDDVAVTDRSMIWNSDLMETLELTNLMPNALATIAGA 538

Query: 541 EARKESRGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLC---- 596
           EARKESRG+HA ED+ D     RDDV+WRKHSL  VD N  K+ L YR V    L     
Sbjct: 539 EARKESRGAHAHEDYPD-----RDDVDWRKHSLAMVDGN--KVDLSYRDVGLSPLIGHNE 591

Query: 597 GGVDYSKIAPKARVY 611
           GG+D  KI PKARVY
Sbjct: 592 GGIDMDKIKPKARVY 606


>gi|149913139|ref|ZP_01901673.1| succinate dehydrogenase [Roseobacter sp. AzwK-3b]
 gi|149813545|gb|EDM73371.1| succinate dehydrogenase [Roseobacter sp. AzwK-3b]
          Length = 601

 Score =  889 bits (2298), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 433/607 (71%), Positives = 499/607 (82%), Gaps = 11/607 (1%)

Query: 9   SSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLA 68
           ++Y Y  H YDVVVVGAGGAGLRATLGMAE+G +TAC+TKVFPTRSHTVAAQGGIAASL+
Sbjct: 2   AAYEYETHDYDVVVVGAGGAGLRATLGMAEQGLRTACVTKVFPTRSHTVAAQGGIAASLS 61

Query: 69  NMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRP 128
           NM PD WQWH+YDT+KGSDWLGD DA++YLA EAP++VYELEHYGVPFSR E GKIYQRP
Sbjct: 62  NMGPDHWQWHMYDTVKGSDWLGDTDAMEYLAREAPKAVYELEHYGVPFSRTEEGKIYQRP 121

Query: 129 FGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCC 188
           FGGH   +GEGPPVQRTCAAADRTGHAILHTLYG++LK  AEF+IEYFA+DLI++ +G C
Sbjct: 122 FGGHTTEFGEGPPVQRTCAAADRTGHAILHTLYGRSLKQKAEFYIEYFAIDLIMSDDGVC 181

Query: 189 VGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDME 248
            GVV W+L+ G +H F+AK+VVLATGGYGRAYFSATSAHTCTGDG GMVARAGLPLQDME
Sbjct: 182 TGVVCWKLDDGTMHVFNAKMVVLATGGYGRAYFSATSAHTCTGDGGGMVARAGLPLQDME 241

Query: 249 FVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEI 308
           FVQFHPTGIYG+GCLITEGARGEGGYL NS+GERFMERYAP+ KDLA RD VSR M MEI
Sbjct: 242 FVQFHPTGIYGSGCLITEGARGEGGYLTNSEGERFMERYAPNYKDLAPRDYVSRSMTMEI 301

Query: 309 REGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMG 368
           REGRGVG   DHIHL L+HL    LQ RLPGISESARIFAGVDVT++PIPV+PTVHYNMG
Sbjct: 302 REGRGVGPHGDHIHLNLSHLPKEALQLRLPGISESARIFAGVDVTKEPIPVLPTVHYNMG 361

Query: 369 GIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIR 428
           GIPTNYWGEVL+   K+P    PGLMA+GEAGCASVHGANRLGSNSLIDLVVFGRAA IR
Sbjct: 362 GIPTNYWGEVLNPTEKDPNAVVPGLMAVGEAGCASVHGANRLGSNSLIDLVVFGRAAAIR 421

Query: 429 ASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQD 488
           A +++D+ + +PS + +  D+ +DRFD LRHADG VPTA LR +MQR MQ DA VFRT  
Sbjct: 422 AGDVVDRETAVPSTNAAQVDKALDRFDGLRHADGAVPTADLRLEMQRTMQDDAAVFRTSK 481

Query: 489 SLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRG 548
           +L++G   ++ +  +M+DLKV DRSL+WNSDL+ETLEL NLM NA+AT+  AEARKESRG
Sbjct: 482 TLAEGVEKMTAIAAKMSDLKVTDRSLVWNSDLMETLELTNLMPNALATIAGAEARKESRG 541

Query: 549 SHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLC----GGVDYSKI 604
           +HA EDF +     R+D  WR H++  VD    K  L YRP+    L     GG+   KI
Sbjct: 542 AHAHEDFPE-----RNDTKWRVHTIARVD--GAKTALSYRPIIEAPLTTEEQGGISLKKI 594

Query: 605 APKARVY 611
           APK R +
Sbjct: 595 APKERTF 601


>gi|85706756|ref|ZP_01037848.1| succinate dehydrogenase [Roseovarius sp. 217]
 gi|85668814|gb|EAQ23683.1| succinate dehydrogenase [Roseovarius sp. 217]
          Length = 600

 Score =  889 bits (2297), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 432/607 (71%), Positives = 497/607 (81%), Gaps = 12/607 (1%)

Query: 9   SSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLA 68
           ++Y Y  H YDVVVVGAGGAGLRATLGMAE+G +TAC+TKVFPTRSHTVAAQGGIAASL 
Sbjct: 2   AAYEYETHDYDVVVVGAGGAGLRATLGMAEQGLRTACVTKVFPTRSHTVAAQGGIAASLG 61

Query: 69  NMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRP 128
           NM PDSWQWH+YDTIKGSDWLGD DA++YLA EAP++VYELEHYGVPFSR E GKIYQRP
Sbjct: 62  NMGPDSWQWHMYDTIKGSDWLGDTDAMEYLAREAPKAVYELEHYGVPFSRTEEGKIYQRP 121

Query: 129 FGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCC 188
           FGGH   +GEGPPVQRTCAAADRTGHAILHTLYGQ+LK  AEF+IEYFA+DL++ ++G C
Sbjct: 122 FGGHTTEFGEGPPVQRTCAAADRTGHAILHTLYGQSLKQKAEFYIEYFAIDLVM-TDGTC 180

Query: 189 VGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDME 248
            GVV W+L+ G IH F+AK+VVLATGGYGRAYFSATSAHTCTGDG GMVARAGLPLQDME
Sbjct: 181 TGVVCWKLDDGTIHVFNAKMVVLATGGYGRAYFSATSAHTCTGDGGGMVARAGLPLQDME 240

Query: 249 FVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEI 308
           FVQFHPTGI+GAGCLITEGARGEGGYL NS+GERFMERYAP+ KDLA RD VSRCM MEI
Sbjct: 241 FVQFHPTGIFGAGCLITEGARGEGGYLTNSEGERFMERYAPNYKDLAPRDYVSRCMTMEI 300

Query: 309 REGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMG 368
           REGRGVG   DHIHL L+HL P  L  RLPGISESARIFAGVDVT++PIPV+PTVHYNMG
Sbjct: 301 REGRGVGADGDHIHLNLSHLPPEALHLRLPGISESARIFAGVDVTKEPIPVLPTVHYNMG 360

Query: 369 GIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIR 428
           G+PTNYWGEV++    NP    PGLMA+GEAGCASVHGANRLGSNSLIDLVVFGRAA IR
Sbjct: 361 GVPTNYWGEVVNPTKDNPHNVVPGLMAVGEAGCASVHGANRLGSNSLIDLVVFGRAAAIR 420

Query: 429 ASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQD 488
           A +++D  S +P  + +  D+ + RFD LRHA G +PTA LR +MQR MQ DA VFRT  
Sbjct: 421 AGKVVDAESAVPGTNKAEVDKALTRFDALRHATGKIPTAELRLEMQRTMQADAAVFRTSK 480

Query: 489 SLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRG 548
           +L++G   +  +  +M D+KV DRSL+WNSDL+ETLEL NLM NA+AT++ AEAR+ESRG
Sbjct: 481 TLAEGVEKMKAVAAKMDDIKVTDRSLVWNSDLMETLELTNLMPNALATIFGAEARQESRG 540

Query: 549 SHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLC----GGVDYSKI 604
           +HA EDF       RDD  WR H++  V+ NT  + L YRP+ T+ L     GG+   KI
Sbjct: 541 AHAHEDFST-----RDDEKWRVHTIARVEGNT--VDLSYRPIITDPLTTEDEGGISLKKI 593

Query: 605 APKARVY 611
           APK R +
Sbjct: 594 APKERTF 600


>gi|149201368|ref|ZP_01878343.1| succinate dehydrogenase flavoprotein subunit [Roseovarius sp.
           TM1035]
 gi|149145701|gb|EDM33727.1| succinate dehydrogenase flavoprotein subunit [Roseovarius sp.
           TM1035]
          Length = 600

 Score =  889 bits (2297), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 432/607 (71%), Positives = 498/607 (82%), Gaps = 12/607 (1%)

Query: 9   SSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLA 68
           ++Y Y  H YDVVVVGAGGAGLRATLGMAE+G +TAC+TKVFPTRSHTVAAQGGIAASL 
Sbjct: 2   AAYEYETHDYDVVVVGAGGAGLRATLGMAEQGLRTACVTKVFPTRSHTVAAQGGIAASLG 61

Query: 69  NMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRP 128
           NM PDSWQWH+YDT+KGSDWLGD DA++YLA EAP++VYELEHYGVPFSR E GKIYQRP
Sbjct: 62  NMGPDSWQWHMYDTVKGSDWLGDTDAMEYLAREAPKAVYELEHYGVPFSRTEEGKIYQRP 121

Query: 129 FGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCC 188
           FGGH   +GEGPPVQRTCAAADRTGHAILHTLYGQ+LK  AEF+IEYFA+DL++ ++G C
Sbjct: 122 FGGHTTEFGEGPPVQRTCAAADRTGHAILHTLYGQSLKQKAEFYIEYFAIDLVM-TDGAC 180

Query: 189 VGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDME 248
            GVV W+L+ G IH F+AK+VVLATGGYGRAYFSATSAHTCTGDG GMVARAGLPLQDME
Sbjct: 181 TGVVCWKLDDGTIHVFNAKMVVLATGGYGRAYFSATSAHTCTGDGGGMVARAGLPLQDME 240

Query: 249 FVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEI 308
           FVQFHPTGI+GAGCLITEGARGEGGYL NS+GERFMERYAP+ KDLA RD VSRCM MEI
Sbjct: 241 FVQFHPTGIFGAGCLITEGARGEGGYLTNSEGERFMERYAPNYKDLAPRDYVSRCMTMEI 300

Query: 309 REGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMG 368
           REGRGVG   DHIHL L+HL P  L  RLPGISESARIFAGVDVT++PIPV+PTVHYNMG
Sbjct: 301 REGRGVGADGDHIHLNLSHLPPEALHLRLPGISESARIFAGVDVTKEPIPVLPTVHYNMG 360

Query: 369 GIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIR 428
           G+PTNYWGEV++    NP    PGLMA+GEAGCASVHGANRLGSNSLIDLVVFGRAA IR
Sbjct: 361 GVPTNYWGEVVNPTQDNPHAVVPGLMAVGEAGCASVHGANRLGSNSLIDLVVFGRAAAIR 420

Query: 429 ASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQD 488
           A +++D+ S +P+ + +  D+ + RFD LRHA G VPTA LR +MQR MQ DA VFRT  
Sbjct: 421 AGKVVDRDSAVPATNKAEVDKALSRFDGLRHATGAVPTAELRLEMQRTMQADAAVFRTSK 480

Query: 489 SLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRG 548
           +L++G   +  +  +M D+KV DRSL+WNSDL+ETLEL NLM NA+AT++ AEAR+ESRG
Sbjct: 481 TLAEGVEKMKTVAAKMDDIKVTDRSLVWNSDLMETLELTNLMPNALATIFGAEARQESRG 540

Query: 549 SHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLC----GGVDYSKI 604
           +HA EDF       RDD  WR H++  VD N+  + L YRP+ T  L     GG+   KI
Sbjct: 541 AHAHEDFST-----RDDEKWRVHTIARVDGNS--VDLSYRPIITTPLTDEDQGGISLKKI 593

Query: 605 APKARVY 611
           APK R +
Sbjct: 594 APKERTF 600


>gi|83950426|ref|ZP_00959159.1| succinate dehydrogenase, flavoprotein subunit [Roseovarius
           nubinhibens ISM]
 gi|83838325|gb|EAP77621.1| succinate dehydrogenase, flavoprotein subunit [Roseovarius
           nubinhibens ISM]
          Length = 601

 Score =  889 bits (2296), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 430/607 (70%), Positives = 499/607 (82%), Gaps = 11/607 (1%)

Query: 9   SSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLA 68
           ++Y Y  H YDVVVVGAGGAGLRATLGMAE+G +TAC+TKVFPTRSHTVAAQGGIAASL 
Sbjct: 2   AAYEYETHEYDVVVVGAGGAGLRATLGMAEQGLRTACVTKVFPTRSHTVAAQGGIAASLG 61

Query: 69  NMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRP 128
           NM PD+WQWH+YDT+KGSDWLGD DA++YLA EAP++VYELEHYGVPFSR E GKIYQRP
Sbjct: 62  NMGPDNWQWHMYDTVKGSDWLGDTDAMEYLAREAPKAVYELEHYGVPFSRTEEGKIYQRP 121

Query: 129 FGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCC 188
           FGGH   +GEGPPVQRTCAAADRTGHAILHTLYGQ+LK  AEF+IEYFA+DLI++ +G C
Sbjct: 122 FGGHTTEFGEGPPVQRTCAAADRTGHAILHTLYGQSLKQKAEFYIEYFAIDLIMSDDGAC 181

Query: 189 VGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDME 248
            GVV W+L+ G +H F+AK+VVLATGGYGRAYFSATSAHTCTGDG GMVARAGLPLQDME
Sbjct: 182 TGVVCWKLDDGTMHVFNAKMVVLATGGYGRAYFSATSAHTCTGDGGGMVARAGLPLQDME 241

Query: 249 FVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEI 308
           FVQFHPTGIYG+GCLITEGARGEGGYL NS+GERFMERYAP  KDLA RD VSR M MEI
Sbjct: 242 FVQFHPTGIYGSGCLITEGARGEGGYLTNSEGERFMERYAPQYKDLAPRDYVSRSMTMEI 301

Query: 309 REGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMG 368
           REGRGVG+  DHIHL L+HL P  LQ RLPGISESARIFAGVDVT++PIPV+PTVHYNMG
Sbjct: 302 REGRGVGEHGDHIHLNLSHLPPEALQLRLPGISESARIFAGVDVTKEPIPVLPTVHYNMG 361

Query: 369 GIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIR 428
           GIPTNYWGEV++    +P    PGLMA+GEAGCASVHGANRLGSNSLIDLVVFGRAA IR
Sbjct: 362 GIPTNYWGEVVNPTKDDPNAIVPGLMAVGEAGCASVHGANRLGSNSLIDLVVFGRAAAIR 421

Query: 429 ASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQD 488
           A +++D  + +P+ +++  D+   RFD LRHADG +PTA LR +MQ+ MQ DA VFRT  
Sbjct: 422 AGKVVDPDTAVPATNLAQVDKAFARFDGLRHADGAIPTAELRLEMQKTMQEDAAVFRTSK 481

Query: 489 SLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRG 548
           +L++G   ++ +  +M DLKV DR+L+WNSDL+ETLEL NLM NA+AT++ AEARKESRG
Sbjct: 482 TLAEGVEKMTAIAGKMGDLKVTDRTLVWNSDLMETLELTNLMPNALATIHGAEARKESRG 541

Query: 549 SHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLC----GGVDYSKI 604
           +HA EDF       RDD NWR HS+  V+    ++ L YRPV  + L     GG+   KI
Sbjct: 542 AHAHEDFTS-----RDDENWRVHSVARVE--DTEVALSYRPVVEDPLTDEKSGGISLKKI 594

Query: 605 APKARVY 611
           APK R +
Sbjct: 595 APKERTF 601


>gi|254474757|ref|ZP_05088143.1| succinate dehydrogenase, flavoprotein subunit [Ruegeria sp. R11]
 gi|214029000|gb|EEB69835.1| succinate dehydrogenase, flavoprotein subunit [Ruegeria sp. R11]
          Length = 603

 Score =  888 bits (2295), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 433/609 (71%), Positives = 502/609 (82%), Gaps = 11/609 (1%)

Query: 7   LKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAAS 66
           + ++Y Y  H YDVVVVGAGGAGLRATLGMAE+G +TAC+TKVFPTRSHTVAAQGGIAAS
Sbjct: 2   MTAAYEYETHDYDVVVVGAGGAGLRATLGMAEQGLRTACVTKVFPTRSHTVAAQGGIAAS 61

Query: 67  LANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQ 126
           LANM PD WQWH+YDT+KGSDWLGD DA++YLA EAP++VYELEHYGVPFSR E GKIYQ
Sbjct: 62  LANMGPDHWQWHMYDTVKGSDWLGDTDAMEYLAREAPKAVYELEHYGVPFSRTEEGKIYQ 121

Query: 127 RPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEG 186
           RPFGGH   +GEGP VQRTCAAADRTGHAILHTLYGQ+LKNNAEF+IEYFA+DLI++ +G
Sbjct: 122 RPFGGHTTEFGEGPAVQRTCAAADRTGHAILHTLYGQSLKNNAEFYIEYFAIDLIMSEDG 181

Query: 187 CCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQD 246
            C GVV W+L+ G +H F+AK+VVLATGGYGRAYFSATSAHTCTGDG GMVARAGL LQD
Sbjct: 182 QCQGVVCWKLDDGTMHVFNAKMVVLATGGYGRAYFSATSAHTCTGDGGGMVARAGLALQD 241

Query: 247 MEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMM 306
           MEFVQFHPTGIYG+GCLITEGARGEGGYL NS+GERFMERYAP  KDLA RD VSR M M
Sbjct: 242 MEFVQFHPTGIYGSGCLITEGARGEGGYLTNSEGERFMERYAPQYKDLAPRDYVSRSMTM 301

Query: 307 EIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYN 366
           EIREGRGVG+  DHIHL L+HL    L ERLPGISESA+IFAGVDVT++PIPV+PTVHYN
Sbjct: 302 EIREGRGVGEHGDHIHLNLSHLPAEALAERLPGISESAKIFAGVDVTKEPIPVLPTVHYN 361

Query: 367 MGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAV 426
           MGGIPTNYWGEVL+  +++P    PGLMA+GEAGCASVHGANRLGSNSLIDLVVFGRAA 
Sbjct: 362 MGGIPTNYWGEVLNPTAEDPNAVVPGLMAVGEAGCASVHGANRLGSNSLIDLVVFGRAAA 421

Query: 427 IRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRT 486
           IRA +++D +SP P L+ +  D+   RFD LRHA G +PTA LR +MQR MQ DA VFRT
Sbjct: 422 IRAGKVVDPNSPNPELNQAQVDKAFGRFDTLRHAKGAIPTADLRLEMQRTMQSDAAVFRT 481

Query: 487 QDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKES 546
            +++++G   ++ +  +M DL V DRSL+WNSDL+ETLEL NLM NA+AT+  AEARKES
Sbjct: 482 SETMAEGVEKMTAIAAKMDDLAVTDRSLVWNSDLMETLELTNLMPNALATIVGAEARKES 541

Query: 547 RGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLC----GGVDYS 602
           RG+HA EDF       RDD NWR H++  ++ N  K+ L YRPV  + L     GG+  +
Sbjct: 542 RGAHAHEDFTT-----RDDENWRVHTVSRIEGN--KVDLTYRPVILDPLTTEAEGGISEA 594

Query: 603 KIAPKARVY 611
           KIAPKAR +
Sbjct: 595 KIAPKARTF 603


>gi|114764870|ref|ZP_01444052.1| succinate dehydrogenase [Pelagibaca bermudensis HTCC2601]
 gi|114542756|gb|EAU45779.1| succinate dehydrogenase [Roseovarius sp. HTCC2601]
          Length = 601

 Score =  887 bits (2291), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 432/607 (71%), Positives = 503/607 (82%), Gaps = 11/607 (1%)

Query: 9   SSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLA 68
           ++Y Y  H+YDVVVVGAGGAGLRATLGMAE+G +TAC+TKVFPTRSHTVAAQGGIAASL+
Sbjct: 2   AAYEYETHNYDVVVVGAGGAGLRATLGMAEQGLRTACVTKVFPTRSHTVAAQGGIAASLS 61

Query: 69  NMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRP 128
           NM PD+WQWH+YDT+KGSDWLGD DA++YLA  AP +VYELEHYGVPFSR E GKIYQRP
Sbjct: 62  NMGPDNWQWHMYDTVKGSDWLGDTDAMEYLARSAPAAVYELEHYGVPFSRTEEGKIYQRP 121

Query: 129 FGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCC 188
           FGGH   +GEGPPVQRTCAAADRTGHAILHTLYGQ+LKNNAEF+IEYFA+DLI++ +G C
Sbjct: 122 FGGHTTEFGEGPPVQRTCAAADRTGHAILHTLYGQSLKNNAEFYIEYFAIDLIMSDDGVC 181

Query: 189 VGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDME 248
            GVV W+L+ G  H F+AK+VVLATGGYGRAYFSATSAHTCTGDG GMVARAGL LQDME
Sbjct: 182 QGVVCWKLDDGTFHVFNAKMVVLATGGYGRAYFSATSAHTCTGDGGGMVARAGLALQDME 241

Query: 249 FVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEI 308
           FVQFHPTGIYG+GCLITEGARGEGGYL NS+GERFMERYAP+ KDLA RD VSR M MEI
Sbjct: 242 FVQFHPTGIYGSGCLITEGARGEGGYLTNSEGERFMERYAPTYKDLAPRDYVSRSMTMEI 301

Query: 309 REGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMG 368
           REGRGVG+  DHIHL L+HL    L ERLPGISESA+IFAGVDVT++PIPV+PTVHYNMG
Sbjct: 302 REGRGVGEHGDHIHLNLSHLPAEALAERLPGISESAKIFAGVDVTKEPIPVLPTVHYNMG 361

Query: 369 GIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIR 428
           GIPTNYWGEVL+  S++P    PGLMA+GEAGCASVHGANRLGSNSLIDLVVFGRAA IR
Sbjct: 362 GIPTNYWGEVLNPTSEDPNAVVPGLMAVGEAGCASVHGANRLGSNSLIDLVVFGRAAAIR 421

Query: 429 ASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQD 488
           A E++D+++P  +L+  S D+  DRFD LR+A+G  PTA LR +MQR MQ DA VFRT  
Sbjct: 422 AGEVVDRAAPTHALNQPSVDKAFDRFDGLRYAEGGTPTAELRLEMQRTMQEDAAVFRTDK 481

Query: 489 SLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRG 548
           +L +G   ++ +  +M D++V DRSL+WNSDL+ETLEL NLM NA+AT+  AEARKESRG
Sbjct: 482 TLKEGVEKMTAIAGKMGDIRVSDRSLVWNSDLMETLELTNLMPNALATIVGAEARKESRG 541

Query: 549 SHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLC----GGVDYSKI 604
           +HA ED+ +     RDD NWR H++  VD    K+ L +RPV  + L     GG+  +KI
Sbjct: 542 AHAHEDYPE-----RDDENWRIHTISRVD--DTKVTLTHRPVIVDPLTEEEKGGISLAKI 594

Query: 605 APKARVY 611
           APKAR +
Sbjct: 595 APKARTF 601


>gi|260425389|ref|ZP_05779369.1| succinate dehydrogenase, flavoprotein subunit [Citreicella sp.
           SE45]
 gi|260423329|gb|EEX16579.1| succinate dehydrogenase, flavoprotein subunit [Citreicella sp.
           SE45]
          Length = 601

 Score =  886 bits (2290), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 432/607 (71%), Positives = 501/607 (82%), Gaps = 11/607 (1%)

Query: 9   SSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLA 68
           ++Y Y  H+YDVVVVGAGGAGLRATLGMAE+G +TAC+TKVFPTRSHTVAAQGGIAASL+
Sbjct: 2   AAYEYETHTYDVVVVGAGGAGLRATLGMAEQGLRTACVTKVFPTRSHTVAAQGGIAASLS 61

Query: 69  NMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRP 128
           NM PD+WQWH+YDT+KGSDWLGD DA++YLA  AP +VYELEHYGVPFSR E GKIYQRP
Sbjct: 62  NMGPDNWQWHMYDTVKGSDWLGDTDAMEYLARSAPAAVYELEHYGVPFSRTEEGKIYQRP 121

Query: 129 FGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCC 188
           FGGH   +GEGPPVQRTCAAADRTGHAILHTLYGQ+LKNNAEF+IEYFA+DLI++ +G C
Sbjct: 122 FGGHTTEFGEGPPVQRTCAAADRTGHAILHTLYGQSLKNNAEFYIEYFAIDLIMSDDGVC 181

Query: 189 VGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDME 248
            GVV W+L+ G  H F+AK+VVLATGGYGRAYFSATSAHTCTGDG GMVARAGL LQDME
Sbjct: 182 QGVVCWKLDDGTFHIFNAKMVVLATGGYGRAYFSATSAHTCTGDGGGMVARAGLALQDME 241

Query: 249 FVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEI 308
           FVQFHPTGIYG+GCLITEGARGEGGYL NS+GERFMERYAP+ KDLA RD VSR M MEI
Sbjct: 242 FVQFHPTGIYGSGCLITEGARGEGGYLTNSEGERFMERYAPTYKDLAPRDYVSRSMTMEI 301

Query: 309 REGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMG 368
           REGRGVG+  DHIHL L+HL    L ERLPGISESA+IFAGVDVT++PIPV+PTVHYNMG
Sbjct: 302 REGRGVGEHGDHIHLNLSHLPAEALAERLPGISESAKIFAGVDVTKEPIPVLPTVHYNMG 361

Query: 369 GIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIR 428
           GIPTNYWGEVL+  + NP    PGLMA+GEAGCASVHGANRLGSNSLIDLVVFGRAA IR
Sbjct: 362 GIPTNYWGEVLNPTADNPNAVVPGLMAVGEAGCASVHGANRLGSNSLIDLVVFGRAAAIR 421

Query: 429 ASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQD 488
           A E++D+++   +L+  S D+  DRFD +R+ADG  PTA LR +MQR MQ DA VFRT  
Sbjct: 422 AGEVVDRAASKHALNQVSVDKAFDRFDSIRNADGDTPTAELRLEMQRTMQADAAVFRTDK 481

Query: 489 SLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRG 548
           +L +G   ++ +  +M DLKV DR+LIWNSDL+E+LEL NLM NA+AT+  AEARKESRG
Sbjct: 482 TLKEGVEKMTAIAGKMGDLKVTDRTLIWNSDLMESLELTNLMPNALATIVGAEARKESRG 541

Query: 549 SHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLC----GGVDYSKI 604
           +HA ED+ +     RDD NWR H++  V+ NT  + L  RPV  + L     GG+  +KI
Sbjct: 542 AHAHEDYPN-----RDDENWRVHTISRVEGNT--VTLSQRPVVVDPLTTEAEGGISLAKI 594

Query: 605 APKARVY 611
           APKAR +
Sbjct: 595 APKARTF 601


>gi|99078503|ref|YP_611761.1| succinate dehydrogenase flavoprotein subunit [Ruegeria sp. TM1040]
 gi|99035641|gb|ABF62499.1| succinate dehydrogenase subunit A [Ruegeria sp. TM1040]
          Length = 602

 Score =  886 bits (2289), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 434/609 (71%), Positives = 498/609 (81%), Gaps = 11/609 (1%)

Query: 7   LKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAAS 66
           + ++Y Y  H YDVVVVGAGGAGLRATLGMAE+G +TAC+TKVFPTRSHTVAAQGGIAAS
Sbjct: 1   MTAAYEYETHEYDVVVVGAGGAGLRATLGMAEQGLRTACVTKVFPTRSHTVAAQGGIAAS 60

Query: 67  LANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQ 126
           L NM PDSWQWH+YDT+KGSDWLGD DA++YLA EAP++VYELEHYGVPFSR E GKIYQ
Sbjct: 61  LGNMGPDSWQWHMYDTVKGSDWLGDTDAMEYLAREAPKAVYELEHYGVPFSRTEEGKIYQ 120

Query: 127 RPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEG 186
           RPFGGH   +GEGPPVQRTCAAADRTGHAILHTLYGQ+LKNNAEF+IEYFA+DLI++ +G
Sbjct: 121 RPFGGHTTEFGEGPPVQRTCAAADRTGHAILHTLYGQSLKNNAEFYIEYFAIDLIMSEDG 180

Query: 187 CCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQD 246
            C GVV W+L+ G +H F+AK+VVLATGGYGRAYFSATSAHTCTGDG GMVARAGLPLQD
Sbjct: 181 QCQGVVCWKLDDGTMHVFNAKMVVLATGGYGRAYFSATSAHTCTGDGGGMVARAGLPLQD 240

Query: 247 MEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMM 306
           MEFVQFHPTGIYG+GCLITEGARGEGGYL NS+GERFMERYAP+ KDLA RD VSR M M
Sbjct: 241 MEFVQFHPTGIYGSGCLITEGARGEGGYLTNSEGERFMERYAPNYKDLAPRDYVSRSMTM 300

Query: 307 EIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYN 366
           EIREGRGVG+  DHIHL L+HL    L ERLPGISESA+IFAGVDVT++PIPV+PTVHYN
Sbjct: 301 EIREGRGVGEHGDHIHLNLSHLPAEALAERLPGISESAKIFAGVDVTKEPIPVLPTVHYN 360

Query: 367 MGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAV 426
           MGGIPTNYWGEVL+    NP    PGLMA+GEAGCASVHGANRLGSNSLIDLVVFGRA+ 
Sbjct: 361 MGGIPTNYWGEVLNPTEDNPTGVVPGLMAVGEAGCASVHGANRLGSNSLIDLVVFGRASA 420

Query: 427 IRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRT 486
           IRA +++D  +P P L+ +S D+  DRFD LR+A G  PTA LR +MQR MQ DA VFRT
Sbjct: 421 IRAGKVVDPEAPNPVLNQASIDKAFDRFDGLRNAKGGTPTAELRLEMQRTMQADAAVFRT 480

Query: 487 QDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKES 546
             +L +G   +  +  ++ DL V D SL+WNSDL+ETLEL NLM NA+AT+  AEARKES
Sbjct: 481 DKTLKEGVEKMEVIAAKLDDLHVTDTSLVWNSDLMETLELTNLMPNALATIVGAEARKES 540

Query: 547 RGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELL----CGGVDYS 602
           RG+HA ED+ +     RDD NWR H++  V+ N  K  L YRPV  + L     GG+   
Sbjct: 541 RGAHAHEDYAE-----RDDENWRVHTVARVEGN--KTSLSYRPVIVDPLTNEDAGGISLK 593

Query: 603 KIAPKARVY 611
           KIAPKAR +
Sbjct: 594 KIAPKARTF 602


>gi|254464526|ref|ZP_05077937.1| succinate dehydrogenase, flavoprotein subunit [Rhodobacterales
           bacterium Y4I]
 gi|206685434|gb|EDZ45916.1| succinate dehydrogenase, flavoprotein subunit [Rhodobacterales
           bacterium Y4I]
          Length = 601

 Score =  886 bits (2289), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 432/607 (71%), Positives = 502/607 (82%), Gaps = 11/607 (1%)

Query: 9   SSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLA 68
           ++Y Y  H YDVVVVGAGGAGLRATLGMAE+G +TAC+TKVFPTRSHTVAAQGGIAASL 
Sbjct: 2   AAYEYETHEYDVVVVGAGGAGLRATLGMAEQGLRTACVTKVFPTRSHTVAAQGGIAASLG 61

Query: 69  NMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRP 128
           NM PDSWQWH+YDT+KGSDWLGD DA++YLA EAP++VYELEHYGVPFSR E GKIYQRP
Sbjct: 62  NMGPDSWQWHMYDTVKGSDWLGDTDAMEYLAREAPKAVYELEHYGVPFSRTEEGKIYQRP 121

Query: 129 FGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCC 188
           FGGH   +GEGP VQRTCAAADRTGHAILHTLYGQ+LKNNAEF+IEYFA+DLI++ +G C
Sbjct: 122 FGGHTTEFGEGPAVQRTCAAADRTGHAILHTLYGQSLKNNAEFYIEYFAIDLIMSEDGQC 181

Query: 189 VGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDME 248
            GVV W+L+ G +H F+AK+VVLATGGYGRAYFSATSAHTCTGDG GMVARAGL LQDME
Sbjct: 182 QGVVCWKLDDGTMHVFNAKMVVLATGGYGRAYFSATSAHTCTGDGGGMVARAGLALQDME 241

Query: 249 FVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEI 308
           FVQFHPTGIYG+GCLITEGARGEGGYL NS+GERFMERYAP  KDLA RD VSR M MEI
Sbjct: 242 FVQFHPTGIYGSGCLITEGARGEGGYLTNSEGERFMERYAPQYKDLAPRDYVSRSMTMEI 301

Query: 309 REGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMG 368
           REGRGVG   DHIHL L+HL    L ERLPGISESA+IFAGVDVT++PIPV+PTVHYNMG
Sbjct: 302 REGRGVGAEGDHIHLNLSHLPAEALAERLPGISESAKIFAGVDVTKEPIPVLPTVHYNMG 361

Query: 369 GIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIR 428
           GIPTNYWGEVL+  + +P    PGLMA+GEAGCASVHGANRLGSNSLIDLVVFGRA+ IR
Sbjct: 362 GIPTNYWGEVLNPTADDPTAVVPGLMAVGEAGCASVHGANRLGSNSLIDLVVFGRASAIR 421

Query: 429 ASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQD 488
           A +++D  +  P L+ +S D+  DRFD LR+A+G +PTA LR +MQ+ MQ DA VFRT  
Sbjct: 422 AGKVVDPEAANPVLNQASVDKAFDRFDTLRNANGGIPTADLRLEMQKCMQADAAVFRTSK 481

Query: 489 SLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRG 548
           ++++G   ++ +  ++ DLKV DRSL+WNSDL+ETLEL NLM NA+AT+  AEARKESRG
Sbjct: 482 TMAEGVEKMTAIAAKLDDLKVTDRSLVWNSDLMETLELTNLMPNALATIVGAEARKESRG 541

Query: 549 SHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLC----GGVDYSKI 604
           +HA EDF       RDD NWR H++  V+ N  K++L YRPV T+ L     GG+  +KI
Sbjct: 542 AHAHEDFTS-----RDDENWRVHTVSRVEGN--KVELSYRPVITDPLSTEAEGGISLAKI 594

Query: 605 APKARVY 611
           APKAR +
Sbjct: 595 APKARTF 601


>gi|84500176|ref|ZP_00998442.1| succinate dehydrogenase, flavoprotein subunit [Oceanicola batsensis
           HTCC2597]
 gi|84392110|gb|EAQ04378.1| succinate dehydrogenase, flavoprotein subunit [Oceanicola batsensis
           HTCC2597]
          Length = 601

 Score =  885 bits (2287), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 431/607 (71%), Positives = 499/607 (82%), Gaps = 11/607 (1%)

Query: 9   SSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLA 68
           ++Y Y  H YDVVVVGAGGAGLRATLGMAE+G +TAC+TKVFPTRSHTVAAQGGIAASL+
Sbjct: 2   AAYEYETHEYDVVVVGAGGAGLRATLGMAEQGLRTACVTKVFPTRSHTVAAQGGIAASLS 61

Query: 69  NMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRP 128
           NM PD WQWH+YDT+KGSDWLGD DA++YLA  AP +VYELEHYGVPFSR E GKIYQRP
Sbjct: 62  NMGPDHWQWHMYDTVKGSDWLGDTDAMEYLARSAPAAVYELEHYGVPFSRTEEGKIYQRP 121

Query: 129 FGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCC 188
           FGGH   +GEGP VQRTCAAADRTGHAILHTLYGQ+LKNNAEF+IEYFA+DLI++ +G C
Sbjct: 122 FGGHTTEFGEGPAVQRTCAAADRTGHAILHTLYGQSLKNNAEFYIEYFAIDLIMSDDGVC 181

Query: 189 VGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDME 248
            GV+ W+L+ G +H F +K+VVLATGGYGRAYFSATSAHTCTGDG GMVARAGLPLQDME
Sbjct: 182 TGVLCWKLDDGTMHVFRSKMVVLATGGYGRAYFSATSAHTCTGDGGGMVARAGLPLQDME 241

Query: 249 FVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEI 308
           FVQFHPTGIYG+GCLITEGARGEGGYL NS+GERFMERYAP  KDLA RD VSR M MEI
Sbjct: 242 FVQFHPTGIYGSGCLITEGARGEGGYLTNSEGERFMERYAPQYKDLAPRDYVSRSMTMEI 301

Query: 309 REGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMG 368
           REGRGVG+  DHIHL L+HL    L ERLPGISESARIFAGVDVT++PIPV+PTVHYNMG
Sbjct: 302 REGRGVGEHGDHIHLNLSHLPAEALAERLPGISESARIFAGVDVTKEPIPVLPTVHYNMG 361

Query: 369 GIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIR 428
           GIPTNYWGEVL+ +  +P    PGLMA+GEAGCASVHGANRLGSNSLIDLVVFGRAA IR
Sbjct: 362 GIPTNYWGEVLNPSEGDPNAVVPGLMAVGEAGCASVHGANRLGSNSLIDLVVFGRAAAIR 421

Query: 429 ASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQD 488
           A +++D  S +P +  +S D+  DRFD LR+A G +PTA LR++MQR MQ DA VFRT +
Sbjct: 422 AGKVVDPESAVPEVVTASVDKAFDRFDGLRNASGSIPTADLRDEMQRTMQSDAAVFRTSE 481

Query: 489 SLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRG 548
           +L DG   ++ +  ++ DLKV DRSLIWNSDL+ETLEL NLM NA+ T+  AEAR ESRG
Sbjct: 482 TLKDGVTKMTEIAGKLGDLKVTDRSLIWNSDLMETLELTNLMPNALTTIVGAEARHESRG 541

Query: 549 SHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLC----GGVDYSKI 604
           +HA ED+ +     RDD  WR H++  VD N  K++L YRPV T+ L     GG++  +I
Sbjct: 542 AHAHEDYSE-----RDDETWRVHTIARVDGN--KVELSYRPVITDPLTTEDEGGIELKRI 594

Query: 605 APKARVY 611
           APKAR +
Sbjct: 595 APKARTF 601


>gi|86138975|ref|ZP_01057546.1| succinate dehydrogenase, flavoprotein subunit [Roseobacter sp.
           MED193]
 gi|85824206|gb|EAQ44410.1| succinate dehydrogenase, flavoprotein subunit [Roseobacter sp.
           MED193]
          Length = 601

 Score =  885 bits (2287), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 431/607 (71%), Positives = 503/607 (82%), Gaps = 11/607 (1%)

Query: 9   SSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLA 68
           ++Y Y  H YDVVVVGAGGAGLRATLGMAE+G +TAC+TKVFPTRSHTVAAQGGIAASL+
Sbjct: 2   AAYEYETHDYDVVVVGAGGAGLRATLGMAEQGLRTACVTKVFPTRSHTVAAQGGIAASLS 61

Query: 69  NMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRP 128
           NM PD+WQWH+YDT+KGSDWLGD DA++YLA EAP++VYELEHYGVPFSR E GKIYQRP
Sbjct: 62  NMGPDNWQWHMYDTVKGSDWLGDTDAMEYLAREAPKAVYELEHYGVPFSRTEEGKIYQRP 121

Query: 129 FGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCC 188
           FGGH   +GEGPPVQRTCAAADRTGHAILHTLYGQ+LKNNAEF+IEYFA+DLI++ +G C
Sbjct: 122 FGGHTTEFGEGPPVQRTCAAADRTGHAILHTLYGQSLKNNAEFYIEYFAIDLIMSDDGEC 181

Query: 189 VGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDME 248
            GVV W+L+ G +H F+AK+VVLATGGYGRA+FSATSAHTCTGDG GMVARAGL LQDME
Sbjct: 182 QGVVCWKLDDGTMHVFNAKMVVLATGGYGRAFFSATSAHTCTGDGGGMVARAGLALQDME 241

Query: 249 FVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEI 308
           FVQFHPTGIYG+GCLITEGARGEGGYL NS+GERFMERYAP  KDLA RD VSR M MEI
Sbjct: 242 FVQFHPTGIYGSGCLITEGARGEGGYLTNSEGERFMERYAPQYKDLAPRDYVSRSMTMEI 301

Query: 309 REGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMG 368
           REGRGVG   DHIHL L+HL P  L ERLPGISESA+IFAGVDVT++PIPV+PTVHYNMG
Sbjct: 302 REGRGVGADGDHIHLNLSHLPPEALAERLPGISESAKIFAGVDVTKEPIPVLPTVHYNMG 361

Query: 369 GIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIR 428
           GIPTNYWGEVL+  +++P    PGLMA+GEAGCASVHGANRLGSNSLIDLVVFGRA+ IR
Sbjct: 362 GIPTNYWGEVLNPTAEDPTAVVPGLMAVGEAGCASVHGANRLGSNSLIDLVVFGRASAIR 421

Query: 429 ASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQD 488
           A +++D  +P  +L+ +S D+  DRFD LR+A+G + TA LR +MQR MQ DA VFRT  
Sbjct: 422 AGKVVDAEAPNATLNQASVDKAFDRFDTLRNANGGIATADLRLEMQRTMQSDAAVFRTDK 481

Query: 489 SLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRG 548
           SL +G   ++ +  +M DLKV DRSL+WNSDL+ETLEL NLM NA+AT++ AEAR+ESRG
Sbjct: 482 SLKEGVEKMTVIASKMDDLKVTDRSLVWNSDLMETLELANLMPNALATIHGAEARRESRG 541

Query: 549 SHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLC----GGVDYSKI 604
           +HA ED+       RDD NWR H++  V+    K+ L YRPV  + L     GG+  +KI
Sbjct: 542 AHAHEDYST-----RDDENWRVHTVSRVEGE--KVDLSYRPVILDRLTTEDEGGISLAKI 594

Query: 605 APKARVY 611
           APKAR +
Sbjct: 595 APKARTF 601


>gi|126740503|ref|ZP_01756190.1| succinate dehydrogenase flavoprotein subunit [Roseobacter sp.
           SK209-2-6]
 gi|126718304|gb|EBA15019.1| succinate dehydrogenase flavoprotein subunit [Roseobacter sp.
           SK209-2-6]
          Length = 601

 Score =  883 bits (2281), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 435/607 (71%), Positives = 498/607 (82%), Gaps = 11/607 (1%)

Query: 9   SSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLA 68
           ++Y Y  H YDVVVVGAGGAGLRATLGMAE+G +TAC+TKVFPTRSHTVAAQGGIAASL 
Sbjct: 2   AAYEYETHDYDVVVVGAGGAGLRATLGMAEQGLRTACVTKVFPTRSHTVAAQGGIAASLG 61

Query: 69  NMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRP 128
           NM PDSWQWH+YDT+KGSDWLGD DA++YLA EAP++VYELEHYGVPFSR E GKIYQRP
Sbjct: 62  NMGPDSWQWHMYDTVKGSDWLGDTDAMEYLAREAPKAVYELEHYGVPFSRTEEGKIYQRP 121

Query: 129 FGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCC 188
           FGGH   YGEGP VQRTCAAADRTGHAILHTLYGQ+LKNNAEF+IEYFA+DLI++ +G C
Sbjct: 122 FGGHTTEYGEGPAVQRTCAAADRTGHAILHTLYGQSLKNNAEFYIEYFAIDLIMSEDGQC 181

Query: 189 VGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDME 248
            GVV W+L+ G +H F+AK+VVLATGGYGRAYFSATSAHTCTGDG GMVARAGL LQDME
Sbjct: 182 QGVVCWKLDDGTMHVFNAKMVVLATGGYGRAYFSATSAHTCTGDGGGMVARAGLALQDME 241

Query: 249 FVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEI 308
           FVQFHPTGIYG+GCLITEGARGEGGYL NS+GERFMERYAP  KDLA RD VSR M MEI
Sbjct: 242 FVQFHPTGIYGSGCLITEGARGEGGYLTNSEGERFMERYAPQYKDLAPRDYVSRSMTMEI 301

Query: 309 REGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMG 368
           REGRGVG   DHIHL L+HL    L ERLPGISESA+IFAGVDVT++PIPV+PTVHYNMG
Sbjct: 302 REGRGVGAEGDHIHLNLSHLPAEALAERLPGISESAKIFAGVDVTKEPIPVLPTVHYNMG 361

Query: 369 GIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIR 428
           GIPTNYWGEVL+  +++P    PGLMA+GEAGCASVHGANRLGSNSLIDLVVFGRAA IR
Sbjct: 362 GIPTNYWGEVLNPTAEDPTGVVPGLMAVGEAGCASVHGANRLGSNSLIDLVVFGRAAAIR 421

Query: 429 ASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQD 488
           A +++D  +P P L+ +S D   DRFD LR+A+G V TA LR +MQR MQ DA VFRT  
Sbjct: 422 AGKVVDAEAPNPVLNQASVDAAFDRFDGLRNANGAVATADLRLEMQRTMQSDAAVFRTDK 481

Query: 489 SLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRG 548
           +L +G   ++ +  +M DLKV DRSL+WNSDL+ETLEL NLM NA+AT++ AEARKESRG
Sbjct: 482 TLKEGVEKMTEIAGKMGDLKVTDRSLVWNSDLMETLELTNLMPNALATIHGAEARKESRG 541

Query: 549 SHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLC----GGVDYSKI 604
           +HA ED+       RDD NWR H++  V+    K+ L YRPV  + L     GG+   KI
Sbjct: 542 AHAHEDYAT-----RDDENWRVHTVSRVEGE--KVDLSYRPVIVDPLTTEDEGGISLKKI 594

Query: 605 APKARVY 611
           APKAR +
Sbjct: 595 APKARTF 601


>gi|259415259|ref|ZP_05739181.1| succinate dehydrogenase, flavoprotein subunit [Silicibacter sp.
           TrichCH4B]
 gi|259349169|gb|EEW60923.1| succinate dehydrogenase, flavoprotein subunit [Silicibacter sp.
           TrichCH4B]
          Length = 602

 Score =  881 bits (2277), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 432/609 (70%), Positives = 496/609 (81%), Gaps = 11/609 (1%)

Query: 7   LKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAAS 66
           + ++Y Y  H YDVVVVGAGGAGLRATLGMAE+G +TAC+TKVFPTRSHTVAAQGGIAAS
Sbjct: 1   MTAAYEYETHEYDVVVVGAGGAGLRATLGMAEQGLRTACVTKVFPTRSHTVAAQGGIAAS 60

Query: 67  LANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQ 126
           L NM PDSWQWH+YDT+KGSDWLGD DA++YLA EAP++VYELEHYGVPFSR E GKIYQ
Sbjct: 61  LGNMGPDSWQWHMYDTVKGSDWLGDTDAMEYLAREAPKAVYELEHYGVPFSRTEEGKIYQ 120

Query: 127 RPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEG 186
           RPFGGH   +GEGPPVQRTCAAADRTGHAILHTLYGQ+LKNNAEF+IEYFA+DLI++ +G
Sbjct: 121 RPFGGHTTEFGEGPPVQRTCAAADRTGHAILHTLYGQSLKNNAEFYIEYFAIDLIMSDDG 180

Query: 187 CCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQD 246
            C GVV W+L+ G +H F+AK+VVLATGGYGRAYFSATSAHTCTGDG GMVARAGLPLQD
Sbjct: 181 QCQGVVCWKLDDGTMHVFNAKMVVLATGGYGRAYFSATSAHTCTGDGGGMVARAGLPLQD 240

Query: 247 MEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMM 306
           MEFVQFHPTGIYG+GCLITEGARGEGGYL NS+GERFMERYAP+ KDLA RD VSR M M
Sbjct: 241 MEFVQFHPTGIYGSGCLITEGARGEGGYLTNSEGERFMERYAPNYKDLAPRDYVSRSMTM 300

Query: 307 EIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYN 366
           EIREGRGVG+  DHIHL L+HL    L ERLPGISESA+IFAGVDVT++PIPV+PTVHYN
Sbjct: 301 EIREGRGVGEHGDHIHLNLSHLPAEALAERLPGISESAKIFAGVDVTKEPIPVLPTVHYN 360

Query: 367 MGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAV 426
           MGGIPTNYWGEVL+    NP    PGLMA+GEAGCASVHGANRLGSNSLIDLVVFGRA+ 
Sbjct: 361 MGGIPTNYWGEVLNPTEDNPTGVVPGLMAVGEAGCASVHGANRLGSNSLIDLVVFGRASA 420

Query: 427 IRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRT 486
           IRA +++D  +P P L+ +S D+  DRFD LR+A G  PTA LR +MQR MQ DA VFRT
Sbjct: 421 IRAGKVVDPEAPNPVLNQASIDKAFDRFDGLRNAKGGTPTAELRLEMQRTMQADAAVFRT 480

Query: 487 QDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKES 546
             +L +G   +  +  ++ DL V D SL+WNSDL+ETLEL NLM NA+AT+  AEARKES
Sbjct: 481 DKTLKEGVEKMEVIAQKLDDLHVTDTSLVWNSDLMETLELTNLMPNALATIVGAEARKES 540

Query: 547 RGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLC----GGVDYS 602
           RG+HA ED+ +     RDD  WR H++  V+ N  K  L YRPV  + L     GG+   
Sbjct: 541 RGAHAHEDYAE-----RDDNAWRVHTVARVEGN--KTTLSYRPVIVDPLTNEDEGGISLK 593

Query: 603 KIAPKARVY 611
            IAPKAR +
Sbjct: 594 TIAPKARTF 602


>gi|56695275|ref|YP_165623.1| succinate dehydrogenase flavoprotein subunit [Ruegeria pomeroyi
           DSS-3]
 gi|56677012|gb|AAV93678.1| succinate dehydrogenase, flavoprotein subunit [Ruegeria pomeroyi
           DSS-3]
          Length = 601

 Score =  881 bits (2277), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 431/607 (71%), Positives = 498/607 (82%), Gaps = 11/607 (1%)

Query: 9   SSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLA 68
           ++Y Y  H YDVVVVGAGGAGLRATLGMAE+G +TAC+TKVFPTRSHTVAAQGGIAASL+
Sbjct: 2   AAYEYETHEYDVVVVGAGGAGLRATLGMAEQGLRTACVTKVFPTRSHTVAAQGGIAASLS 61

Query: 69  NMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRP 128
           NM PD WQWH+YDT+KGSDWLGD DA++YLA EAP++VYELEHYGVPFSR E GKIYQRP
Sbjct: 62  NMGPDHWQWHMYDTVKGSDWLGDTDAMEYLAREAPKAVYELEHYGVPFSRTEEGKIYQRP 121

Query: 129 FGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCC 188
           FGGH   +GEGP VQRTCAAADRTGHAILHTLYGQ+LKNNAEF+IEYFA+DLI++ +G C
Sbjct: 122 FGGHTTEFGEGPAVQRTCAAADRTGHAILHTLYGQSLKNNAEFYIEYFAIDLIMSEDGQC 181

Query: 189 VGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDME 248
            GVV W+L+ G  H F+AK+VVLATGGYGRAYFSATSAHTCTGDG GMVARAGL LQDME
Sbjct: 182 QGVVCWKLDDGTFHVFNAKMVVLATGGYGRAYFSATSAHTCTGDGGGMVARAGLALQDME 241

Query: 249 FVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEI 308
           FVQFHPTGIYG+GCLITEGARGEGGYL NS+GERFMERYAP  KDLA RD VSR M MEI
Sbjct: 242 FVQFHPTGIYGSGCLITEGARGEGGYLTNSEGERFMERYAPQYKDLAPRDYVSRSMTMEI 301

Query: 309 REGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMG 368
           REGRGVGK  DHIHL L+HL    L ERLPGISESA+IFAGVDVT++PIPV+PTVHYNMG
Sbjct: 302 REGRGVGKDGDHIHLNLSHLPAEALAERLPGISESAKIFAGVDVTKEPIPVLPTVHYNMG 361

Query: 369 GIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIR 428
           GIPTNYWGEVL+  + NP    PGLMA+GEAGCASVHGANRLGSNSLIDLVVFGRA+ IR
Sbjct: 362 GIPTNYWGEVLNPTADNPTAIVPGLMAVGEAGCASVHGANRLGSNSLIDLVVFGRASAIR 421

Query: 429 ASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQD 488
           A +++D  +  P L+++S ++  DRFD LR+A G V TA LR +MQ+ MQ DA VFRT  
Sbjct: 422 AGKVVDPEAANPVLNLASVEKAFDRFDGLRNAKGSVATADLRLEMQKTMQADAAVFRTAK 481

Query: 489 SLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRG 548
           ++++G   ++ +  +M DL V DRSL+WNSDL+ETLEL NLM +A+AT+  AEARKESRG
Sbjct: 482 TMAEGVEKMTAIAAKMDDLSVTDRSLVWNSDLMETLELTNLMPSALATIVGAEARKESRG 541

Query: 549 SHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLC----GGVDYSKI 604
           +HA EDF       RDD NWR H++  V+ N  K++L YRPV TE L     GG+   KI
Sbjct: 542 AHAHEDFPT-----RDDENWRVHTISRVEGN--KVELSYRPVITEPLTTEEQGGIALKKI 594

Query: 605 APKARVY 611
           APK R +
Sbjct: 595 APKERTF 601


>gi|163738941|ref|ZP_02146354.1| succinate dehydrogenase [Phaeobacter gallaeciensis BS107]
 gi|161387746|gb|EDQ12102.1| succinate dehydrogenase flavoprotein subunit [Phaeobacter
           gallaeciensis BS107]
          Length = 601

 Score =  881 bits (2276), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 429/607 (70%), Positives = 499/607 (82%), Gaps = 11/607 (1%)

Query: 9   SSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLA 68
           ++Y Y  H YDVVVVGAGGAGLRATLGMAE+G +TAC+TKVFPTRSHTVAAQGGIAASL+
Sbjct: 2   AAYEYETHDYDVVVVGAGGAGLRATLGMAEQGLRTACVTKVFPTRSHTVAAQGGIAASLS 61

Query: 69  NMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRP 128
           NM PD WQWH+YDT+KGSDWLGD DA++YLA EAP++VYELEHYGVPFSR E GKIYQRP
Sbjct: 62  NMGPDHWQWHMYDTVKGSDWLGDTDAMEYLAREAPKAVYELEHYGVPFSRTEEGKIYQRP 121

Query: 129 FGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCC 188
           FGGH   +GEGP VQRTCAAADRTGHAILHTLYGQ+LKNNAEF++EYFA+DLI++ +G C
Sbjct: 122 FGGHTTEFGEGPAVQRTCAAADRTGHAILHTLYGQSLKNNAEFYVEYFAIDLIMSEDGQC 181

Query: 189 VGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDME 248
            GVV W+L+ G +H F+AK+VVLATGGYGRAYFSATSAHTCTGDG GMVARAGL LQDME
Sbjct: 182 QGVVCWKLDDGTMHVFNAKMVVLATGGYGRAYFSATSAHTCTGDGGGMVARAGLALQDME 241

Query: 249 FVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEI 308
           FVQFHPTGIYG+GCLITEGARGEGGYL NS+GERFMERYAP  KDLA RD VSR M MEI
Sbjct: 242 FVQFHPTGIYGSGCLITEGARGEGGYLTNSEGERFMERYAPQYKDLAPRDYVSRSMTMEI 301

Query: 309 REGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMG 368
           REGRGVG+  DHIHL L+HL    L ERLPGISESA+IFAGVDVT++PIPV+PTVHYNMG
Sbjct: 302 REGRGVGEHGDHIHLNLSHLPAEALAERLPGISESAKIFAGVDVTKEPIPVLPTVHYNMG 361

Query: 369 GIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIR 428
           GIPTNYWGEVL+  + +P    PGLMA+GEAGCASVHGANRLGSNSLIDLVVFGRAA IR
Sbjct: 362 GIPTNYWGEVLNPTADDPTAVVPGLMAVGEAGCASVHGANRLGSNSLIDLVVFGRAAAIR 421

Query: 429 ASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQD 488
           A +++D  +P P L+ +  D+  DRFD LRHA G +PTA LR +MQR MQ DA VFRT +
Sbjct: 422 AGKVVDAEAPNPVLNQAQVDKAFDRFDGLRHAKGSIPTADLRLEMQRTMQSDAAVFRTSE 481

Query: 489 SLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRG 548
           ++++G   ++ +  ++ DL V DRSL+WNSDL+ETLEL NLM NA+AT+  AEAR+ESRG
Sbjct: 482 TMAEGVTKMTAIAAKIDDLAVTDRSLVWNSDLMETLELTNLMPNALATIVGAEARQESRG 541

Query: 549 SHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLC----GGVDYSKI 604
           +HA EDF       R+D  WR H++  VD N  K+ L YRPV  + L     GG+  +KI
Sbjct: 542 AHAHEDFTS-----RNDEKWRVHTVSRVDGN--KVDLSYRPVIVDPLTTEAEGGISEAKI 594

Query: 605 APKARVY 611
           APKAR +
Sbjct: 595 APKARTF 601


>gi|163741815|ref|ZP_02149205.1| succinate dehydrogenase [Phaeobacter gallaeciensis 2.10]
 gi|161384988|gb|EDQ09367.1| succinate dehydrogenase [Phaeobacter gallaeciensis 2.10]
          Length = 601

 Score =  879 bits (2270), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 428/607 (70%), Positives = 499/607 (82%), Gaps = 11/607 (1%)

Query: 9   SSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLA 68
           ++Y Y  H YDVVVVGAGGAGLRATLGMAE+G +TAC+TKVFPTRSHTVAAQGGIAASL+
Sbjct: 2   AAYEYETHDYDVVVVGAGGAGLRATLGMAEQGLRTACVTKVFPTRSHTVAAQGGIAASLS 61

Query: 69  NMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRP 128
           NM PD WQWH+YDT+KGSDWLGD DA++YLA EAP++VYELEHYGVPFSR E GKIYQRP
Sbjct: 62  NMGPDHWQWHMYDTVKGSDWLGDTDAMEYLAREAPKAVYELEHYGVPFSRTEEGKIYQRP 121

Query: 129 FGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCC 188
           FGGH   +GEGP VQRTCAAADRTGHAILHTLYGQ+LKNNAEF++EYFA+DLI++ +G C
Sbjct: 122 FGGHTTEFGEGPAVQRTCAAADRTGHAILHTLYGQSLKNNAEFYVEYFAIDLIMSEDGQC 181

Query: 189 VGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDME 248
            GVV W+L+ G +H F+AK+VVLATGGYGRAYFSATSAHTCTGDG GMVARAGL LQDME
Sbjct: 182 QGVVCWKLDDGTMHVFNAKMVVLATGGYGRAYFSATSAHTCTGDGGGMVARAGLALQDME 241

Query: 249 FVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEI 308
           FVQFHPTGIYG+GCLITEGARGEGGYL NS+GERFMERYAP  KDLA RD VSR M MEI
Sbjct: 242 FVQFHPTGIYGSGCLITEGARGEGGYLTNSEGERFMERYAPQYKDLAPRDYVSRSMTMEI 301

Query: 309 REGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMG 368
           REGRGVG+  DHIHL L+HL    L ERLPGISESA+IFAGVDVT++PIPV+PTVHYNMG
Sbjct: 302 REGRGVGEHGDHIHLNLSHLPAEALAERLPGISESAKIFAGVDVTKEPIPVLPTVHYNMG 361

Query: 369 GIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIR 428
           GIPTNYWGEVL+  + +P    PGLMA+GEAGCASVHGANRLGSNSLIDLVVFGRAA IR
Sbjct: 362 GIPTNYWGEVLNPTADDPTAVVPGLMAVGEAGCASVHGANRLGSNSLIDLVVFGRAAAIR 421

Query: 429 ASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQD 488
           A +++D  +P P L+ +  D+  DRFD LR+A G +PTA LR +MQR MQ DA VFRT +
Sbjct: 422 AGKVVDAEAPNPVLNQAQVDKAFDRFDGLRYAKGSIPTADLRLEMQRTMQSDAAVFRTSE 481

Query: 489 SLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRG 548
           ++++G   ++ +  ++ DL V DRSL+WNSDL+ETLEL NLM NA+AT+  AEAR+ESRG
Sbjct: 482 TMAEGVTKMTAIAAKIDDLAVTDRSLVWNSDLMETLELTNLMPNALATIVGAEARQESRG 541

Query: 549 SHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLC----GGVDYSKI 604
           +HA EDF       R+D  WR H++  VD N  K+ L YRPV  + L     GG+  +KI
Sbjct: 542 AHAHEDFTS-----RNDEKWRVHTVSRVDGN--KVDLSYRPVIVDPLTTEAEGGISEAKI 594

Query: 605 APKARVY 611
           APKAR +
Sbjct: 595 APKARTF 601


>gi|163744265|ref|ZP_02151625.1| succinate dehydrogenase flavoprotein subunit [Oceanibulbus
           indolifex HEL-45]
 gi|161381083|gb|EDQ05492.1| succinate dehydrogenase flavoprotein subunit [Oceanibulbus
           indolifex HEL-45]
          Length = 601

 Score =  876 bits (2264), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 441/607 (72%), Positives = 506/607 (83%), Gaps = 11/607 (1%)

Query: 9   SSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLA 68
           ++Y Y  H YDVVVVGAGGAGLRATLGMAE+G +TACI+KVFPTRSHTVAAQGGIAASL+
Sbjct: 2   AAYEYETHEYDVVVVGAGGAGLRATLGMAEQGLRTACISKVFPTRSHTVAAQGGIAASLS 61

Query: 69  NMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRP 128
           NM PD+WQWH+YDT+KGSDWLGD DA++YLA EAP++VYELEHYGVPFSR E GKIYQRP
Sbjct: 62  NMGPDNWQWHMYDTVKGSDWLGDTDAMEYLAREAPKAVYELEHYGVPFSRTEEGKIYQRP 121

Query: 129 FGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCC 188
           FGGH   +GEGPPVQRTCAAADRTGHAILHTLYGQ+LK  AEFFIEYFA+DLI++ +G C
Sbjct: 122 FGGHTTEFGEGPPVQRTCAAADRTGHAILHTLYGQSLKQKAEFFIEYFAIDLIMSDDGVC 181

Query: 189 VGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDME 248
            GV+ W+L+ G +H FSAK+VVLATGGYGRAYFSATSAHTCTGDG GM ARAGLPLQDME
Sbjct: 182 QGVLCWKLDDGTMHLFSAKMVVLATGGYGRAYFSATSAHTCTGDGGGMAARAGLPLQDME 241

Query: 249 FVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEI 308
           FVQFHPTGIYGAGCLITEGARGEGGYL NS+GERFMERYAP+ KDLASRDVVSRCM MEI
Sbjct: 242 FVQFHPTGIYGAGCLITEGARGEGGYLTNSEGERFMERYAPTYKDLASRDVVSRCMTMEI 301

Query: 309 REGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMG 368
           REGRGVG++KDHIHL+LNHL P  L  RLPGISESARIFAGVD+T++PIPV+PTVHYNMG
Sbjct: 302 REGRGVGENKDHIHLHLNHLPPETLDLRLPGISESARIFAGVDLTKEPIPVLPTVHYNMG 361

Query: 369 GIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIR 428
           GIPTNYWGEVL+  + NP+  APGLMA+GEAGCASVHGANRLGSNSLIDLVVFGRAA IR
Sbjct: 362 GIPTNYWGEVLNPTADNPDAIAPGLMAVGEAGCASVHGANRLGSNSLIDLVVFGRAAAIR 421

Query: 429 ASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQD 488
           A++++D  + +P+ + +S  +  DRFD LRHA G  PTA LR +MQ+ MQ DA VFRT  
Sbjct: 422 AAKIVDPETAVPTANPASVAKAFDRFDGLRHAKGGTPTAELRLEMQKTMQADAAVFRTDK 481

Query: 489 SLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRG 548
           +L +G   +  +  ++ DL V DRSL+WNSDL+ETLEL NLM NA AT+ +A ARKESRG
Sbjct: 482 TLEEGREKMIEVAGKLNDLHVTDRSLVWNSDLMETLELTNLMPNATATITAAAARKESRG 541

Query: 549 SHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLC----GGVDYSKI 604
           +HA ED+ D     R+D  WRKHSL W + N    KL YR VH + L     GG+D  KI
Sbjct: 542 AHAHEDYPD-----RNDDEWRKHSLAWFEGNDA--KLTYRAVHLDPLTKEDEGGIDMKKI 594

Query: 605 APKARVY 611
           APKARVY
Sbjct: 595 APKARVY 601


>gi|126730327|ref|ZP_01746138.1| succinate dehydrogenase [Sagittula stellata E-37]
 gi|126709060|gb|EBA08115.1| succinate dehydrogenase [Sagittula stellata E-37]
          Length = 600

 Score =  873 bits (2256), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 428/607 (70%), Positives = 492/607 (81%), Gaps = 12/607 (1%)

Query: 9   SSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLA 68
           ++Y Y  H YDVVVVGAGGAGLRATLGMAE+G KTAC+TKVFPTRSHTVAAQGGIAASL+
Sbjct: 2   AAYEYETHDYDVVVVGAGGAGLRATLGMAEQGLKTACVTKVFPTRSHTVAAQGGIAASLS 61

Query: 69  NMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRP 128
           NM PD+WQWH+YDT+KGSDWLGD DA++YLA EAP++VYELEHYGVPFSR E GKIYQRP
Sbjct: 62  NMGPDNWQWHMYDTVKGSDWLGDTDAMEYLAREAPKAVYELEHYGVPFSRTEEGKIYQRP 121

Query: 129 FGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCC 188
           FGGH   +GEGPPVQRTCAAADRTGHAILHTLYGQ+LK +AEF++EYFA+DL++  +G C
Sbjct: 122 FGGHTTEFGEGPPVQRTCAAADRTGHAILHTLYGQSLKESAEFYVEYFAIDLLME-DGVC 180

Query: 189 VGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDME 248
            GV+ W+L+ G  H F+AK+VVLATGGYGRAYFSATSAHTCTGDG GMVARAGL LQDME
Sbjct: 181 KGVLTWKLDDGTFHVFNAKMVVLATGGYGRAYFSATSAHTCTGDGGGMVARAGLALQDME 240

Query: 249 FVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEI 308
           FVQFHPTGIYG+GCLITEGARGEGGYL NS+GERFMERYAP+ KDLA RD VSR M MEI
Sbjct: 241 FVQFHPTGIYGSGCLITEGARGEGGYLTNSEGERFMERYAPTYKDLAPRDYVSRSMTMEI 300

Query: 309 REGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMG 368
           REGRGVGK  DHIHL L+HL    L ERLPGISESA+IFAGVDVT++PIPV+PTVHYNMG
Sbjct: 301 REGRGVGKDGDHIHLNLSHLPAEALAERLPGISESAKIFAGVDVTKEPIPVLPTVHYNMG 360

Query: 369 GIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIR 428
           GIPTNYWGEVL+    NP    PGLMA+GEAGCASVHGANRLGSNSLIDLVVFGRAA IR
Sbjct: 361 GIPTNYWGEVLNPTEDNPTAVVPGLMAVGEAGCASVHGANRLGSNSLIDLVVFGRAAAIR 420

Query: 429 ASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQD 488
           A +++D+ S IP+   +  D+  DRFD LR+A G  PTA LR +MQ+ MQ DA VFRT  
Sbjct: 421 AGKVVDRDSAIPTAPKAQIDKAFDRFDGLRYAQGGTPTAELRLEMQKTMQADAAVFRTSK 480

Query: 489 SLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRG 548
           +L DG   ++ +  ++ DL+V D SLIWNSDL+ETLEL NLM NA+AT+  AEARKESRG
Sbjct: 481 TLEDGVEKMTAIAGKIDDLRVTDTSLIWNSDLMETLELTNLMPNALATIVGAEARKESRG 540

Query: 549 SHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLC----GGVDYSKI 604
           +HA EDF +     RDD  WR H++  V  N   + L YRPV  + L     GG+    I
Sbjct: 541 AHAHEDFTE-----RDDDKWRVHTVARVSGNA--VDLSYRPVIVDPLTTEDEGGISLKTI 593

Query: 605 APKARVY 611
           APKAR +
Sbjct: 594 APKARTF 600


>gi|254460460|ref|ZP_05073876.1| succinate dehydrogenase, flavoprotein subunit [Rhodobacterales
           bacterium HTCC2083]
 gi|206677049|gb|EDZ41536.1| succinate dehydrogenase, flavoprotein subunit [Rhodobacteraceae
           bacterium HTCC2083]
          Length = 601

 Score =  872 bits (2252), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 428/607 (70%), Positives = 496/607 (81%), Gaps = 11/607 (1%)

Query: 9   SSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLA 68
           ++Y Y  H YDVVVVGAGGAGLRATLGMAE+G +TAC+TKVFPTRSHTVAAQGGIAASL+
Sbjct: 2   AAYEYETHDYDVVVVGAGGAGLRATLGMAEQGLRTACVTKVFPTRSHTVAAQGGIAASLS 61

Query: 69  NMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRP 128
           NM PD+WQWH+YDT+KGSDWLGD DA++YLA EAP++VYELEHYGVPFSR E GKIYQRP
Sbjct: 62  NMGPDNWQWHMYDTVKGSDWLGDTDAMEYLAREAPKAVYELEHYGVPFSRTEEGKIYQRP 121

Query: 129 FGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCC 188
           FGGH   +GEGPPVQRTCAAADRTGHAILHTLYGQ+LKNNAEF+IEYFA+DLI++ +G C
Sbjct: 122 FGGHTTEFGEGPPVQRTCAAADRTGHAILHTLYGQSLKNNAEFYIEYFAIDLIMSEDGQC 181

Query: 189 VGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDME 248
            GVV W+L+ G +H F+AK+VVLATGGYGRAYFSATSAHTCTGDG GMVAR GL LQDME
Sbjct: 182 QGVVCWKLDDGTMHVFNAKMVVLATGGYGRAYFSATSAHTCTGDGGGMVARQGLALQDME 241

Query: 249 FVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEI 308
           FVQFHPTGIYG+GCLITEGARGEGGYL NSKGERFMERYAP+ KDLA RD VSRCM MEI
Sbjct: 242 FVQFHPTGIYGSGCLITEGARGEGGYLTNSKGERFMERYAPNYKDLAPRDYVSRCMTMEI 301

Query: 309 REGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMG 368
           REGRGVG   DHIHL L+HL    L ERLPGISESA+IFAGV+V ++PIPV+PTVHYNMG
Sbjct: 302 REGRGVGAGGDHIHLNLSHLPADALAERLPGISESAKIFAGVNVNKEPIPVLPTVHYNMG 361

Query: 369 GIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIR 428
           GIPTNY+GEVL+  +K+P    PGLMA+GEAGCASVHGANRLGSNSLIDLVVFGRAA IR
Sbjct: 362 GIPTNYFGEVLNPTAKDPNAVVPGLMAVGEAGCASVHGANRLGSNSLIDLVVFGRAAAIR 421

Query: 429 ASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQD 488
           A +++D  +   +L+ +S D   DRFD LR+A G  PTA LR +MQ+ MQ DA VFRT  
Sbjct: 422 AGKVVDAEAVPAALNQASVDFAFDRFDGLRNASGATPTAELRLEMQKTMQEDAAVFRTDK 481

Query: 489 SLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRG 548
           +L +G   ++ +  ++ DLKV DRSL+WNSDL+ETLEL NLM NA+AT+  AEARKESRG
Sbjct: 482 TLKEGVEKMTNVASKVDDLKVTDRSLVWNSDLMETLELTNLMPNALATIVGAEARKESRG 541

Query: 549 SHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLC----GGVDYSKI 604
           +HA ED+       RDD NWR H++  VD     + L +RPV T+ L     GG+   KI
Sbjct: 542 AHAHEDYAT-----RDDENWRVHTISRVDGK--NVALSHRPVVTDPLTTEADGGISLKKI 594

Query: 605 APKARVY 611
           APK R +
Sbjct: 595 APKERTF 601


>gi|254452086|ref|ZP_05065523.1| succinate dehydrogenase, flavoprotein subunit [Octadecabacter
           antarcticus 238]
 gi|198266492|gb|EDY90762.1| succinate dehydrogenase, flavoprotein subunit [Octadecabacter
           antarcticus 238]
          Length = 601

 Score =  870 bits (2247), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 429/607 (70%), Positives = 491/607 (80%), Gaps = 11/607 (1%)

Query: 9   SSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLA 68
           + Y Y  H YDVVVVGAGGAGLRATLGMAE+G +TACI+KVFPTRSHTVAAQGGIAASL 
Sbjct: 2   AEYEYETHEYDVVVVGAGGAGLRATLGMAEQGLRTACISKVFPTRSHTVAAQGGIAASLG 61

Query: 69  NMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRP 128
           NM PDSWQWH+YDT+KGSDWLGD DA++YLA EAP++VYELEHYGVPFSR E GKIYQRP
Sbjct: 62  NMGPDSWQWHMYDTVKGSDWLGDTDAMEYLAREAPKAVYELEHYGVPFSRTEEGKIYQRP 121

Query: 129 FGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCC 188
           FGGH   +GEGP VQRTCAAADRTGHAILHTLYGQ+LK  AEF+IEYFA+DLI++ +G C
Sbjct: 122 FGGHTTEFGEGPAVQRTCAAADRTGHAILHTLYGQSLKQKAEFYIEYFAIDLIMSDDGVC 181

Query: 189 VGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDME 248
            GVV W+L+ G +H F+AK+VVLATGGYGRAYFSATSAHTCTGDG GMVARAGL LQDME
Sbjct: 182 TGVVCWKLDDGTMHVFNAKMVVLATGGYGRAYFSATSAHTCTGDGGGMVARAGLALQDME 241

Query: 249 FVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEI 308
           FVQFHPTGIYG+GCLITEGARGEGGYL NS+GERFMERYAP+ KDLA RD VSRCM MEI
Sbjct: 242 FVQFHPTGIYGSGCLITEGARGEGGYLTNSEGERFMERYAPNYKDLAPRDYVSRCMTMEI 301

Query: 309 REGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMG 368
           REGRGVG  KDHIHL LNHL  A L ERLPGISESA+IFAGVDV ++PIPV+PTVHYNMG
Sbjct: 302 REGRGVGDGKDHIHLNLNHLPAAALAERLPGISESAKIFAGVDVNKEPIPVLPTVHYNMG 361

Query: 369 GIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIR 428
           GIPTNY+GEVL     NP    PGLMA+GEAGCASVHGANRLGSNSLIDLVVFGRAA IR
Sbjct: 362 GIPTNYFGEVLHPTKDNPNAVVPGLMAVGEAGCASVHGANRLGSNSLIDLVVFGRAAAIR 421

Query: 429 ASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQD 488
           A  ++D+ + IP     S D+  DRFD LR+A+G   TA LR +MQ+AMQ DA VFRT  
Sbjct: 422 AGTVVDRDAAIPVTHKPSVDKAFDRFDGLRNANGGTGTAELRLEMQKAMQEDAAVFRTDK 481

Query: 489 SLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRG 548
           +L +G + ++ +  +M DL V DRSLIWN+DL+ETLEL NLM NA+AT+  AEARKESRG
Sbjct: 482 TLKEGVKKMTDIATKMGDLHVTDRSLIWNTDLMETLELSNLMPNALATIVGAEARKESRG 541

Query: 549 SHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLC----GGVDYSKI 604
           +HA ED+       RDD  WR H++  VD    K+ L +RPV T+ L     GG++  + 
Sbjct: 542 AHAHEDYAT-----RDDEYWRVHTISHVD--GAKVTLSHRPVITKPLTTEKEGGINLKQF 594

Query: 605 APKARVY 611
           APK R +
Sbjct: 595 APKERTF 601


>gi|154251888|ref|YP_001412712.1| succinate dehydrogenase flavoprotein subunit [Parvibaculum
           lavamentivorans DS-1]
 gi|154155838|gb|ABS63055.1| succinate dehydrogenase, flavoprotein subunit [Parvibaculum
           lavamentivorans DS-1]
          Length = 597

 Score =  867 bits (2240), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 426/605 (70%), Positives = 495/605 (81%), Gaps = 8/605 (1%)

Query: 7   LKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAAS 66
           + +SY ++DH++DVVVVGAGGAGLRATLG  EKG +TA ITKVFPTRSHTVAAQGGI+AS
Sbjct: 1   MTASYQFIDHTFDVVVVGAGGAGLRATLGCVEKGLRTANITKVFPTRSHTVAAQGGISAS 60

Query: 67  LANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQ 126
           L NM PD W+WH+YDT+KGSDWLGD DAI+YL  +AP++VYELEH+GVPFSR E GKIYQ
Sbjct: 61  LGNMGPDDWRWHMYDTVKGSDWLGDQDAIEYLCRQAPEAVYELEHFGVPFSRTEEGKIYQ 120

Query: 127 RPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEG 186
           RPFGG   N+GEG   QRTCAAADRTGHAILHTLYGQ++++ AEF+IEYFA+DLI+++EG
Sbjct: 121 RPFGGMTTNFGEGI-AQRTCAAADRTGHAILHTLYGQSVRHKAEFYIEYFAIDLIMDAEG 179

Query: 187 CCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQD 246
            C GVVA  + TGEIHRF A LVVLATGGYGRAYFSATSAHTCTGDG  MV RAGLPLQD
Sbjct: 180 ACRGVVALDMATGEIHRFRASLVVLATGGYGRAYFSATSAHTCTGDGNAMVLRAGLPLQD 239

Query: 247 MEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMM 306
           MEFVQFHPTGIYGAGCLITEGARGEGGYL NS+GERFMERYAPSAKDLASRDVVSR M +
Sbjct: 240 MEFVQFHPTGIYGAGCLITEGARGEGGYLTNSEGERFMERYAPSAKDLASRDVVSRSMTV 299

Query: 307 EIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYN 366
           EIREGRGVG  KDHIHL+L+HLDPA+L ERLPGISESARIFAGVDVT++PIPV+PTVHYN
Sbjct: 300 EIREGRGVGAEKDHIHLHLDHLDPAILHERLPGISESARIFAGVDVTKEPIPVLPTVHYN 359

Query: 367 MGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAV 426
           MGGIPTN+ GEVL   + NP+   PGLMAIGEA C SVHGANRLGSNSLIDLVVFGRAA 
Sbjct: 360 MGGIPTNFHGEVLTLKNGNPDTVVPGLMAIGEAACVSVHGANRLGSNSLIDLVVFGRAAG 419

Query: 427 IRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRT 486
           +RA+E+++     P L   + D  + R D+ R+A G  PT+ LR +MQRAMQ D  VFRT
Sbjct: 420 LRAAELVEPGQRQPELAKGAGDNAVARLDKYRNAKGDTPTSELRLRMQRAMQEDVAVFRT 479

Query: 487 QDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKES 546
            ++L  G + ++ +   + D++V DRSLIWNSDL+ETLE  NL++ A+ATV  A  R+ES
Sbjct: 480 GETLVSGQKRVADVHAAIPDIRVSDRSLIWNSDLIETLEFDNLIVQAVATVEGAVNRQES 539

Query: 547 RGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAP 606
           RG+HAREDF +     RDD NW KH+LCWVD  +GK  LDYRPVH   L   ++Y  I P
Sbjct: 540 RGAHAREDFPE-----RDDANWMKHTLCWVDDQSGKASLDYRPVHAYTLSNDIEY--IKP 592

Query: 607 KARVY 611
           KARVY
Sbjct: 593 KARVY 597


>gi|154245908|ref|YP_001416866.1| succinate dehydrogenase flavoprotein subunit [Xanthobacter
           autotrophicus Py2]
 gi|154159993|gb|ABS67209.1| succinate dehydrogenase, flavoprotein subunit [Xanthobacter
           autotrophicus Py2]
          Length = 611

 Score =  864 bits (2232), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 419/603 (69%), Positives = 484/603 (80%), Gaps = 8/603 (1%)

Query: 9   SSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLA 68
           ++Y   DH+YDV+VVGAGGAGLRA +G +E G +TACITKVFPTRSHTVAAQGG+AASLA
Sbjct: 17  AAYPIEDHTYDVLVVGAGGAGLRAVVGCSEAGLRTACITKVFPTRSHTVAAQGGVAASLA 76

Query: 69  NMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRP 128
           NM  D W+WH+YDT+KGSDWLGD DAI+Y+   AP +VYELEH+GVPFSR E GKIYQRP
Sbjct: 77  NMGEDKWEWHMYDTVKGSDWLGDQDAIEYMVRNAPAAVYELEHWGVPFSRTEDGKIYQRP 136

Query: 129 FGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCC 188
           FGG   +YG+G   QRTCAAADRTGHA+LHTLYG ALK++AEFF+EYFA+DLI++ +G C
Sbjct: 137 FGGMTTHYGKGT-AQRTCAAADRTGHAMLHTLYGAALKHHAEFFVEYFAIDLIMDEDGRC 195

Query: 189 VGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDME 248
            GV+A +L+ G IHRF A LVVLATGGYGRAYFSATSAHTCTGDG GMV RAGLPLQDME
Sbjct: 196 RGVIAIKLDDGTIHRFRAHLVVLATGGYGRAYFSATSAHTCTGDGGGMVLRAGLPLQDME 255

Query: 249 FVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEI 308
           FVQFHPTGIYG+GCLITEGARGEGGYL NS GERFMERYAPSAKDLASRDVVSR M MEI
Sbjct: 256 FVQFHPTGIYGSGCLITEGARGEGGYLTNSAGERFMERYAPSAKDLASRDVVSRSMTMEI 315

Query: 309 REGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMG 368
           REGRGVGK+KDHI L+L+HLDPA+L ERLPGISESA+IFAGVD+TR+PIPVIPTVHYNMG
Sbjct: 316 REGRGVGKNKDHIFLHLDHLDPAILHERLPGISESAKIFAGVDLTREPIPVIPTVHYNMG 375

Query: 369 GIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIR 428
           GIPTNY+GEVLD  S +P+   PGLMAIGEA C SVHGANRLGSNSLIDLVVFGRAA +R
Sbjct: 376 GIPTNYYGEVLDKRSGDPDTVVPGLMAIGEAACVSVHGANRLGSNSLIDLVVFGRAAGLR 435

Query: 429 ASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQD 488
           A+E++        L   S D  + R D  R+A G  PTA LR  MQ+ MQ +  VFRT +
Sbjct: 436 AAELVKPGEKHRELPAGSADLALSRLDAARYASGGTPTAELRLAMQKVMQSNCAVFRTGE 495

Query: 489 SLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRG 548
            L +GC+ +  ++   +D+ V DRSL+WNSDL+ETLE +NL+  AI T+  A ARKESRG
Sbjct: 496 VLEEGCKLIHDVYKGASDIGVTDRSLVWNSDLIETLEFENLIAQAIVTMEGASARKESRG 555

Query: 549 SHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPKA 608
            HAREDF D     RDDVNW KH+L + D  TG ++LD RPVHT  L   + Y  I PK 
Sbjct: 556 GHAREDFPD-----RDDVNWMKHTLAYFDTATGNVRLDDRPVHTYTLSNDIQY--IEPKK 608

Query: 609 RVY 611
           RVY
Sbjct: 609 RVY 611


>gi|23011974|ref|ZP_00052177.1| COG1053: Succinate dehydrogenase/fumarate reductase, flavoprotein
           subunit [Magnetospirillum magnetotacticum MS-1]
          Length = 605

 Score =  862 bits (2228), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 412/602 (68%), Positives = 486/602 (80%), Gaps = 8/602 (1%)

Query: 10  SYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLAN 69
           +Y   DH++DVV+VGAGGAGLRAT+G ++ G +TACITKVFPTRSHTVAAQGGI+ASL N
Sbjct: 12  AYAITDHTFDVVIVGAGGAGLRATVGCSQAGLRTACITKVFPTRSHTVAAQGGISASLGN 71

Query: 70  MTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRPF 129
           M PD W+WH+YDT+KGSDWLGD DAI+YL   AP +VYELEH+GVPFSR E GKIYQRPF
Sbjct: 72  MGPDDWRWHMYDTVKGSDWLGDQDAIEYLVRNAPAAVYELEHWGVPFSRTEEGKIYQRPF 131

Query: 130 GGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCCV 189
           GG   +YG+G   QRTCAAADRTGHA+LHTLYGQA+KN  +FFIEYFALDLI++ EG C 
Sbjct: 132 GGMTTDYGKGT-AQRTCAAADRTGHAMLHTLYGQAVKNKTQFFIEYFALDLIMDEEGRCR 190

Query: 190 GVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDMEF 249
           GV+A    TGEIHRF A+  +LATGGYGRAYFSATSAHTCTGDG  MV RAGLPLQDMEF
Sbjct: 191 GVIAIDQATGEIHRFRAQQTILATGGYGRAYFSATSAHTCTGDGNAMVLRAGLPLQDMEF 250

Query: 250 VQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEIR 309
           VQFHPTGIYGAGCLITEGARGEGGYL NS+GERFMERYAPSAKDLASRDVVSR M MEIR
Sbjct: 251 VQFHPTGIYGAGCLITEGARGEGGYLTNSEGERFMERYAPSAKDLASRDVVSRSMTMEIR 310

Query: 310 EGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMGG 369
           +GRGVGK+KDHI L+L+HLDP +L ERLPGISESA+IFAGVDVT++PIPV+PTVHYNMGG
Sbjct: 311 DGRGVGKNKDHIFLHLDHLDPKILHERLPGISESAKIFAGVDVTKEPIPVLPTVHYNMGG 370

Query: 370 IPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIRA 429
           IPTNY GEVL   + +P+   PGLMA+GEA C SVHGANRLGSNSLIDLVVFGRAA +R 
Sbjct: 371 IPTNYHGEVLTLKNGDPDTVVPGLMALGEAACVSVHGANRLGSNSLIDLVVFGRAAGLRC 430

Query: 430 SEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQDS 489
           +E+++ ++  P L   S ++ + R DR R+ADG  PTA LR++MQR MQ +  VFRT + 
Sbjct: 431 AEIVEPNARQPELPKDSAEKALSRLDRFRYADGGTPTAQLRDRMQRTMQNNCAVFRTGEV 490

Query: 490 LSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRGS 549
           L +G   +  +W  +AD+KV DRSL+WN+DL+ETLE  NL+  A+ T+ SA  RKESRG+
Sbjct: 491 LEEGKGLIHDVWRGVADIKVSDRSLVWNTDLLETLEFDNLIGQAVVTMESAVNRKESRGA 550

Query: 550 HAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPKAR 609
           HAREDF D     RDD  W KH+L W+D +   +++DYRPVHT  +   + Y  I PKAR
Sbjct: 551 HAREDFPD-----RDDKEWMKHTLAWLDQSKHGVEIDYRPVHTYTMSNEIQY--IEPKAR 603

Query: 610 VY 611
           VY
Sbjct: 604 VY 605


>gi|170746893|ref|YP_001753153.1| succinate dehydrogenase flavoprotein subunit [Methylobacterium
           radiotolerans JCM 2831]
 gi|170653415|gb|ACB22470.1| succinate dehydrogenase, flavoprotein subunit [Methylobacterium
           radiotolerans JCM 2831]
          Length = 605

 Score =  860 bits (2223), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 413/602 (68%), Positives = 485/602 (80%), Gaps = 8/602 (1%)

Query: 10  SYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLAN 69
           +YT  DH++DVV+VGAGGAGLRAT+G +E G +TACITKVFPTRSHTVAAQGGI+ASL N
Sbjct: 12  AYTIHDHAFDVVIVGAGGAGLRATVGCSEAGLRTACITKVFPTRSHTVAAQGGISASLGN 71

Query: 70  MTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRPF 129
           M PD W+WH+YDT+KGSDWLGD DAI+YL   AP +VYELEH+GVPFSR E GKIYQRPF
Sbjct: 72  MGPDDWRWHMYDTVKGSDWLGDQDAIEYLVRNAPAAVYELEHWGVPFSRTEEGKIYQRPF 131

Query: 130 GGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCCV 189
           GG   +YG+G   QRTCAAADRTGHA+LHTLYGQA+KN  +FFIEYFALDLI++ EG C 
Sbjct: 132 GGMTTDYGKGT-AQRTCAAADRTGHAMLHTLYGQAVKNQTDFFIEYFALDLIMDDEGRCR 190

Query: 190 GVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDMEF 249
           GV+A    TGEIHRF A++ +LATGGYGRAYFSATSAHTCTGDG  MV RAGLPLQDMEF
Sbjct: 191 GVIALDQATGEIHRFRAQMTILATGGYGRAYFSATSAHTCTGDGNAMVLRAGLPLQDMEF 250

Query: 250 VQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEIR 309
           VQFHPTGIYGAGCLITEG+RGEGGYL NS+GERFMERYAPSAKDLASRDVVSR M MEIR
Sbjct: 251 VQFHPTGIYGAGCLITEGSRGEGGYLTNSEGERFMERYAPSAKDLASRDVVSRSMTMEIR 310

Query: 310 EGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMGG 369
           +GRGVGK+KDHI+L+L+HLDP +L ERLPGISESARIFAGVDVT++PIPVIPTVHYNMGG
Sbjct: 311 DGRGVGKNKDHIYLHLDHLDPKILHERLPGISESARIFAGVDVTKEPIPVIPTVHYNMGG 370

Query: 370 IPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIRA 429
           IPTNY GEVL     NP+   PGLMAIGEA C SVHGANRLGSNSLIDLVVFGRAA  R 
Sbjct: 371 IPTNYHGEVLTLRDGNPDTVVPGLMAIGEAACVSVHGANRLGSNSLIDLVVFGRAAGKRC 430

Query: 430 SEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQDS 489
           +E+++ +     L   + D+ ++R DR R+A+G  PTA LR +MQ+ MQ +  VFRT + 
Sbjct: 431 AEIVEPNGRAMELPKGATDKALERLDRFRYANGSTPTAELRAEMQKTMQNNCAVFRTGEV 490

Query: 490 LSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRGS 549
           L +G   +  +W+  AD+KV DRSL+WN+DL+ETLE  NL+  A+ T+ SA  R ESRG+
Sbjct: 491 LEEGKGLIHKVWNAAADVKVTDRSLVWNTDLLETLEFDNLIGQAVVTMESAANRTESRGA 550

Query: 550 HAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPKAR 609
           HAREDF D     RDD +W KH+L W+D +  ++ +DYRPVHT  +   + Y  I PKAR
Sbjct: 551 HAREDFPD-----RDDKDWMKHTLSWLDESRHQVNIDYRPVHTYTMSNEIQY--IEPKAR 603

Query: 610 VY 611
           VY
Sbjct: 604 VY 605


>gi|188583474|ref|YP_001926919.1| succinate dehydrogenase flavoprotein subunit [Methylobacterium
           populi BJ001]
 gi|179346972|gb|ACB82384.1| succinate dehydrogenase, flavoprotein subunit [Methylobacterium
           populi BJ001]
          Length = 605

 Score =  855 bits (2208), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 410/612 (66%), Positives = 488/612 (79%), Gaps = 9/612 (1%)

Query: 1   MKNSSNLKS-SYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAA 59
           + N SN  + +Y   DH++DVV+VGAGGAGLRAT+G ++ G +TACITKVFPTRSHTVAA
Sbjct: 2   VSNGSNGGTPAYAITDHTFDVVIVGAGGAGLRATVGCSQAGLRTACITKVFPTRSHTVAA 61

Query: 60  QGGIAASLANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRN 119
           QGGI+ASL NM PD W+WH+YDT+KGSDWLGD DAI+YL   AP +VYELEH+GVPFSR 
Sbjct: 62  QGGISASLGNMGPDDWRWHMYDTVKGSDWLGDQDAIEYLVRNAPAAVYELEHWGVPFSRT 121

Query: 120 EAGKIYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALD 179
           E GKIYQRPFGG   +YG+G   QRTCAAADRTGHA+LHTLYGQA+KN  +FFIEYFALD
Sbjct: 122 EEGKIYQRPFGGMTTDYGKGT-AQRTCAAADRTGHAMLHTLYGQAVKNKTQFFIEYFALD 180

Query: 180 LIINSEGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVAR 239
           LI++ +G C GV+A    TGEIHRF A+  +LATGGYGRAYFSATSAHTCTGDG  MV R
Sbjct: 181 LIMDEDGRCRGVIAIDQATGEIHRFRAQQTILATGGYGRAYFSATSAHTCTGDGNAMVLR 240

Query: 240 AGLPLQDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDV 299
           AGLPLQDMEFVQFHPTGIYGAGCLITEGARGEGGYL NS+GERFMERYAPSAKDLASRDV
Sbjct: 241 AGLPLQDMEFVQFHPTGIYGAGCLITEGARGEGGYLTNSEGERFMERYAPSAKDLASRDV 300

Query: 300 VSRCMMMEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPV 359
           VSR M MEIR+GRGVGK  DHI L+L+HLDP +L ERLPGISESA+IFAGVDVT++PIPV
Sbjct: 301 VSRSMTMEIRDGRGVGKDGDHIFLHLDHLDPKILHERLPGISESAKIFAGVDVTKEPIPV 360

Query: 360 IPTVHYNMGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLV 419
           +PTVHYNMGGIPTN+ GEVL   + +P+   PGLMA+GEA C SVHGANRLGSNSLIDLV
Sbjct: 361 LPTVHYNMGGIPTNFHGEVLTLKNGDPDTVVPGLMALGEAACVSVHGANRLGSNSLIDLV 420

Query: 420 VFGRAAVIRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQL 479
           VFGRAA +R +++++  +  P L   S D+ + R DR R+ADG  PTA LR++MQR MQ 
Sbjct: 421 VFGRAAGLRCADIVEADARQPELPKDSADKALARLDRFRYADGATPTAQLRDRMQRTMQN 480

Query: 480 DAGVFRTQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYS 539
           +  VFRT + L +G   +  +W  ++D+K+ DRSL+WN+DL+ETLE  NL+  A+ T+ S
Sbjct: 481 NCAVFRTGEVLEEGKGLIHDVWRGVSDIKITDRSLVWNTDLLETLEFDNLIGQAVVTMES 540

Query: 540 AEARKESRGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGV 599
           A  RKESRG+HAREDF D     RDD  W KH+L W+D +   +++DYRPVHT  +   +
Sbjct: 541 AVNRKESRGAHAREDFPD-----RDDKEWMKHTLAWLDQSKHGVEIDYRPVHTYTMSNDI 595

Query: 600 DYSKIAPKARVY 611
            Y  I PKARVY
Sbjct: 596 QY--IEPKARVY 605


>gi|254510096|ref|ZP_05122163.1| succinate dehydrogenase, flavoprotein subunit [Rhodobacteraceae
           bacterium KLH11]
 gi|221533807|gb|EEE36795.1| succinate dehydrogenase, flavoprotein subunit [Rhodobacteraceae
           bacterium KLH11]
          Length = 606

 Score =  853 bits (2204), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 429/610 (70%), Positives = 495/610 (81%), Gaps = 12/610 (1%)

Query: 9   SSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLA 68
           ++Y Y  H YDVVVVGAGGAGLRATLGMAE+G +TAC+TKVFPTRSHTVAAQGGIAASL+
Sbjct: 2   AAYEYETHEYDVVVVGAGGAGLRATLGMAEQGLRTACVTKVFPTRSHTVAAQGGIAASLS 61

Query: 69  NMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRP 128
           NM PD WQWH+YDT+KGSDWLGD DA++YLA EAP++VYELEHYGVPFSR E GKIYQRP
Sbjct: 62  NMGPDHWQWHMYDTVKGSDWLGDTDAMEYLAREAPKAVYELEHYGVPFSRTEEGKIYQRP 121

Query: 129 FGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCC 188
           FGGH   +GEGP VQRTCAAADRTGHAILHTLYGQ+LKNNAEF+IEYFA+DLI++ +G C
Sbjct: 122 FGGHTTEFGEGPAVQRTCAAADRTGHAILHTLYGQSLKNNAEFYIEYFAIDLIMSEDGQC 181

Query: 189 VGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDME 248
            GVV W+L+ G +H F+AK+VVLATGGYGRAYFSATSAHTCTGDG GMVARAGL LQDME
Sbjct: 182 QGVVCWKLDDGTMHVFNAKMVVLATGGYGRAYFSATSAHTCTGDGGGMVARAGLALQDME 241

Query: 249 FVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEI 308
           FVQFHPTGIYG+GCLITEGARGEGGYL N++GERFMERYAP  KDLA RD VSR M MEI
Sbjct: 242 FVQFHPTGIYGSGCLITEGARGEGGYLTNAEGERFMERYAPQYKDLAPRDYVSRSMTMEI 301

Query: 309 REGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMG 368
           REGRGVG   DHIHL L+HL    L ERLPGISESA+IFAGVDVT++PIPV+PTVHYNMG
Sbjct: 302 REGRGVGGEGDHIHLNLSHLPAEALHERLPGISESAKIFAGVDVTKEPIPVLPTVHYNMG 361

Query: 369 GIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIR 428
           GIPTNYWG+VLD  +++P R  PGLMA+GEAGCASVHGANRLGSNSLIDLVVFGRAA I+
Sbjct: 362 GIPTNYWGQVLDPTAEDPNRVVPGLMAVGEAGCASVHGANRLGSNSLIDLVVFGRAAAIK 421

Query: 429 ASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQD 488
           A ++++   P P L+ +S D   +RFD LR+A G+V TA LR +MQ+ MQ DA VFRT  
Sbjct: 422 AGKVVNPDEPNPVLNQASVDAAFERFDSLRYAKGNVATAELRLEMQKTMQRDAAVFRTAK 481

Query: 489 SLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRG 548
           +L++G   ++ +  ++ DL+V DRSLIWNSDL+ETLEL NLM NA+AT+  AEARKESRG
Sbjct: 482 TLAEGVEAMTEIAGKLDDLQVTDRSLIWNSDLMETLELTNLMPNALATIVGAEARKESRG 541

Query: 549 SHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGK---IKLDYRPVHTELLC----GGVDY 601
           +HA ED        RDD  WR H+L     NT     I L YRPV  + L     GG+  
Sbjct: 542 AHAHEDHPT-----RDDEKWRVHTLARAHGNTVNTIHINLSYRPVIVDPLSTEDEGGISL 596

Query: 602 SKIAPKARVY 611
            KIAPKAR +
Sbjct: 597 KKIAPKARTF 606


>gi|240140349|ref|YP_002964828.1| succinate dehydrogenase, flavoprotein subunit [Methylobacterium
           extorquens AM1]
 gi|27902658|gb|AAO24621.1| succinate dehydrogenase alpha subunit [Methylobacterium extorquens]
 gi|240010325|gb|ACS41551.1| succinate dehydrogenase, flavoprotein subunit [Methylobacterium
           extorquens AM1]
          Length = 605

 Score =  852 bits (2202), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 406/602 (67%), Positives = 483/602 (80%), Gaps = 8/602 (1%)

Query: 10  SYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLAN 69
           +Y  +DH++DVV+VGAGGAGLRAT+G ++ G +TACITKVFPTRSHTVAAQGGI+ASL N
Sbjct: 12  AYAIIDHTFDVVIVGAGGAGLRATVGCSQAGLRTACITKVFPTRSHTVAAQGGISASLGN 71

Query: 70  MTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRPF 129
           M PD W+WH+YDT+KGSDWLGD DAI+YL   AP +VYELEH+GVPFSR + GKIYQRPF
Sbjct: 72  MGPDDWRWHMYDTVKGSDWLGDQDAIEYLVRNAPAAVYELEHWGVPFSRTDEGKIYQRPF 131

Query: 130 GGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCCV 189
           GG   +YG+G   QRTCAAADRTGHA+LHTLYGQA+KN  +FFIEYFALDLI++ +G C 
Sbjct: 132 GGMTTDYGKGT-AQRTCAAADRTGHAMLHTLYGQAVKNKTQFFIEYFALDLIMDEDGRCR 190

Query: 190 GVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDMEF 249
           GV+A    TGEIHRF A+  +LATGGYGRAYFSATSAHTCTGDG  MV RAGLPLQDMEF
Sbjct: 191 GVLAIDQATGEIHRFRAQQTILATGGYGRAYFSATSAHTCTGDGNAMVLRAGLPLQDMEF 250

Query: 250 VQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEIR 309
           VQFHPTGIYGAGCLITEGARGEGGYL NS+GERFMERYAPSAKDLASRDVVSR M MEIR
Sbjct: 251 VQFHPTGIYGAGCLITEGARGEGGYLTNSEGERFMERYAPSAKDLASRDVVSRSMTMEIR 310

Query: 310 EGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMGG 369
           +GRGVGK  DHI L+L+HLDP +L ERLPGISESA+IFAGVDVT++PIPV+PTVHYNMGG
Sbjct: 311 DGRGVGKEGDHIFLHLDHLDPKILHERLPGISESAKIFAGVDVTKEPIPVLPTVHYNMGG 370

Query: 370 IPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIRA 429
           IPTN+ GEVL   + NP+   PGLMA+GEA C SVHGANRLGSNSLIDLVVFGRAA +R 
Sbjct: 371 IPTNFHGEVLTLKNGNPDTVVPGLMALGEAACVSVHGANRLGSNSLIDLVVFGRAAGLRC 430

Query: 430 SEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQDS 489
           +++++  +  P L   S D+ + R DR R+ADG  PTA LR++MQR MQ +  VFRT + 
Sbjct: 431 ADIVEPDARQPELPKGSADKALTRLDRFRYADGGTPTAQLRDRMQRTMQNNCAVFRTGEV 490

Query: 490 LSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRGS 549
           L +G   +  +W  ++D+ + DRSL+WN+DL+ETLE  NL+  A+ T+ SA  RKESRG+
Sbjct: 491 LEEGKGLIHEVWRGVSDIAITDRSLVWNTDLLETLEFDNLIGQAVVTMESAVNRKESRGA 550

Query: 550 HAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPKAR 609
           HAREDF D     RDD  W KH+L W+D +   +++DYRPVHT  +   + Y  I PKAR
Sbjct: 551 HAREDFPD-----RDDKEWMKHTLAWLDQSKHGVEIDYRPVHTYTMSNDIQY--IEPKAR 603

Query: 610 VY 611
           VY
Sbjct: 604 VY 605


>gi|163853008|ref|YP_001641051.1| succinate dehydrogenase flavoprotein subunit [Methylobacterium
           extorquens PA1]
 gi|163664613|gb|ABY31980.1| succinate dehydrogenase, flavoprotein subunit [Methylobacterium
           extorquens PA1]
          Length = 605

 Score =  852 bits (2200), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 406/602 (67%), Positives = 482/602 (80%), Gaps = 8/602 (1%)

Query: 10  SYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLAN 69
           +Y   DH++DVV+VGAGGAGLRAT+G ++ G +TACITKVFPTRSHTVAAQGGI+ASL N
Sbjct: 12  AYAITDHTFDVVIVGAGGAGLRATVGCSQAGLRTACITKVFPTRSHTVAAQGGISASLGN 71

Query: 70  MTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRPF 129
           M PD W+WH+YDT+KGSDWLGD DAI+YL   AP +VYELEH+GVPFSR + GKIYQRPF
Sbjct: 72  MGPDDWRWHMYDTVKGSDWLGDQDAIEYLVRNAPAAVYELEHWGVPFSRTDEGKIYQRPF 131

Query: 130 GGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCCV 189
           GG   +YG+G   QRTCAAADRTGHA+LHTLYGQA+KN  +FFIEYFALDLI++ +G C 
Sbjct: 132 GGMTTDYGKGT-AQRTCAAADRTGHAMLHTLYGQAVKNKTQFFIEYFALDLIMDEDGRCR 190

Query: 190 GVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDMEF 249
           GV+A    TGEIHRF A+  +LATGGYGRAYFSATSAHTCTGDG  MV RAGLPLQDMEF
Sbjct: 191 GVMAIDQATGEIHRFRAQQTILATGGYGRAYFSATSAHTCTGDGNAMVLRAGLPLQDMEF 250

Query: 250 VQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEIR 309
           VQFHPTGIYGAGCLITEGARGEGGYL NS+GERFMERYAPSAKDLASRDVVSR M MEIR
Sbjct: 251 VQFHPTGIYGAGCLITEGARGEGGYLTNSEGERFMERYAPSAKDLASRDVVSRSMTMEIR 310

Query: 310 EGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMGG 369
           +GRGVGK  DHI L+L+HLDP +L ERLPGISESA+IFAGVDVT++PIPV+PTVHYNMGG
Sbjct: 311 DGRGVGKEGDHIFLHLDHLDPKILHERLPGISESAKIFAGVDVTKEPIPVLPTVHYNMGG 370

Query: 370 IPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIRA 429
           IPTN+ GEVL   + NP+   PGLMA+GEA C SVHGANRLGSNSLIDLVVFGRAA +R 
Sbjct: 371 IPTNFHGEVLTLKNGNPDTVVPGLMALGEAACVSVHGANRLGSNSLIDLVVFGRAAGLRC 430

Query: 430 SEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQDS 489
           +++++  +  P L   S D+ + R DR R+ADG  PTA LR++MQR MQ +  VFRT + 
Sbjct: 431 ADIVEPDARQPELPKGSADKALSRLDRFRYADGGTPTAQLRDRMQRTMQNNCAVFRTGEV 490

Query: 490 LSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRGS 549
           L +G   +  +W  ++D+ + DRSL+WN+DL+ETLE  NL+  A+ T+ SA  RKESRG+
Sbjct: 491 LEEGKGLIHEVWRGVSDIAITDRSLVWNTDLLETLEFDNLIGQAVVTMESAVNRKESRGA 550

Query: 550 HAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPKAR 609
           HAREDF D     RDD  W KH+L W+D +   +++DYRPVHT  +   + Y  I PKAR
Sbjct: 551 HAREDFPD-----RDDKEWMKHTLAWLDQSKHGVEIDYRPVHTYTMSNDIQY--IEPKAR 603

Query: 610 VY 611
           VY
Sbjct: 604 VY 605


>gi|254562944|ref|YP_003070039.1| succinate dehydrogenase, flavoprotein subunit [Methylobacterium
           extorquens DM4]
 gi|254270222|emb|CAX26216.1| succinate dehydrogenase, flavoprotein subunit [Methylobacterium
           extorquens DM4]
          Length = 605

 Score =  851 bits (2199), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 406/602 (67%), Positives = 482/602 (80%), Gaps = 8/602 (1%)

Query: 10  SYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLAN 69
           +Y   DH++DVV+VGAGGAGLRAT+G ++ G +TACITKVFPTRSHTVAAQGGI+ASL N
Sbjct: 12  AYAITDHTFDVVIVGAGGAGLRATVGCSQAGLRTACITKVFPTRSHTVAAQGGISASLGN 71

Query: 70  MTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRPF 129
           M PD W+WH+YDT+KGSDWLGD DAI+YL   AP +VYELEH+GVPFSR + GKIYQRPF
Sbjct: 72  MGPDDWRWHMYDTVKGSDWLGDQDAIEYLVRNAPAAVYELEHWGVPFSRTDEGKIYQRPF 131

Query: 130 GGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCCV 189
           GG   +YG+G   QRTCAAADRTGHA+LHTLYGQA+KN  +FFIEYFALDLI++ +G C 
Sbjct: 132 GGMTTDYGKGT-AQRTCAAADRTGHAMLHTLYGQAVKNKTQFFIEYFALDLIMDEDGRCR 190

Query: 190 GVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDMEF 249
           GV+A    TGEIHRF A+  +LATGGYGRAYFSATSAHTCTGDG  MV RAGLPLQDMEF
Sbjct: 191 GVMAIDQATGEIHRFRAQQTILATGGYGRAYFSATSAHTCTGDGNAMVLRAGLPLQDMEF 250

Query: 250 VQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEIR 309
           VQFHPTGIYGAGCLITEGARGEGGYL NS+GERFMERYAPSAKDLASRDVVSR M MEIR
Sbjct: 251 VQFHPTGIYGAGCLITEGARGEGGYLTNSEGERFMERYAPSAKDLASRDVVSRSMTMEIR 310

Query: 310 EGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMGG 369
           +GRGVGK  DHI L+L+HLDP +L ERLPGISESA+IFAGVDVT++PIPV+PTVHYNMGG
Sbjct: 311 DGRGVGKEGDHIFLHLDHLDPKILHERLPGISESAKIFAGVDVTKEPIPVLPTVHYNMGG 370

Query: 370 IPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIRA 429
           IPTN+ GEVL   + NP+   PGLMA+GEA C SVHGANRLGSNSLIDLVVFGRAA +R 
Sbjct: 371 IPTNFHGEVLTLKNGNPDTVVPGLMALGEAACVSVHGANRLGSNSLIDLVVFGRAAGLRC 430

Query: 430 SEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQDS 489
           +++++  +  P L   S D+ + R DR R+ADG  PTA LR++MQR MQ +  VFRT + 
Sbjct: 431 ADIVEPDARQPELPKGSADKALTRLDRFRYADGGTPTAQLRDRMQRTMQNNCAVFRTGEV 490

Query: 490 LSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRGS 549
           L +G   +  +W  ++D+ + DRSL+WN+DL+ETLE  NL+  A+ T+ SA  RKESRG+
Sbjct: 491 LEEGKGLIHEVWRGVSDIAITDRSLVWNTDLLETLEFDNLIGQAVVTMESAVNRKESRGA 550

Query: 550 HAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPKAR 609
           HAREDF D     RDD  W KH+L W+D +   +++DYRPVHT  +   + Y  I PKAR
Sbjct: 551 HAREDFPD-----RDDKEWMKHTLAWLDQSKHGVEIDYRPVHTYTMSNDIQY--IEPKAR 603

Query: 610 VY 611
           VY
Sbjct: 604 VY 605


>gi|218531818|ref|YP_002422634.1| succinate dehydrogenase flavoprotein subunit [Methylobacterium
           chloromethanicum CM4]
 gi|218524121|gb|ACK84706.1| succinate dehydrogenase, flavoprotein subunit [Methylobacterium
           chloromethanicum CM4]
          Length = 605

 Score =  851 bits (2198), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 406/602 (67%), Positives = 482/602 (80%), Gaps = 8/602 (1%)

Query: 10  SYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLAN 69
           +Y   DH++DVV+VGAGGAGLRAT+G ++ G +TACITKVFPTRSHTVAAQGGI+ASL N
Sbjct: 12  AYAITDHTFDVVIVGAGGAGLRATVGCSQAGLRTACITKVFPTRSHTVAAQGGISASLGN 71

Query: 70  MTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRPF 129
           M PD W+WH+YDT+KGSDWLGD DAI+YL   AP +VYELEH+GVPFSR + GKIYQRPF
Sbjct: 72  MGPDDWRWHMYDTVKGSDWLGDQDAIEYLVRNAPAAVYELEHWGVPFSRTDEGKIYQRPF 131

Query: 130 GGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCCV 189
           GG   +YG+G   QRTCAAADRTGHA+LHTLYGQA+KN  +FFIEYFALDLI++ +G C 
Sbjct: 132 GGMTTDYGKGT-AQRTCAAADRTGHAMLHTLYGQAVKNKTQFFIEYFALDLIMDEDGRCR 190

Query: 190 GVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDMEF 249
           GV+A    TGEIHRF A+  +LATGGYGRAYFSATSAHTCTGDG  MV RAGLPLQDMEF
Sbjct: 191 GVMAIDQATGEIHRFRAQQTILATGGYGRAYFSATSAHTCTGDGNAMVLRAGLPLQDMEF 250

Query: 250 VQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEIR 309
           VQFHPTGIYGAGCLITEGARGEGGYL NS+GERFMERYAPSAKDLASRDVVSR M MEIR
Sbjct: 251 VQFHPTGIYGAGCLITEGARGEGGYLTNSEGERFMERYAPSAKDLASRDVVSRSMTMEIR 310

Query: 310 EGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMGG 369
           +GRGVGK  DHI L+L+HLDP +L ERLPGISESA+IFAGVDVT++PIPV+PTVHYNMGG
Sbjct: 311 DGRGVGKEGDHIFLHLDHLDPKILHERLPGISESAKIFAGVDVTKEPIPVLPTVHYNMGG 370

Query: 370 IPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIRA 429
           IPTN+ GEVL   + NP+   PGLMA+GEA C SVHGANRLGSNSLIDLVVFGRAA +R 
Sbjct: 371 IPTNFHGEVLTLKNGNPDTVVPGLMALGEAACVSVHGANRLGSNSLIDLVVFGRAAGLRC 430

Query: 430 SEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQDS 489
           +++++  +  P L   S D+ + R DR R+ADG  PTA LR++MQR MQ +  VFRT + 
Sbjct: 431 ADIVEPDARQPELPKGSADKALARLDRFRYADGGTPTAQLRDRMQRTMQNNCAVFRTGEV 490

Query: 490 LSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRGS 549
           L +G   +  +W  ++D+ + DRSL+WN+DL+ETLE  NL+  A+ T+ SA  RKESRG+
Sbjct: 491 LEEGKGLIHEVWRGVSDIAITDRSLVWNTDLLETLEFDNLIGQAVVTMESAVNRKESRGA 550

Query: 550 HAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPKAR 609
           HAREDF D     RDD  W KH+L W+D +   +++DYRPVHT  +   + Y  I PKAR
Sbjct: 551 HAREDFPD-----RDDKEWMKHTLAWLDQSKHGVEIDYRPVHTYTMSNDIQY--IEPKAR 603

Query: 610 VY 611
           VY
Sbjct: 604 VY 605


>gi|319786902|ref|YP_004146377.1| succinate dehydrogenase, flavoprotein subunit [Pseudoxanthomonas
           suwonensis 11-1]
 gi|317465414|gb|ADV27146.1| succinate dehydrogenase, flavoprotein subunit [Pseudoxanthomonas
           suwonensis 11-1]
          Length = 597

 Score =  850 bits (2197), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 409/603 (67%), Positives = 471/603 (78%), Gaps = 7/603 (1%)

Query: 9   SSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLA 68
           S+Y   +H YD+VVVGAGGAGLRAT G+A+KG +T C+TKVFPTRSHTVAAQGGI+A+LA
Sbjct: 2   SAYKITEHKYDMVVVGAGGAGLRATFGLAQKGLQTVCLTKVFPTRSHTVAAQGGISAALA 61

Query: 69  NMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRP 128
           NM  D W++H YDTIKGSDWLGD DAI+Y+  EA  ++ ELEHYGVPFSR E GKIYQRP
Sbjct: 62  NMGEDDWRYHFYDTIKGSDWLGDQDAIEYMCREAIPAIIELEHYGVPFSRTEDGKIYQRP 121

Query: 129 FGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCC 188
           FGG    YGEGP  QRTCAAADRTGHAILHTLY Q+L +NA F IEYFALDLI++ EG C
Sbjct: 122 FGGMTTRYGEGPSAQRTCAAADRTGHAILHTLYQQSLAHNARFMIEYFALDLIMDEEGVC 181

Query: 189 VGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDME 248
            GV+A  +  G +H F A  VVLATGGYGRAYFSATSAHTCTGDG G+VARAGLPLQDME
Sbjct: 182 RGVLALDMAEGTLHLFRAHGVVLATGGYGRAYFSATSAHTCTGDGGGLVARAGLPLQDME 241

Query: 249 FVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEI 308
           FVQFHPTGIYGAGCLITEG RGEGG L NS GERFMERYAP  KDLASRDVVSR M +EI
Sbjct: 242 FVQFHPTGIYGAGCLITEGVRGEGGILRNSNGERFMERYAPHYKDLASRDVVSRSMTIEI 301

Query: 309 REGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMG 368
           REGRGVG+ KDHI L L HL P V+ E+LPGI+ESARIFAGVDV + PIPVIPTVHYNMG
Sbjct: 302 REGRGVGEHKDHILLDLTHLGPGVIDEKLPGIAESARIFAGVDVHKQPIPVIPTVHYNMG 361

Query: 369 GIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIR 428
           GIPTNY GEV+     NP+   PGL AIGEA C SVHGANRLGSNSL+DLVVFGRA   R
Sbjct: 362 GIPTNYHGEVVRKVGDNPDAVVPGLYAIGEAACVSVHGANRLGSNSLLDLVVFGRAVANR 421

Query: 429 ASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQD 488
            +E I K++P   L   +CD+ + + D+LR+A+G  PTA +R++MQR MQ DA VFRT  
Sbjct: 422 CAETIKKNAPHKPLASDACDKALSQLDKLRNANGDTPTAVIRDRMQRTMQADAAVFRTSK 481

Query: 489 SLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRG 548
           +L +GC  +S ++D   D+KV DRSL+WNSDL+ET EL NL++NA+AT+ SAE RKESRG
Sbjct: 482 TLQEGCEKMSQIFDSFQDVKVSDRSLVWNSDLIETYELHNLLLNAVATINSAEQRKESRG 541

Query: 549 SHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPKA 608
           +HA ED+ D     RDD NW+KH+L  VD  TGK   DYRPVH   L   VD   + PK 
Sbjct: 542 AHAHEDYPD-----RDDANWQKHTLVTVDAETGKTSFDYRPVHMYTLSKDVDV--VPPKP 594

Query: 609 RVY 611
           RVY
Sbjct: 595 RVY 597


>gi|302381551|ref|YP_003817374.1| succinate dehydrogenase, flavoprotein subunit [Brevundimonas
           subvibrioides ATCC 15264]
 gi|302192179|gb|ADK99750.1| succinate dehydrogenase, flavoprotein subunit [Brevundimonas
           subvibrioides ATCC 15264]
          Length = 594

 Score =  847 bits (2188), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 421/603 (69%), Positives = 487/603 (80%), Gaps = 10/603 (1%)

Query: 9   SSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLA 68
           ++Y +VDH+YDVVVVGAGG+GLRA LG A++G K AC+TKVFPTRSHTVAAQGGI+A+L 
Sbjct: 2   AAYEFVDHAYDVVVVGAGGSGLRAALGAAQQGLKVACVTKVFPTRSHTVAAQGGISAALG 61

Query: 69  NMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRP 128
           NM  DSW+WH+YDT+KGSDWLGD DAI+YL  EAP++VYELEH+GVPFSR + GKIYQR 
Sbjct: 62  NMGEDSWKWHMYDTVKGSDWLGDQDAIEYLVREAPKAVYELEHWGVPFSRTDDGKIYQRA 121

Query: 129 FGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCC 188
           FGG  +NYGEGP VQRTCAAADRTGHAILHTLYGQ+++   EFFIEYFALDLI+++ G C
Sbjct: 122 FGGMTKNYGEGP-VQRTCAAADRTGHAILHTLYGQSVRREVEFFIEYFALDLIMDN-GAC 179

Query: 189 VGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDME 248
            GV AW+L+ G +HRF+AKLV+LATGGYGRAYFSATSAHTCTGDG  MV RAGLPLQDME
Sbjct: 180 TGVTAWKLDDGTLHRFNAKLVILATGGYGRAYFSATSAHTCTGDGNAMVLRAGLPLQDME 239

Query: 249 FVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEI 308
           FVQFHPTGIYGAGCLITEGARGEGGYL NS+GERFMERYAPSAKDLASRDVVSR M MEI
Sbjct: 240 FVQFHPTGIYGAGCLITEGARGEGGYLTNSEGERFMERYAPSAKDLASRDVVSRSMTMEI 299

Query: 309 REGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMG 368
           REGRGVG +KDHI+L+L+HLDPAVL ERLPGISESA+IFAGVDVT++PIPVIPTVHYNMG
Sbjct: 300 REGRGVGPNKDHINLHLDHLDPAVLHERLPGISESAKIFAGVDVTKEPIPVIPTVHYNMG 359

Query: 369 GIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIR 428
           GIPTNY GEVL     N +   PGLMA+GEA C SVHGANRLGSNSL DLVVFGRAA +R
Sbjct: 360 GIPTNYHGEVLTKVGGNADTVVPGLMAVGEAACVSVHGANRLGSNSLTDLVVFGRAAGLR 419

Query: 429 ASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQD 488
           A E++DK+S +P    +  D  + R DR RHA G  PTA LR +MQRAMQ DA VFRT +
Sbjct: 420 AGEVVDKASAVPVATAAHTDSHLARLDRFRHASGSTPTAKLRGEMQRAMQSDAAVFRTGE 479

Query: 489 SLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRG 548
           +L++G   L  +    AD++  DR +IWN+DLVETLE  NL+  A+ T+ SA  RKESRG
Sbjct: 480 TLAEGVAKLRDIHARGADIQTTDRGMIWNTDLVETLEYDNLIDQALVTIESAANRKESRG 539

Query: 549 SHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPKA 608
           +HAREDF D     R D  W KH+L W     G + +DYRPVH   +   +DY  I PKA
Sbjct: 540 AHAREDFPD-----RHDEEWMKHTLAWKKPGEG-VVIDYRPVHEYTMSSDIDY--IKPKA 591

Query: 609 RVY 611
           RVY
Sbjct: 592 RVY 594


>gi|330813449|ref|YP_004357688.1| succinate dehydrogenase flavoprotein subunit [Candidatus
           Pelagibacter sp. IMCC9063]
 gi|327486544|gb|AEA80949.1| succinate dehydrogenase flavoprotein subunit [Candidatus
           Pelagibacter sp. IMCC9063]
          Length = 594

 Score =  846 bits (2186), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 402/603 (66%), Positives = 481/603 (79%), Gaps = 10/603 (1%)

Query: 9   SSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLA 68
           S Y  +DH YD +VVGAGG+GLRA +G++E G KTACI+KVFPTRSHT AAQGGI+A+L 
Sbjct: 2   SKYEIIDHEYDAIVVGAGGSGLRAAVGLSEAGLKTACISKVFPTRSHTAAAQGGISAALG 61

Query: 69  NMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRP 128
           NM  D W+WH+YDT+KG+DWLGD D+I++L  EAP++V ELE YGV FSR E GKIYQRP
Sbjct: 62  NMGEDDWRWHMYDTVKGADWLGDQDSIEFLCKEAPKAVIELEKYGVAFSRTEEGKIYQRP 121

Query: 129 FGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCC 188
           FGG  +NYG G  +QRTCAAADRTGHAILHTLYGQALK N EFFIEYFALDL++++ G C
Sbjct: 122 FGGMTKNYGNGV-IQRTCAAADRTGHAILHTLYGQALKKNTEFFIEYFALDLLMHN-GKC 179

Query: 189 VGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDME 248
            GV+AW L+ G+IHRF + + +LATGGYGRAYFSATSAHTCTGDG GMV RAGLPLQDME
Sbjct: 180 HGVLAWSLQDGKIHRFRSNMTILATGGYGRAYFSATSAHTCTGDGGGMVLRAGLPLQDME 239

Query: 249 FVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEI 308
           F+QFHPTGIYGAGCLITEG+RGEGG+LVNS+GERFMERYAPSAKDLASRDVVSR M +EI
Sbjct: 240 FIQFHPTGIYGAGCLITEGSRGEGGFLVNSEGERFMERYAPSAKDLASRDVVSRSMTVEI 299

Query: 309 REGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMG 368
            EGRGVGK KDHI+L+LNH+DP  L ERLPGISESA++FAGVDVT++PIPV+PTVHYNMG
Sbjct: 300 NEGRGVGKDKDHIYLHLNHIDPKTLHERLPGISESAKVFAGVDVTKEPIPVMPTVHYNMG 359

Query: 369 GIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIR 428
           GIPTNY GEVL  ++   E    GLMAIGEA C SVHGANRLGSNSLIDLVVFG+AA +R
Sbjct: 360 GIPTNYHGEVLTKDADGSETIVDGLMAIGEAACVSVHGANRLGSNSLIDLVVFGKAASVR 419

Query: 429 ASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQD 488
            ++++  +S   ++  S   + +DRFD+LR+A+G  PTA LR+KMQR MQ    VFRT  
Sbjct: 420 TAQVVKPNSKHETIPESETQKSLDRFDKLRNANGSTPTAVLRDKMQRTMQSKCAVFRTDK 479

Query: 489 SLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRG 548
           +L +G  ++   WD M D++V D+SLI+N+DLVE LE  NL+  ++ TV SAE RKESRG
Sbjct: 480 TLKEGLHDIQQPWDGMKDIRVQDKSLIFNTDLVEALEFDNLIRQSMVTVSSAENRKESRG 539

Query: 549 SHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPKA 608
           +H+REDFKD     RDD  W KH+L W   + GK+++DYR VHT  L   V Y    PK 
Sbjct: 540 AHSREDFKD-----RDDQEWMKHTLAWQK-SDGKVEIDYRDVHTYTLSTDVQY--FPPKK 591

Query: 609 RVY 611
           RVY
Sbjct: 592 RVY 594


>gi|304394278|ref|ZP_07376201.1| succinate dehydrogenase, flavoprotein subunit [Ahrensia sp. R2A130]
 gi|303293718|gb|EFL88095.1| succinate dehydrogenase, flavoprotein subunit [Ahrensia sp. R2A130]
          Length = 602

 Score =  846 bits (2186), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 409/608 (67%), Positives = 470/608 (77%), Gaps = 8/608 (1%)

Query: 4   SSNLKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGI 63
           ++  K +YT++DH+ DV VVGAGGAGLRATLG A+ G KTACITKVFPTRSHTVAAQGG+
Sbjct: 3   TAQTKKAYTFIDHTVDVCVVGAGGAGLRATLGAAQAGLKTACITKVFPTRSHTVAAQGGV 62

Query: 64  AASLANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGK 123
           AASL NM  D+WQWH+YDT+KGSDWLGD DAI+YL  EAP++VYEL+H+GVPFSR E GK
Sbjct: 63  AASLGNMGKDTWQWHMYDTVKGSDWLGDQDAIEYLCREAPKAVYELDHFGVPFSRTEEGK 122

Query: 124 IYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIIN 183
           IYQRPFGG    YGEGPP QRTCAAADRTGHA+LHTLYGQ+LK +AEF+IEYFA+DLI+ 
Sbjct: 123 IYQRPFGGMTTEYGEGPPAQRTCAAADRTGHAMLHTLYGQSLKYDAEFYIEYFAIDLIME 182

Query: 184 SEGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLP 243
            +G C GV+   L TGE+HRF A   +LATGGYGRAYFS TSAHTCTGDG  MV RAGLP
Sbjct: 183 -DGACRGVICMDLATGELHRFRAHKTILATGGYGRAYFSCTSAHTCTGDGNAMVLRAGLP 241

Query: 244 LQDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRC 303
           LQDMEF+QFHPTGIYGAGCLITEG+RGEGGYLVNS+GERFMERYAPSAKDLASRDVVSR 
Sbjct: 242 LQDMEFIQFHPTGIYGAGCLITEGSRGEGGYLVNSEGERFMERYAPSAKDLASRDVVSRS 301

Query: 304 MMMEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTV 363
           M MEIREGRGVG   DHI+L+L+HLD  +L ERLPGISESA+IFAGVDVT++PIPVIPTV
Sbjct: 302 MTMEIREGRGVGAKGDHIYLHLDHLDSELLAERLPGISESAKIFAGVDVTKEPIPVIPTV 361

Query: 364 HYNMGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGR 423
           HYNMGGIPTNY GEVL     +P+    GLMA+GEA C SVHGANRLGSNSLIDLVVFGR
Sbjct: 362 HYNMGGIPTNYHGEVLTKKDGDPDSVVQGLMAVGEAACVSVHGANRLGSNSLIDLVVFGR 421

Query: 424 AAVIRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGV 483
           AA +R  E +        L   S D  + R D  RHADG   TA LR+ MQ  MQ +  V
Sbjct: 422 AAGLRCQETVTPGQSHAPLQEGSSDLAVSRLDHFRHADGGTSTAELRDAMQETMQTNCAV 481

Query: 484 FRTQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEAR 543
           FRT + L +G + ++ +W    D+ V D+ +IWN+DLVET+E  NL+  A  TV SA AR
Sbjct: 482 FRTSEILEEGQKKIADVWSGTDDISVTDKGMIWNTDLVETMEFDNLISQAAVTVESAAAR 541

Query: 544 KESRGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSK 603
           KESRG+HA EDF D     RDD NW  H+L + D +  K+ L  RPVHT  L   V Y  
Sbjct: 542 KESRGAHAHEDFPD-----RDDKNWMHHTLAFADDDKKKVDLGARPVHTYTLSNEVSY-- 594

Query: 604 IAPKARVY 611
           I PKARVY
Sbjct: 595 IKPKARVY 602


>gi|90421132|ref|ZP_01229034.1| sdhA, succinate dehydrogenase/fumarate reductase, flavoprotein
           [Aurantimonas manganoxydans SI85-9A1]
 gi|90334624|gb|EAS48404.1| sdhA, succinate dehydrogenase/fumarate reductase, flavoprotein
           [Aurantimonas manganoxydans SI85-9A1]
          Length = 617

 Score =  846 bits (2185), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 416/602 (69%), Positives = 478/602 (79%), Gaps = 7/602 (1%)

Query: 10  SYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLAN 69
           +Y + DH++DVVVVGAGGAGLRATLG A+ G KTACITKVFPTRSHTVAAQGG+AASL N
Sbjct: 23  AYEFTDHTFDVVVVGAGGAGLRATLGAAQAGLKTACITKVFPTRSHTVAAQGGVAASLGN 82

Query: 70  MTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRPF 129
           M  D W+WH+YDT+KGSDWLGD DAI+YL   AP +VYELEH+GVPFSR E GKIYQRPF
Sbjct: 83  MGKDDWRWHMYDTVKGSDWLGDQDAIEYLVRNAPAAVYELEHFGVPFSRTEDGKIYQRPF 142

Query: 130 GGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCCV 189
           GG    +G+GP  QRTCAAADRTGHAILHTLYGQ+L++++EFFIEYFA+DLI++ EG C 
Sbjct: 143 GGMTTEFGQGPAAQRTCAAADRTGHAILHTLYGQSLRHSSEFFIEYFAIDLIMDEEGVCR 202

Query: 190 GVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDMEF 249
           GVVA  L+ G IHRF AK  +LATGGYGRAYFSATSAHTCTGDG GMV RAGLPLQDMEF
Sbjct: 203 GVVALCLDDGTIHRFRAKKTILATGGYGRAYFSATSAHTCTGDGGGMVLRAGLPLQDMEF 262

Query: 250 VQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEIR 309
           VQFHPTGIYGAGCLITEG+RGEGGYL NS+GERFMERYAPSAKDLASRDVVSR M MEIR
Sbjct: 263 VQFHPTGIYGAGCLITEGSRGEGGYLTNSEGERFMERYAPSAKDLASRDVVSRSMTMEIR 322

Query: 310 EGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMGG 369
           EGRGVGK+KDHIHL+L+HLDPAVL ERLPGISESARIFAGVDVT++PIPV+PTVHYNMGG
Sbjct: 323 EGRGVGKNKDHIHLHLDHLDPAVLAERLPGISESARIFAGVDVTKEPIPVLPTVHYNMGG 382

Query: 370 IPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIRA 429
           IPTN+ GEVL     N +   PGLMA+GEAGC SVHGANRLGSNSLIDLVVFGRAA +R 
Sbjct: 383 IPTNFHGEVLTKKDGNADTVVPGLMAVGEAGCVSVHGANRLGSNSLIDLVVFGRAAGLRC 442

Query: 430 SEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQDS 489
           +E +  +   P L + + D  + R DR R+A+G  PTA LR  MQ  MQ +  VFRT + 
Sbjct: 443 AETVSAAEEQPDLPVGAGDNAIARLDRFRYANGATPTAELRADMQNTMQSNCAVFRTGEI 502

Query: 490 LSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRGS 549
           L +G   +  +W    D++V DRSLIWN+DL+ETLE  NL+  A+ T+ SA  R ESRG+
Sbjct: 503 LEEGHAKIHEVWKASDDIRVTDRSLIWNTDLIETLEYDNLIAQAVVTMDSARNRTESRGA 562

Query: 550 HAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPKAR 609
           HAREDF D     RDD NW KH+L + D     + L+ RPVHT  L   +DY  I PK R
Sbjct: 563 HAREDFPD-----RDDANWMKHTLSFCDTVAKTVTLEDRPVHTYTLSNQIDY--IEPKKR 615

Query: 610 VY 611
           VY
Sbjct: 616 VY 617


>gi|217979667|ref|YP_002363814.1| succinate dehydrogenase flavoprotein subunit [Methylocella
           silvestris BL2]
 gi|217505043|gb|ACK52452.1| succinate dehydrogenase, flavoprotein subunit [Methylocella
           silvestris BL2]
          Length = 612

 Score =  845 bits (2182), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/607 (66%), Positives = 480/607 (79%), Gaps = 8/607 (1%)

Query: 5   SNLKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIA 64
           + L ++Y  +DHS+DV+VVGAGGAGLRAT+G ++ G +TACI+KVFPTRSHTVAAQGG+A
Sbjct: 14  ARLGAAYPIIDHSFDVIVVGAGGAGLRATVGCSQAGLRTACISKVFPTRSHTVAAQGGVA 73

Query: 65  ASLANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKI 124
           ASLANM PD+W+WH+YDT+KGSDWLGD D+I+YL   AP +VYELEH+GVPFSR E G+I
Sbjct: 74  ASLANMGPDNWKWHMYDTVKGSDWLGDQDSIEYLCRNAPAAVYELEHWGVPFSRTEDGRI 133

Query: 125 YQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINS 184
           YQRPFGG   ++G+GPP QRTCAAADRTGHA+LHTLYGQAL+ N EFFIEYFA+DLI+  
Sbjct: 134 YQRPFGGMTTDFGKGPPAQRTCAAADRTGHAMLHTLYGQALRYNTEFFIEYFAIDLIME- 192

Query: 185 EGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPL 244
           +G C GVV  +L+ G IHRF A+LV+LATGGYGRAYFSATSAHTCTGDG  MV RAGLPL
Sbjct: 193 DGRCRGVVCLKLDDGTIHRFRAQLVILATGGYGRAYFSATSAHTCTGDGNAMVLRAGLPL 252

Query: 245 QDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCM 304
           QDMEFVQFHPTGIYGAGCLITEGARGEGGYL N  GERFMERYAPS KDLA RD+VSR M
Sbjct: 253 QDMEFVQFHPTGIYGAGCLITEGARGEGGYLTNGAGERFMERYAPSVKDLAPRDMVSRAM 312

Query: 305 MMEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVH 364
            MEIREGRGVGK+KDHIHL+L+HLDP +L ERLPGISESA+IFAGVD+T+ PIPV+PTVH
Sbjct: 313 TMEIREGRGVGKNKDHIHLHLDHLDPKILHERLPGISESAKIFAGVDLTKAPIPVLPTVH 372

Query: 365 YNMGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRA 424
           YNMGGIPTNY GEV+     +P+   PGLMA+GEA C SVHGANRLGSNSLIDLVVFGRA
Sbjct: 373 YNMGGIPTNYHGEVVIKKDGDPDVIVPGLMALGEAACVSVHGANRLGSNSLIDLVVFGRA 432

Query: 425 AVIRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVF 484
           A IRA+E++   +    L   S D+ + R D LR A G +PTA LR +MQ+ MQ    V+
Sbjct: 433 AGIRAAEIVTAGAKQAELPADSADKALARLDGLRFAKGSIPTAELRLRMQKVMQDHCAVY 492

Query: 485 RTQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARK 544
           RT + L +G + +  +W     + V DRSLIWNSDLVETLE  NL+I A+ T+  A  R 
Sbjct: 493 RTGEVLEEGSKRIHEVWRAKDQVGVTDRSLIWNSDLVETLEFDNLIIQAVVTMDGAVNRT 552

Query: 545 ESRGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKI 604
           ESRG+HARED+       RDDVNW KH+L  +D +   + +DYRPVH+  +   + Y  I
Sbjct: 553 ESRGAHAREDYTQ-----RDDVNWMKHTLASIDPDAHSVSIDYRPVHSYTMTNEMQY--I 605

Query: 605 APKARVY 611
            PKARVY
Sbjct: 606 EPKARVY 612


>gi|329847592|ref|ZP_08262620.1| succinate dehydrogenase, flavoprotein subunit [Asticcacaulis
           biprosthecum C19]
 gi|328842655|gb|EGF92224.1| succinate dehydrogenase, flavoprotein subunit [Asticcacaulis
           biprosthecum C19]
          Length = 596

 Score =  842 bits (2175), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 413/605 (68%), Positives = 480/605 (79%), Gaps = 9/605 (1%)

Query: 7   LKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAAS 66
           +  SY  ++H YDVVVVGAGG+GLRA LG  + G KTACITKVFPTRSHTVAAQGG+AAS
Sbjct: 1   MTKSYNIIEHEYDVVVVGAGGSGLRAALGAGQAGLKTACITKVFPTRSHTVAAQGGVAAS 60

Query: 67  LANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQ 126
           L NM  D WQWH+YDT+KGSDWLGD DAI+YL   APQ+VYELEH+GVPFSR E GKIYQ
Sbjct: 61  LGNMGEDKWQWHMYDTVKGSDWLGDQDAIEYLVRNAPQAVYELEHWGVPFSRTEDGKIYQ 120

Query: 127 RPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEG 186
           RPFGG  +N+GEGP VQRTCAAADRTGHA+LHTLYGQ+++NN EFFIEYFALDLI++ + 
Sbjct: 121 RPFGGMTRNFGEGP-VQRTCAAADRTGHAMLHTLYGQSVRNNVEFFIEYFALDLIMDGD- 178

Query: 187 CCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQD 246
            C G+  WQL+TG+IH F A LV+LATGGYGRAYFSATSAHTCTGDG  MV RAGLPLQD
Sbjct: 179 VCRGLTTWQLDTGDIHVFRAHLVILATGGYGRAYFSATSAHTCTGDGNAMVLRAGLPLQD 238

Query: 247 MEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMM 306
           MEFVQFHPTGIYG+GCLITEGARGEGGYL NS GERFMERYAPSAKDLASRDVVSR M M
Sbjct: 239 MEFVQFHPTGIYGSGCLITEGARGEGGYLTNSAGERFMERYAPSAKDLASRDVVSRSMTM 298

Query: 307 EIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYN 366
           EIREGRGVG  KDHIHL+L+HL P +L +RLPGISESA+IFAGVDVT++PIPVIPTVHYN
Sbjct: 299 EIREGRGVGPKKDHIHLHLDHLPPEILHKRLPGISESAKIFAGVDVTKEPIPVIPTVHYN 358

Query: 367 MGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAV 426
           MGGIPTNY GEVL     + +   PGLMA+GEA C SVHGANRLGSNSLIDLVVFGRAA 
Sbjct: 359 MGGIPTNYHGEVLTKKGADADTVVPGLMAVGEAACVSVHGANRLGSNSLIDLVVFGRAAG 418

Query: 427 IRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRT 486
           +RA E++  ++P   L  S     +DR ++ R A G  PTA LR++MQ AMQ DA VFRT
Sbjct: 419 LRAKELVKPNTPHVDLPASKVQSHLDRLEKFRTASGGTPTAVLRDRMQHAMQEDAAVFRT 478

Query: 487 QDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKES 546
            ++L  G + ++ ++   +D+ + DR LIWN+DLVE LE  NL+  A+ TV SA  RKES
Sbjct: 479 GETLEQGSKRMTGIFQASSDIGIKDRGLIWNTDLVEALEYDNLISQAVVTVDSALNRKES 538

Query: 547 RGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAP 606
           RG+HAREDF +     R+D  W KH+L W+D  +G   +DYRPVHT  +   + Y  IAP
Sbjct: 539 RGAHAREDFPN-----RNDDEWMKHTLTWIDLTSGTTNIDYRPVHTYTMTNDIAY--IAP 591

Query: 607 KARVY 611
           KARVY
Sbjct: 592 KARVY 596


>gi|182679664|ref|YP_001833810.1| succinate dehydrogenase flavoprotein subunit [Beijerinckia indica
           subsp. indica ATCC 9039]
 gi|182635547|gb|ACB96321.1| succinate dehydrogenase, flavoprotein subunit [Beijerinckia indica
           subsp. indica ATCC 9039]
          Length = 612

 Score =  840 bits (2171), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/603 (66%), Positives = 476/603 (78%), Gaps = 8/603 (1%)

Query: 9   SSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLA 68
           ++Y   DH++DVV+VGAGGAGLRAT+G ++ G +TACI+KVFPTRSHTVAAQGG+AASLA
Sbjct: 18  TAYPITDHTFDVVIVGAGGAGLRATVGCSQAGLRTACISKVFPTRSHTVAAQGGVAASLA 77

Query: 69  NMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRP 128
           NM PD+W+WH+YDT+KGSDWLGD D+I+YL   AP +V+ELEH+GVPFSR E G+IYQRP
Sbjct: 78  NMGPDNWKWHMYDTVKGSDWLGDQDSIEYLCRNAPAAVFELEHWGVPFSRTEDGRIYQRP 137

Query: 129 FGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCC 188
           FGG   ++G+GPP QRTCAAADRTGHAILHTLYGQAL+N  EFFIEYFA+DLI+  +G C
Sbjct: 138 FGGMTTDFGKGPPAQRTCAAADRTGHAILHTLYGQALRNQTEFFIEYFAIDLIME-DGHC 196

Query: 189 VGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDME 248
            GVV  +L+ G IHRF ++LV+LATGGYGRAYFSATSAHTCTGDG  MV RAGLPLQDME
Sbjct: 197 RGVVCLKLDDGTIHRFRSQLVILATGGYGRAYFSATSAHTCTGDGNAMVLRAGLPLQDME 256

Query: 249 FVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEI 308
           FVQFHPTGIYGAGCLITEGARGEGGYL NS GERFMERYAPS KDLA RD+VSR M MEI
Sbjct: 257 FVQFHPTGIYGAGCLITEGARGEGGYLTNSSGERFMERYAPSVKDLAPRDMVSRAMTMEI 316

Query: 309 REGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMG 368
           REGRGVGK KDHI L+L+HLDP +L ERLPGISESARIFAGVDVT++PIPV+PTVHYNMG
Sbjct: 317 REGRGVGKGKDHIFLHLDHLDPKILHERLPGISESARIFAGVDVTKEPIPVLPTVHYNMG 376

Query: 369 GIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIR 428
           GIPTNY GEV+     +P+   PGLMA+GEA C SVHGANRLGSNSLIDLVVFGRAA +R
Sbjct: 377 GIPTNYHGEVVIKKGDDPDVVVPGLMALGEAACVSVHGANRLGSNSLIDLVVFGRAAGLR 436

Query: 429 ASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQD 488
           A+E++   +  P L   S D  + R D  R+A G +PTA LR +MQ+ MQ +  V+RT +
Sbjct: 437 AAEIVTAGAKQPELPAGSADLSLSRLDHFRNAKGSLPTAELRLRMQKVMQNNCAVYRTGE 496

Query: 489 SLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRG 548
           +L +G + +  +W     + V DR LIWN+DL+ETLE  NL++ A+ T+  A  R ESRG
Sbjct: 497 TLEEGSKLIHEVWKAKDQIGVTDRGLIWNTDLIETLEFDNLIVQAVVTMDGAVNRTESRG 556

Query: 549 SHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPKA 608
           +HARED+ +     RDD NW KH+L  +D     + LDYRPVH   +   + Y  I PKA
Sbjct: 557 AHAREDYAE-----RDDKNWMKHTLASIDGTAHTVSLDYRPVHNYTMTNEMQY--IEPKA 609

Query: 609 RVY 611
           RVY
Sbjct: 610 RVY 612


>gi|83944807|ref|ZP_00957173.1| succinate dehydrogenase [Oceanicaulis alexandrii HTCC2633]
 gi|83851589|gb|EAP89444.1| succinate dehydrogenase [Oceanicaulis alexandrii HTCC2633]
          Length = 595

 Score =  840 bits (2171), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 414/603 (68%), Positives = 485/603 (80%), Gaps = 9/603 (1%)

Query: 9   SSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLA 68
           S+Y + DH++DVVVVGAGG+GLRA LG A++G KTACI+KVFPTRSHTVAAQGGI+ASL 
Sbjct: 2   SAYEWTDHTFDVVVVGAGGSGLRAALGAAQEGLKTACISKVFPTRSHTVAAQGGISASLG 61

Query: 69  NMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRP 128
           NM  D W+WH+YDT+KGSDWLGD D+I+YL   AP++VYELEH+GVPFSR E GKIYQR 
Sbjct: 62  NMGEDDWRWHMYDTVKGSDWLGDQDSIEYLCRHAPKAVYELEHWGVPFSRTEDGKIYQRA 121

Query: 129 FGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCC 188
           FGG  +N+GEGP VQRTCAAADRTGHAILHTLYGQ+L++  EFFIEYF LDLI++ +G C
Sbjct: 122 FGGMTRNFGEGP-VQRTCAAADRTGHAILHTLYGQSLRHATEFFIEYFVLDLIMDEDGAC 180

Query: 189 VGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDME 248
            GV AW+L+ G +HRF A+  +LATGGYGRAYFSATSAHTCTGDG  MV RAGLPLQDME
Sbjct: 181 RGVTAWKLDDGTLHRFRAQKTILATGGYGRAYFSATSAHTCTGDGNAMVLRAGLPLQDME 240

Query: 249 FVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEI 308
           FVQFHPTGIYGAGCLITEGARGEGGYL NSKGERFMERYAP+AKDLASRDVVSR M MEI
Sbjct: 241 FVQFHPTGIYGAGCLITEGARGEGGYLTNSKGERFMERYAPNAKDLASRDVVSRSMTMEI 300

Query: 309 REGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMG 368
           REGRGVG+  DHIHL+L+HLDPA+L +RLPGISESA+IFAGVDVT++PIPVIPTVHYNMG
Sbjct: 301 REGRGVGEHGDHIHLHLDHLDPAILAQRLPGISESAKIFAGVDVTKEPIPVIPTVHYNMG 360

Query: 369 GIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIR 428
           GIPTNY GEVL     NP++  PGLMA+GEA C SVHGANRLGSNSLIDLVVFGRAA +R
Sbjct: 361 GIPTNYHGEVLTKVGGNPDQVVPGLMAVGEAACVSVHGANRLGSNSLIDLVVFGRAAGLR 420

Query: 429 ASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQD 488
             E ++  +  P L   +    + RFD++RHADG   TA LR  MQRAMQ +  VFRTQ+
Sbjct: 421 CGETVEAGASQPELSEKAGADTLSRFDKMRHADGGTKTATLRLDMQRAMQENCAVFRTQE 480

Query: 489 SLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRG 548
            L +G   ++ ++   AD++V+DRS+IWN+DLVE LE +NL+  A  TV SA AR ESRG
Sbjct: 481 VLDEGVTRIAEVYKGAADIRVNDRSMIWNTDLVEALEFENLIAQASVTVNSAAARTESRG 540

Query: 549 SHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPKA 608
           +HARED+ D     RDD NW KH+L W++   G +KLD RPVH   L   + Y  I PKA
Sbjct: 541 AHAREDYPD-----RDDANWMKHTLAWIN-EDGSVKLDDRPVHEYTLSNDIAY--IEPKA 592

Query: 609 RVY 611
           RVY
Sbjct: 593 RVY 595


>gi|83592540|ref|YP_426292.1| succinate dehydrogenase flavoprotein subunit [Rhodospirillum rubrum
           ATCC 11170]
 gi|3273341|dbj|BAA31212.1| succinate dehydrogenase flavoprotein subunit [Rhodospirillum
           rubrum]
 gi|83575454|gb|ABC22005.1| succinate dehydrogenase subunit A [Rhodospirillum rubrum ATCC
           11170]
          Length = 594

 Score =  839 bits (2167), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 406/603 (67%), Positives = 475/603 (78%), Gaps = 10/603 (1%)

Query: 9   SSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLA 68
           +SY  VDH YD +VVGAGGAGLRAT G+ E+G KTACITKVFPTRSHTVAAQGGI A+L 
Sbjct: 2   ASYEIVDHEYDALVVGAGGAGLRATFGLVEQGLKTACITKVFPTRSHTVAAQGGIGAALG 61

Query: 69  NMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRP 128
           NM  D+W+WH+YDT+KG+DWLGD DAI+Y+  EA  +VYELEHYGVPFSR E G+IYQRP
Sbjct: 62  NMAEDNWKWHMYDTVKGADWLGDQDAIEYMCREAIPAVYELEHYGVPFSRTEDGRIYQRP 121

Query: 129 FGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCC 188
           FGGHM+N+GE P VQR CAAADRTGHAIL TLY Q+L+ NAEFF+EYFALDLII  +G C
Sbjct: 122 FGGHMRNFGEAP-VQRACAAADRTGHAILQTLYQQSLRFNAEFFVEYFALDLIIE-DGVC 179

Query: 189 VGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDME 248
            GV+AW +E G IHRF +   VLATGGYGRAYFS TSAHTCTGDG GMVARAGLPLQDME
Sbjct: 180 RGVIAWCMEDGTIHRFKSHTTVLATGGYGRAYFSCTSAHTCTGDGNGMVARAGLPLQDME 239

Query: 249 FVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEI 308
           FVQFHPTGIYGAGCLITEGARGEGGYL NS+GERFMERYAP+AKDLASRDVVSR M +EI
Sbjct: 240 FVQFHPTGIYGAGCLITEGARGEGGYLTNSEGERFMERYAPTAKDLASRDVVSRAMTVEI 299

Query: 309 REGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMG 368
           REGRGVG  KDHI+L+L HL P VL  RLPGI+E+A++F+GVD TRDPIPV+PTVHYNMG
Sbjct: 300 REGRGVGPKKDHINLHLEHLGPEVLHSRLPGITETAKVFSGVDATRDPIPVLPTVHYNMG 359

Query: 369 GIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIR 428
           GIPTNY GEVL+    +PE   PGLMA+GE  C SVHGANRLG+NSL+D+VVFGRAA +R
Sbjct: 360 GIPTNYHGEVLNPTKADPEAIFPGLMAVGECACVSVHGANRLGTNSLLDIVVFGRAAALR 419

Query: 429 ASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQD 488
           A+E++        L   + D  + R DRLR A G   TA +R+ +Q+AMQ DA VFRT  
Sbjct: 420 AAEVVKPGIAHKPLKADAADLALSRLDRLRSAKGAKLTAEIRDDLQQAMQRDAAVFRTTK 479

Query: 489 SLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRG 548
           SL++G   +  +   +AD+K+ D S+I+N+DL E LEL+NLM  A  T++ A AR+ESRG
Sbjct: 480 SLAEGVARVDQVAASLADIKLVDTSMIFNTDLAEALELENLMACAQTTIHGAAARQESRG 539

Query: 549 SHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPKA 608
           +HA EDF D     RDD  W KH+L W+D   GK+ LDYRPVHT  L   +DY  I PKA
Sbjct: 540 AHAHEDFPD-----RDDKTWMKHTLAWLD-PKGKVTLDYRPVHTFTLTDEIDY--IEPKA 591

Query: 609 RVY 611
           RVY
Sbjct: 592 RVY 594


>gi|114571385|ref|YP_758065.1| succinate dehydrogenase flavoprotein subunit [Maricaulis maris
           MCS10]
 gi|114341847|gb|ABI67127.1| succinate dehydrogenase subunit A [Maricaulis maris MCS10]
          Length = 595

 Score =  837 bits (2163), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 412/603 (68%), Positives = 480/603 (79%), Gaps = 9/603 (1%)

Query: 9   SSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLA 68
           + Y ++DH+YDVVVVGAGG+GLRA LG ++ G KTACITKVFPTRSHTVAAQGGI+ASL 
Sbjct: 2   AEYKWIDHTYDVVVVGAGGSGLRAALGASQAGLKTACITKVFPTRSHTVAAQGGISASLG 61

Query: 69  NMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRP 128
           NM  D W+WH+YDT+KGSDWLGD DAI+YL  EAP +VYELEH+GVPFSR E GKIYQR 
Sbjct: 62  NMGEDDWRWHMYDTVKGSDWLGDQDAIEYLCREAPAAVYELEHWGVPFSRTEDGKIYQRA 121

Query: 129 FGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCC 188
           FGG  +NYGEGP VQRTCAAADRTGHAILHTLYGQ+++N  EFFIEYFALDLI++ +G C
Sbjct: 122 FGGMTKNYGEGP-VQRTCAAADRTGHAILHTLYGQSVRNETEFFIEYFALDLIMDDDGVC 180

Query: 189 VGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDME 248
            G+ AW+L+ G +HRF A+ VVLATGGYGRAYFSATSAHTCTGDG  MV RAGLPLQDME
Sbjct: 181 RGITAWKLDDGTLHRFRAQTVVLATGGYGRAYFSATSAHTCTGDGNAMVLRAGLPLQDME 240

Query: 249 FVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEI 308
           FVQFHPTGIYGAGCLITEGARGEGGYL NS GERFMERYAPSAKDLASRDVVSR M MEI
Sbjct: 241 FVQFHPTGIYGAGCLITEGARGEGGYLTNSNGERFMERYAPSAKDLASRDVVSRSMTMEI 300

Query: 309 REGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMG 368
           REGRGVG + DHIHL+L+HLDP +L ERLPGISESAR+FAGVDVT++PIPV+PTVHYNMG
Sbjct: 301 REGRGVGANGDHIHLHLDHLDPDILGERLPGISESARVFAGVDVTKEPIPVLPTVHYNMG 360

Query: 369 GIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIR 428
           GIPTNY GEVL     + +   PGLMA+GEA C SVHGANRLGSNSLIDLVVFGRAA +R
Sbjct: 361 GIPTNYHGEVLTKVGGDADTVVPGLMAVGEAACVSVHGANRLGSNSLIDLVVFGRAAGLR 420

Query: 429 ASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQD 488
             E     +  P +  +     +DR D+ R+A G  PTA LR +MQR+MQ +  VFRT D
Sbjct: 421 LGETTKAGASQPEIKSTDGQLSLDRLDKYRNAAGGTPTAKLRLEMQRSMQNNCAVFRTGD 480

Query: 489 SLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRG 548
            L++G   +  ++  MAD+ V DR+++WN+DL+ETLE+ NL+  A  TV  A  R+ESRG
Sbjct: 481 VLAEGVEAIKQVYTGMADIGVTDRTMVWNTDLMETLEMDNLLSQAAVTVNGAANREESRG 540

Query: 549 SHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPKA 608
           +HAREDF D     RDD NW KH+L W D   G +K+DYRPVHT  +   ++Y  I PKA
Sbjct: 541 AHAREDFSD-----RDDENWMKHTLAWCD-EAGNVKIDYRPVHTYTMSNDIEY--IKPKA 592

Query: 609 RVY 611
           RVY
Sbjct: 593 RVY 595


>gi|167648793|ref|YP_001686456.1| succinate dehydrogenase flavoprotein subunit [Caulobacter sp. K31]
 gi|167351223|gb|ABZ73958.1| succinate dehydrogenase, flavoprotein subunit [Caulobacter sp. K31]
          Length = 595

 Score =  837 bits (2161), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 404/603 (66%), Positives = 488/603 (80%), Gaps = 9/603 (1%)

Query: 9   SSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLA 68
           S+Y ++DH +DVVVVGAGG+GLRA LG A+ G KTAC+TKVFPTRSHTVAAQGGI+ASL 
Sbjct: 2   SAYKFIDHKFDVVVVGAGGSGLRAALGCAQAGLKTACVTKVFPTRSHTVAAQGGISASLG 61

Query: 69  NMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRP 128
           NM  D W+WH++DT+KGSDWLGD DAI+YL   AP +VYELEH+GVPFSR   GKIYQR 
Sbjct: 62  NMGQDDWRWHMFDTVKGSDWLGDQDAIEYLTRNAPAAVYELEHWGVPFSRTVDGKIYQRA 121

Query: 129 FGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCC 188
           FGG  +N+GEGP +QRTCAAADRTGHA+LHT+YGQ+L ++ EFFIEYFALDLI+  +G C
Sbjct: 122 FGGMTKNFGEGP-IQRTCAAADRTGHAMLHTMYGQSLAHDTEFFIEYFALDLIME-DGVC 179

Query: 189 VGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDME 248
            G+ AW+L+ G +HRF A++V+LATGGYGRAYFSATSAHTCTGDG  M  RAGLPLQDME
Sbjct: 180 RGLTAWKLDDGTLHRFQAQMVILATGGYGRAYFSATSAHTCTGDGNAMALRAGLPLQDME 239

Query: 249 FVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEI 308
           FVQFHPTGIYGAGCLITEGARGEGGYL NS+GERFMERYAPS KDLA RD+VSR M +EI
Sbjct: 240 FVQFHPTGIYGAGCLITEGARGEGGYLTNSEGERFMERYAPSVKDLAPRDMVSRAMTIEI 299

Query: 309 REGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMG 368
           REGRGVG +KDHI L+L+HLDP +L ERLPGISE+A++FAGVDVT+ PIPV+PTVHYNMG
Sbjct: 300 REGRGVGPNKDHIFLHLDHLDPKILHERLPGISETAKVFAGVDVTKAPIPVLPTVHYNMG 359

Query: 369 GIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIR 428
           GIPTNY GEV+  +  NP++  PGLMA+GEA C SVHGANRLGSNSLIDLVVFGRAA +R
Sbjct: 360 GIPTNYHGEVVTKSGDNPDQVIPGLMAVGEAACVSVHGANRLGSNSLIDLVVFGRAAALR 419

Query: 429 ASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQD 488
            +E++   +  P L  S  D  + RFDR R+A+GH PTAALR +MQ+AMQ DA VFRT +
Sbjct: 420 CAEILKPLATQPELKDSMTDGHLARFDRYRNANGHQPTAALRLEMQKAMQEDAAVFRTGE 479

Query: 489 SLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRG 548
           +L  G + L+ +W++  D+KV+DR ++WN+DL+ETLE  NL+  A+ TV  A  R ESRG
Sbjct: 480 TLVGGAQRLAVVWEKAKDIKVNDRGMVWNTDLMETLEFDNLIGQAVVTVAGAVNRTESRG 539

Query: 549 SHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPKA 608
           +HAREDF       RDD NW KH+L W+D +TG++K+D+RPVH   +   +DY  I PK 
Sbjct: 540 AHAREDFST-----RDDANWMKHTLAWLDPSTGQVKIDFRPVHNYTMSKDIDY--IPPKQ 592

Query: 609 RVY 611
           RVY
Sbjct: 593 RVY 595


>gi|103488508|ref|YP_618069.1| succinate dehydrogenase flavoprotein subunit [Sphingopyxis
           alaskensis RB2256]
 gi|98978585|gb|ABF54736.1| succinate dehydrogenase subunit A [Sphingopyxis alaskensis RB2256]
          Length = 604

 Score =  837 bits (2161), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 411/611 (67%), Positives = 470/611 (76%), Gaps = 13/611 (2%)

Query: 7   LKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAAS 66
           +  +Y  +DH YD VVVGAGG+GLRAT+G AE G KTACITKVFPTRSHTVAAQGGIAAS
Sbjct: 1   MTEAYKIIDHIYDTVVVGAGGSGLRATMGSAEAGLKTACITKVFPTRSHTVAAQGGIAAS 60

Query: 67  LANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQ 126
           L N +PD WQWH+YDT+KGSDWLGD DAI+Y+  EAP +VYELEH GVPFSRN  G IYQ
Sbjct: 61  LGNNSPDHWQWHMYDTVKGSDWLGDQDAIEYMVREAPAAVYELEHAGVPFSRNADGTIYQ 120

Query: 127 RPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEG 186
           RPFGGHMQN GEGPPVQRTCAAADRTGHA+LH LY Q+LK +A+FFIEYFALDLI+ +  
Sbjct: 121 RPFGGHMQNMGEGPPVQRTCAAADRTGHAMLHALYQQSLKYDADFFIEYFALDLIMENGA 180

Query: 187 C---CVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLP 243
               C GV+A  +E G IHRF ++ VVLATGGYGR YF+ATSAHTCTGDG GMV RAGLP
Sbjct: 181 NGPECRGVIALCMEDGSIHRFRSQAVVLATGGYGRCYFTATSAHTCTGDGGGMVLRAGLP 240

Query: 244 LQDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRC 303
           LQDMEFVQFHPTGIYGAG LITEGARGEGGYL NS+GERFMERYAPSAKDLASRDVVSR 
Sbjct: 241 LQDMEFVQFHPTGIYGAGVLITEGARGEGGYLTNSEGERFMERYAPSAKDLASRDVVSRS 300

Query: 304 MMMEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTV 363
           M +EIREGRGVG   DHI+L+L+H+DPAVL ERLPGI+ES +IFAGVD+TR P+PV+PTV
Sbjct: 301 MALEIREGRGVGPDADHIYLHLDHIDPAVLAERLPGITESGKIFAGVDLTRQPLPVVPTV 360

Query: 364 HYNMGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGR 423
           HYNMGGIP NY GEV+      P+   PGL A+GEA C SVHGANRLGSNSLIDLVVFGR
Sbjct: 361 HYNMGGIPCNYHGEVVTLGKDGPDTVVPGLFAVGEAACVSVHGANRLGSNSLIDLVVFGR 420

Query: 424 AAVIRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGV 483
           A   R  E++   +    L   S D  + R D  RHA G  PTA +R +MQRAM   A V
Sbjct: 421 ATGHRLKELLTPGAAQQPLPKDSADLALARLDHFRHASGGSPTAEVRTEMQRAMSAHAAV 480

Query: 484 FRTQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEAR 543
           FRT + +++G   L+  +  MAD+ V DRSLIWN+DLVETLEL NL+  A  T++SA  R
Sbjct: 481 FRTDELMAEGKEKLAKTYARMADIHVSDRSLIWNTDLVETLELDNLIAQATVTMHSAFNR 540

Query: 544 KESRGSHAREDFKDGEFGGRDDVNWRKHSLCWVD-W--NTGKIKLDYRPVHTELLCGGVD 600
           KESRG+HA EDF +     RDD NW KHS+ W D W    G ++LDYRPVH   L    +
Sbjct: 541 KESRGAHAHEDFPN-----RDDANWMKHSVAWFDGWGGKGGDVRLDYRPVHEYTLSDDAE 595

Query: 601 YSKIAPKARVY 611
           Y  I PKARVY
Sbjct: 596 Y--IKPKARVY 604


>gi|158425369|ref|YP_001526661.1| succinate dehydrogenase flavoprotein subunit [Azorhizobium
           caulinodans ORS 571]
 gi|158332258|dbj|BAF89743.1| succinate dehydrogenase or fumarate reductase [Azorhizobium
           caulinodans ORS 571]
          Length = 610

 Score =  836 bits (2160), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 410/602 (68%), Positives = 482/602 (80%), Gaps = 8/602 (1%)

Query: 10  SYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLAN 69
           +Y   DH+YDV+VVGAGGAGLRA +G +E G +TAC+TKVFPTRSHTVAAQGG+AASLAN
Sbjct: 17  AYQVTDHTYDVLVVGAGGAGLRAVVGCSEAGLRTACVTKVFPTRSHTVAAQGGVAASLAN 76

Query: 70  MTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRPF 129
           M  D W+WH+YDT+KGSDWLGD DAI+YL   AP +VYELEH+GVPFSR E GKIYQRPF
Sbjct: 77  MGEDKWEWHMYDTVKGSDWLGDQDAIEYLVRNAPAAVYELEHWGVPFSRTEDGKIYQRPF 136

Query: 130 GGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCCV 189
           GG   ++G+G   QRTCAAADRTGHA+LHTLYG ALK+ AEFFIEYFA+DLI++ +G C 
Sbjct: 137 GGMTTHFGKGT-AQRTCAAADRTGHAMLHTLYGAALKHKAEFFIEYFAIDLIMDEDGRCC 195

Query: 190 GVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDMEF 249
           G+VA +++ G +HRF A L +LATGGYGRAYFSATSAHTCTGDG GMV RAGLPLQDMEF
Sbjct: 196 GIVALKMDDGTLHRFRANLTILATGGYGRAYFSATSAHTCTGDGGGMVLRAGLPLQDMEF 255

Query: 250 VQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEIR 309
           VQFHPTGIYG+GCLITEG+RGEGGYL NS+GERFMERYAPSAKDLASRDVVSR M MEIR
Sbjct: 256 VQFHPTGIYGSGCLITEGSRGEGGYLTNSEGERFMERYAPSAKDLASRDVVSRSMTMEIR 315

Query: 310 EGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMGG 369
           EGRGVGK+KDHI L+L+HLDPA+L ERLPGISESARIFAGVDVTR+PIPVIPTVHYNMGG
Sbjct: 316 EGRGVGKNKDHIFLHLDHLDPAILHERLPGISESARIFAGVDVTREPIPVIPTVHYNMGG 375

Query: 370 IPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIRA 429
           IPTNY GEVL+    +P++  PGLMAIGEA C SVHGANRLGSNSLIDLVVFGRAA +RA
Sbjct: 376 IPTNYHGEVLNKVGGDPDKVVPGLMAIGEAACVSVHGANRLGSNSLIDLVVFGRAAALRA 435

Query: 430 SEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQDS 489
           +E++        L     +  + R DR R+A G  PTA LR  MQR MQ +  VFRT + 
Sbjct: 436 AELVRPGEKQRELPADGGELALSRLDRFRNASGDTPTAELRGNMQRVMQNNCAVFRTGEV 495

Query: 490 LSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRGS 549
           L +G   +  ++   ++++V DRSL+WNSDL+ETLE  NL+  A+ T+ SA  RKESRG+
Sbjct: 496 LEEGHTLIHDVFKASSNIRVSDRSLVWNSDLIETLEYDNLIAQAVVTMDSALNRKESRGA 555

Query: 550 HAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPKAR 609
           HAREDF D     RDDVNW KH+L ++D  +G++KL+ RPVHT  L   + Y  I PK R
Sbjct: 556 HAREDFPD-----RDDVNWMKHTLAYIDTASGEVKLEDRPVHTYTLSNDIQY--IEPKKR 608

Query: 610 VY 611
           VY
Sbjct: 609 VY 610


>gi|23014376|ref|ZP_00054196.1| COG1053: Succinate dehydrogenase/fumarate reductase, flavoprotein
           subunit [Magnetospirillum magnetotacticum MS-1]
          Length = 593

 Score =  833 bits (2152), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 409/603 (67%), Positives = 485/603 (80%), Gaps = 11/603 (1%)

Query: 9   SSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLA 68
           ++Y  +DH+YDVVVVGAGGAGLRAT+GM + GFKTACITKVFPTRSHTVAAQGGI ASL 
Sbjct: 2   AAYKIIDHTYDVVVVGAGGAGLRATMGMGQAGFKTACITKVFPTRSHTVAAQGGIGASLG 61

Query: 69  NMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRP 128
           NM  D+W+WH+YDT+KGSDWLGD DAI+Y+  EA  +V+ELEH+GVPFSR   GKIYQRP
Sbjct: 62  NMAEDNWKWHMYDTVKGSDWLGDQDAIEYMCREAVPAVHELEHFGVPFSRTPEGKIYQRP 121

Query: 129 FGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCC 188
           FGGHM N+GE  PVQR CAAADRTGHAILHTLY Q LK+  EFFIEYFA+DLI+ + G C
Sbjct: 122 FGGHMSNFGE-KPVQRACAAADRTGHAILHTLYSQCLKHQCEFFIEYFAIDLIMEN-GAC 179

Query: 189 VGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDME 248
            GV+AW L+ G +HRF A  VVLA+GGYGRA+FS TSAHTCTGDG G+VARAGLPLQDME
Sbjct: 180 RGVIAWNLDDGTLHRFRAHKVVLASGGYGRAFFSCTSAHTCTGDGHGLVARAGLPLQDME 239

Query: 249 FVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEI 308
           FVQFHPTGIYG+GCLITEGARGEGGY+ NS GERFMERYAP+AKDLASRDVVSR M MEI
Sbjct: 240 FVQFHPTGIYGSGCLITEGARGEGGYVTNSAGERFMERYAPTAKDLASRDVVSRAMTMEI 299

Query: 309 REGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMG 368
           REGRGVGK  DHI+L+L HL    L+ RLPGISE+A+IFAGVDVT++PIPV+PTVHYNMG
Sbjct: 300 REGRGVGKENDHIYLHLEHLGAETLELRLPGISETAKIFAGVDVTKEPIPVLPTVHYNMG 359

Query: 369 GIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIR 428
           GIPTN +GEVL   ++NP+    GLMAIGEA C SVHGANRLG+NSL+D+VVFGRA+ +R
Sbjct: 360 GIPTNLYGEVLRPTAENPDATVEGLMAIGEAACVSVHGANRLGTNSLLDIVVFGRASALR 419

Query: 429 ASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQD 488
           A+E +   +P   L     D  + RFDRLR+A+G + T+ +R  MQ+ MQ+DA VFRT  
Sbjct: 420 AAETLKPGTPHKPLPKDGSDLALSRFDRLRNANGSMHTSEIRLAMQKTMQMDAAVFRTSK 479

Query: 489 SLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRG 548
           SL++GC  +  +   +  +K++DRS +WNSDLVE LEL+NLM  A+AT+ SAEAR ESRG
Sbjct: 480 SLAEGCAKMDQVASTLPQIKINDRSTVWNSDLVEALELENLMDCALATIVSAEARHESRG 539

Query: 549 SHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPKA 608
           +HA ED+ D     RDDVNW+KHSL WV+   GK+KLDYRPVHT  L   V+Y  I P+ 
Sbjct: 540 AHAHEDYPD-----RDDVNWQKHSLAWVE--NGKVKLDYRPVHTYTLTDEVEY--IKPQK 590

Query: 609 RVY 611
           RVY
Sbjct: 591 RVY 593


>gi|87199763|ref|YP_497020.1| succinate dehydrogenase flavoprotein subunit [Novosphingobium
           aromaticivorans DSM 12444]
 gi|87135444|gb|ABD26186.1| succinate dehydrogenase subunit A [Novosphingobium aromaticivorans
           DSM 12444]
          Length = 604

 Score =  833 bits (2151), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 407/611 (66%), Positives = 474/611 (77%), Gaps = 12/611 (1%)

Query: 5   SNLKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIA 64
           ++ + +Y  +DH+YD VVVGAGG+GLRAT+G A+ G +TACITKVFPTRSHTVAAQGGIA
Sbjct: 2   TSTQPAYKIIDHTYDTVVVGAGGSGLRATMGSAQAGLRTACITKVFPTRSHTVAAQGGIA 61

Query: 65  ASLANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKI 124
           ASL N +PD W WH+YDT+KGSDWLGD DAI+Y+  EAP +VYELEH GVPFSRN  G I
Sbjct: 62  ASLGNNSPDHWTWHMYDTVKGSDWLGDQDAIEYMVREAPAAVYELEHAGVPFSRNPEGTI 121

Query: 125 YQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINS 184
           YQRPFGGHMQN GEGPPVQRTCAAADRTGHA+LH LY Q+LK +A+FFIEYFA+DLI+ +
Sbjct: 122 YQRPFGGHMQNMGEGPPVQRTCAAADRTGHAMLHALYQQSLKYDADFFIEYFAIDLIMEN 181

Query: 185 EGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPL 244
            G C GV+A  ++ G IHRF +  VVLATGGYGR+YF+ATSAHTCTGDG GMV RAGLPL
Sbjct: 182 -GECRGVIALCMDDGSIHRFRSHAVVLATGGYGRSYFTATSAHTCTGDGGGMVLRAGLPL 240

Query: 245 QDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCM 304
           QDMEFVQFHPTGIYGAG LITEGARGEGGYL NS+GERFMERYAPSAKDLASRDVVSR M
Sbjct: 241 QDMEFVQFHPTGIYGAGVLITEGARGEGGYLTNSEGERFMERYAPSAKDLASRDVVSRSM 300

Query: 305 MMEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVH 364
            MEIREGRGVG  KDHI+L+L+H+D  VL ERLPGI+ES +IFAGVD+TR P+PV+PTVH
Sbjct: 301 AMEIREGRGVGPHKDHIYLHLDHIDQKVLAERLPGITESGKIFAGVDLTRQPLPVVPTVH 360

Query: 365 YNMGGIPTNYWGEVLDANSK-NPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGR 423
           YNMGGIPTNY GEV+   +  NPE   PGL A+GEA C SVHGANRLGSNSLIDLVVFGR
Sbjct: 361 YNMGGIPTNYHGEVVTIGADGNPETIVPGLFAVGEAACVSVHGANRLGSNSLIDLVVFGR 420

Query: 424 AAVIRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGV 483
           A  +R  E+I   +   SL   S D  + R D  RHA G  PTA +R +MQR M   A V
Sbjct: 421 ATGLRLKELIKPGTAHNSLPKDSADLALTRLDHFRHAKGGSPTAEVRIEMQRTMSAHAAV 480

Query: 484 FRTQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEAR 543
           FRT + +++G   L+  +  M D+ V DRSLIWNSDLVETLEL NL+  A  T++SA  R
Sbjct: 481 FRTDELMAEGKVKLADTYKRMEDIHVSDRSLIWNSDLVETLELDNLISQATVTMHSAHNR 540

Query: 544 KESRGSHAREDFKDGEFGGRDDVNWRKHSLCWVD-W--NTGKIKLDYRPVHTELLCGGVD 600
           KESRG+HA EDF D     R+D  W KH+  W + W    G++++DYRPVH   L   V+
Sbjct: 541 KESRGAHAHEDFPD-----RNDAEWMKHTATWFNGWGGKGGEVRIDYRPVHEYTLTDDVE 595

Query: 601 YSKIAPKARVY 611
           Y  I PK RVY
Sbjct: 596 Y--IKPKKRVY 604


>gi|197103678|ref|YP_002129055.1| succinate dehydrogenase, flavoprotein subunit [Phenylobacterium
           zucineum HLK1]
 gi|196477098|gb|ACG76626.1| succinate dehydrogenase, flavoprotein subunit [Phenylobacterium
           zucineum HLK1]
          Length = 595

 Score =  832 bits (2148), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 408/603 (67%), Positives = 481/603 (79%), Gaps = 9/603 (1%)

Query: 9   SSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLA 68
           ++Y ++DH +DVVVVGAGG+GLRA LG A+ G KTACITKVFPTRSHTVAAQGGI+ASL 
Sbjct: 2   AAYEFIDHKFDVVVVGAGGSGLRAALGCAQAGLKTACITKVFPTRSHTVAAQGGISASLG 61

Query: 69  NMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRP 128
           NM  D W+WH+YDT+KGSDWLGD DAI+YL   AP +VYELEH+GVPFSR   GKIYQR 
Sbjct: 62  NMGEDDWRWHMYDTVKGSDWLGDQDAIEYLCRNAPAAVYELEHWGVPFSRTADGKIYQRA 121

Query: 129 FGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCC 188
           FGG  +N+GE P +QRTCAAADRTGHA+LHT+YGQ+L ++ EFFIE+FALDLI++ EG C
Sbjct: 122 FGGMTRNFGEAP-IQRTCAAADRTGHAMLHTMYGQSLAHDTEFFIEFFALDLIMD-EGVC 179

Query: 189 VGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDME 248
            GV AW+L+ G +HRF A++V+LATGGYGRAYFS TSAHTCTGDG GM  RAGLPLQDME
Sbjct: 180 RGVTAWKLDDGTLHRFQAQMVILATGGYGRAYFSCTSAHTCTGDGGGMALRAGLPLQDME 239

Query: 249 FVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEI 308
           FVQFHPTGIYGAGCLITEGARGEGGYL NS+GERFMERYAP+ KDLA RD+VSR M +EI
Sbjct: 240 FVQFHPTGIYGAGCLITEGARGEGGYLTNSEGERFMERYAPTVKDLAPRDMVSRAMTIEI 299

Query: 309 REGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMG 368
           REGRGVG +KDHI L+L+HLDP +L ERLPGISESA+IFAGVDVT++PIPV+PTVHYNMG
Sbjct: 300 REGRGVGPNKDHIFLHLDHLDPKILAERLPGISESAKIFAGVDVTKEPIPVLPTVHYNMG 359

Query: 369 GIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIR 428
           GIPTN++ EV+    KNP++  PGLMA+GEA C SVHGANRLGSNSLIDLVVFGR+A +R
Sbjct: 360 GIPTNFYSEVVTKAGKNPDQVVPGLMAVGEAACVSVHGANRLGSNSLIDLVVFGRSAALR 419

Query: 429 ASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQD 488
           A++++   +  P L     D  + RFDR RHA G VPTA LR +MQRAMQ DA VFRT +
Sbjct: 420 AADVLTPGASQPELKDHMTDGHLARFDRFRHAAGEVPTAELRLEMQRAMQEDAAVFRTGE 479

Query: 489 SLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRG 548
           SL+ G + L  + D+   ++V DRS+IWNSDL+ETLE  NL+  A  TV  A  R ESRG
Sbjct: 480 SLTSGVKRLQAVHDKRKHIRVTDRSMIWNSDLMETLEFDNLVGQAAVTVNGAANRTESRG 539

Query: 549 SHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPKA 608
           +HAREDF D     RDD  W KH+L W D  TGK+KLD RPVH   +   + Y  I PKA
Sbjct: 540 AHAREDFPD-----RDDKKWMKHTLAWFDDKTGKVKLDDRPVHNFTMSNDIAY--IPPKA 592

Query: 609 RVY 611
           RVY
Sbjct: 593 RVY 595


>gi|332188545|ref|ZP_08390265.1| succinate dehydrogenase, flavoprotein subunit [Sphingomonas sp.
           S17]
 gi|332011450|gb|EGI53535.1| succinate dehydrogenase, flavoprotein subunit [Sphingomonas sp.
           S17]
          Length = 602

 Score =  831 bits (2147), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 404/606 (66%), Positives = 468/606 (77%), Gaps = 10/606 (1%)

Query: 9   SSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLA 68
           ++Y  +DH+YD VVVGAGG+GLRAT+G+AE G KTACITKVFPTRSHTVAAQGGIAASL 
Sbjct: 4   AAYKIIDHTYDAVVVGAGGSGLRATMGIAEAGLKTACITKVFPTRSHTVAAQGGIAASLG 63

Query: 69  NMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRP 128
           NM PD W WH+YDT+KGSDWLGD DAI+YL  EAP +VYELEH GVPFSR E GKIYQRP
Sbjct: 64  NMGPDHWTWHMYDTVKGSDWLGDQDAIEYLCREAPAAVYELEHAGVPFSRTEEGKIYQRP 123

Query: 129 FGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCC 188
           FGG MQN GEGPP QRTCAAADRTGHA+LH LY Q+LK +A+FFIEYFALDLI++ +G C
Sbjct: 124 FGGMMQNMGEGPPAQRTCAAADRTGHAMLHALYQQSLKYDADFFIEYFALDLIMDEQGNC 183

Query: 189 VGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDME 248
            GV+A  +E G IHRF A  VVLATGGYGR YFSATSAHTCTGDG GMV RAGLPLQDME
Sbjct: 184 RGVIALCMEDGSIHRFRAHNVVLATGGYGRCYFSATSAHTCTGDGGGMVLRAGLPLQDME 243

Query: 249 FVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEI 308
           FVQFHPTGIYGAG LITEGARGEGGYL NS+GERFMERYAPSAKDLASRDVVSR M MEI
Sbjct: 244 FVQFHPTGIYGAGVLITEGARGEGGYLTNSEGERFMERYAPSAKDLASRDVVSRSMAMEI 303

Query: 309 REGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMG 368
           REGRGVGK  DHI+L+L+H+DP VL ERLPGI+E+ +IFAGVD+TR P+PV PTVHYNMG
Sbjct: 304 REGRGVGKEGDHIYLHLDHIDPKVLAERLPGITETGKIFAGVDLTRQPLPVTPTVHYNMG 363

Query: 369 GIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIR 428
           GIPTNY GEV+     NP+   PGL A+GEA C SVHGANRLGSNSLIDLVVFGRA  +R
Sbjct: 364 GIPTNYHGEVVRLKDGNPDSVVPGLFAVGEAACVSVHGANRLGSNSLIDLVVFGRATGLR 423

Query: 429 ASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQD 488
             + +   +P   L   S +  + R D  R+A G   TA +R +MQ+ MQ    VFRT +
Sbjct: 424 IKDTLKPGTPHAPLPAGSEELALSRLDHFRNAAGGSTTAQVRSEMQKTMQRHCAVFRTDE 483

Query: 489 SLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRG 548
            L++G + +   ++ M D+ + DRSLIWN+DLVETLEL NL+  A+ T+ SA  RKESRG
Sbjct: 484 LLTEGRQMIRATYNRMKDIGIKDRSLIWNTDLVETLELDNLISQAVVTMESALNRKESRG 543

Query: 549 SHAREDFKDGEFGGRDDVNWRKHSLCWVD---WNTGKIKLDYRPVHTELLCGGVDYSKIA 605
           +H  EDF D     RDD NW KH++   D      G +++DYRPVH   L   ++Y  I 
Sbjct: 544 AHVNEDFPD-----RDDANWMKHTVATFDGWGGQGGGVEIDYRPVHDYTLTDDIEY--IK 596

Query: 606 PKARVY 611
           PK RVY
Sbjct: 597 PKKRVY 602


>gi|326387617|ref|ZP_08209223.1| succinate dehydrogenase flavoprotein subunit [Novosphingobium
           nitrogenifigens DSM 19370]
 gi|326207663|gb|EGD58474.1| succinate dehydrogenase flavoprotein subunit [Novosphingobium
           nitrogenifigens DSM 19370]
          Length = 601

 Score =  830 bits (2143), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 407/609 (66%), Positives = 472/609 (77%), Gaps = 12/609 (1%)

Query: 7   LKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAAS 66
           + ++Y  +DH+YD VVVGAGG+GLRAT+G A+ G +TACITKVFPTRSHTVAAQGGIAAS
Sbjct: 1   MTAAYKIIDHTYDTVVVGAGGSGLRATMGSAQAGLRTACITKVFPTRSHTVAAQGGIAAS 60

Query: 67  LANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQ 126
           L N TPD W WH+YDT+KGSDWLGD DAI+Y+  EAP +VYELEH GVPFSRN  G IYQ
Sbjct: 61  LCNNTPDHWTWHMYDTVKGSDWLGDQDAIEYMVREAPAAVYELEHAGVPFSRNADGTIYQ 120

Query: 127 RPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEG 186
           RPFGGHMQN G+GPPVQRTCAAADRTGHA+LH LY Q+LK +A+FFIEYFA+DLI+ + G
Sbjct: 121 RPFGGHMQNMGDGPPVQRTCAAADRTGHAMLHALYQQSLKYDADFFIEYFAIDLIMEN-G 179

Query: 187 CCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQD 246
            C GV+A  L+ G IHRF +  VVLATGGYGR Y++ATSAHTCTGDG GMV RAGLPLQD
Sbjct: 180 VCRGVIALCLDDGSIHRFRSHAVVLATGGYGRCYYTATSAHTCTGDGGGMVLRAGLPLQD 239

Query: 247 MEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMM 306
           MEFVQFHPTGIYGAG LITEGARGEGGYL NS+GERFMERYAPSAKDLASRDVVSR M M
Sbjct: 240 MEFVQFHPTGIYGAGVLITEGARGEGGYLTNSEGERFMERYAPSAKDLASRDVVSRSMAM 299

Query: 307 EIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYN 366
           EIREGRGVG  KDHI+L+L+H+D  VL ERLPGI+ES +IFAGVD+TR P+PV+PTVHYN
Sbjct: 300 EIREGRGVGPHKDHIYLHLDHIDSKVLAERLPGITESGKIFAGVDLTRQPLPVVPTVHYN 359

Query: 367 MGGIPTNYWGEVLDANSK-NPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAA 425
           MGGIPTNY GEV+   +  NP+   PGL A+GEA C SVHGANRLGSNSLIDLVVFGRA 
Sbjct: 360 MGGIPTNYHGEVVTLGADGNPDTVVPGLFAVGEAACVSVHGANRLGSNSLIDLVVFGRAT 419

Query: 426 VIRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFR 485
            +R  E++   +   SL   S D  + R D  R+A G  PT+ +R +MQRAM   A VFR
Sbjct: 420 GLRLKEIVKPGAAHASLPKDSADLALTRLDHFRNAKGGSPTSQIRVEMQRAMSQHAAVFR 479

Query: 486 TQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKE 545
           T + +++G   L+  ++ M D+ V DRSLIWNSDL+ETLEL NL+  A  T+ SA  RKE
Sbjct: 480 TDEVMAEGKVKLAKTYERMQDVAVSDRSLIWNSDLIETLELDNLISQANVTMCSAHNRKE 539

Query: 546 SRGSHAREDFKDGEFGGRDDVNWRKHSLCWVD-W--NTGKIKLDYRPVHTELLCGGVDYS 602
           SRG+HA EDF       RDD NW KH++ W D W    G I+LDYRPVH   L     Y 
Sbjct: 540 SRGAHAHEDFPT-----RDDANWMKHTIAWFDGWGGKGGNIRLDYRPVHEYTLTDDATY- 593

Query: 603 KIAPKARVY 611
            I PKARVY
Sbjct: 594 -IKPKARVY 601


>gi|83313051|ref|YP_423315.1| succinate dehydrogenase flavoprotein subunit [Magnetospirillum
           magneticum AMB-1]
 gi|82947892|dbj|BAE52756.1| Succinate dehydrogenase/fumarate reductase, flavoprotein subunit
           [Magnetospirillum magneticum AMB-1]
          Length = 593

 Score =  829 bits (2142), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 410/603 (67%), Positives = 482/603 (79%), Gaps = 11/603 (1%)

Query: 9   SSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLA 68
           ++Y  +DH+YDVVVVGAGGAGLRAT+GM + GFKTACITKVFPTRSHTVAAQGGI ASL 
Sbjct: 2   AAYKIIDHTYDVVVVGAGGAGLRATMGMGQAGFKTACITKVFPTRSHTVAAQGGIGASLG 61

Query: 69  NMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRP 128
           NM  D+W+WH+YDT+KGSDWLGD DAI+Y+  EA  +V+ELEH+GVPFSR   GKIYQRP
Sbjct: 62  NMAEDNWKWHMYDTVKGSDWLGDQDAIEYMCREAVPAVHELEHFGVPFSRTPEGKIYQRP 121

Query: 129 FGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCC 188
           FGGHM N+GE  PVQR CAAADRTGHAILHTLY Q LK+  EFFIEYFA+DLI+ + G C
Sbjct: 122 FGGHMSNFGE-KPVQRACAAADRTGHAILHTLYSQCLKHQCEFFIEYFAIDLIMEN-GAC 179

Query: 189 VGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDME 248
            GVVAW L+ G +HRF A  VVLA+GGYGRA+FS TSAHTCTGDG G+VARAGLPLQDME
Sbjct: 180 RGVVAWNLDDGTLHRFRAHKVVLASGGYGRAFFSCTSAHTCTGDGHGLVARAGLPLQDME 239

Query: 249 FVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEI 308
           FVQFHPTGIYG+GCLITEGARGEGGY+ NS GERFMERYAP+AKDLASRDVVSR M MEI
Sbjct: 240 FVQFHPTGIYGSGCLITEGARGEGGYVTNSAGERFMERYAPTAKDLASRDVVSRAMTMEI 299

Query: 309 REGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMG 368
           REGRGVGK  DHI L+L HL    L+ RLPGISE+A+IFAGVDVT++PIPV+PTVHYNMG
Sbjct: 300 REGRGVGKEHDHIFLHLEHLGAETLELRLPGISETAKIFAGVDVTKEPIPVLPTVHYNMG 359

Query: 369 GIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIR 428
           GIPTN +GEVL   ++NP+    GLMAIGEA C SVHGANRLG+NSL+D+VVFGRA  +R
Sbjct: 360 GIPTNVYGEVLRPTAENPDATVEGLMAIGEAACVSVHGANRLGTNSLLDIVVFGRACALR 419

Query: 429 ASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQD 488
           A+E +   +    L     D  + RFDRLR+A+G + T+ +R  MQ+ MQ+DA VFRT  
Sbjct: 420 AAETMKPGTAHKPLPKDGSDLALSRFDRLRNANGSMHTSEIRLAMQKTMQMDAAVFRTSK 479

Query: 489 SLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRG 548
           SL++GC  +  +   +  LK++DRS +WNSDLVE LEL+NLM  A+AT+ SAEAR ESRG
Sbjct: 480 SLAEGCAKMDQVASTLPQLKINDRSTVWNSDLVEALELENLMDCALATIVSAEARHESRG 539

Query: 549 SHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPKA 608
           +HA ED+ D     RDDVNW+KHSL WV+   GK+KLDYRPVHT  L   V+Y  I P+ 
Sbjct: 540 AHAHEDYPD-----RDDVNWQKHSLAWVE--NGKVKLDYRPVHTYTLTDEVEY--IKPQK 590

Query: 609 RVY 611
           RVY
Sbjct: 591 RVY 593


>gi|94496884|ref|ZP_01303458.1| succinate dehydrogenase, flavoprotein subunit [Sphingomonas sp.
           SKA58]
 gi|94423560|gb|EAT08587.1| succinate dehydrogenase, flavoprotein subunit [Sphingomonas sp.
           SKA58]
          Length = 600

 Score =  829 bits (2141), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 406/608 (66%), Positives = 471/608 (77%), Gaps = 11/608 (1%)

Query: 7   LKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAAS 66
           +  +Y  +DH+YD VVVGAGG+GLRAT+G AE G KTACITK+FPTRSHTVAAQGGIAAS
Sbjct: 1   MTEAYKIIDHTYDTVVVGAGGSGLRATMGSAEAGLKTACITKLFPTRSHTVAAQGGIAAS 60

Query: 67  LANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQ 126
           L N +PD W WH+YDT+KGSDWLGD DAI+Y+  EAP +V ELEH GVPFSRNE G IYQ
Sbjct: 61  LGNNSPDHWTWHMYDTVKGSDWLGDQDAIEYMVREAPAAVIELEHAGVPFSRNENGTIYQ 120

Query: 127 RPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEG 186
           RPFGGHMQN GEGPPVQRTCAAADRTGHA+LH LY Q+LK +A+F+IEYFA+DLI+ + G
Sbjct: 121 RPFGGHMQNMGEGPPVQRTCAAADRTGHAMLHALYQQSLKYDADFYIEYFAIDLIMEN-G 179

Query: 187 CCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQD 246
            C GV+A  +E G IHRF A  VVLATGGYGRAYFSATSAH+CTGDG GMV RAGLPLQD
Sbjct: 180 ECRGVIAICMEDGSIHRFRAHAVVLATGGYGRAYFSATSAHSCTGDGGGMVLRAGLPLQD 239

Query: 247 MEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMM 306
           +EFVQFHPTGIYGAG LITEGARGEGGYL NS+GERFMERYAPSAKDLASRDVVSR M M
Sbjct: 240 LEFVQFHPTGIYGAGVLITEGARGEGGYLTNSEGERFMERYAPSAKDLASRDVVSRSMAM 299

Query: 307 EIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYN 366
           E+REGRGVG +KDHI L+L+H+DP VL ERLPGI+ES +IFAGVD+TR P+PV PTVHYN
Sbjct: 300 EMREGRGVGPNKDHIFLHLDHIDPKVLAERLPGITESGKIFAGVDLTRQPLPVTPTVHYN 359

Query: 367 MGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAV 426
           MGGIP NY G+V+     +PE   PGL A+GEA C SVHGANRLGSNSLIDLVVFGRA  
Sbjct: 360 MGGIPCNYHGQVVTKIGDDPEVVVPGLYAVGEAACVSVHGANRLGSNSLIDLVVFGRATG 419

Query: 427 IRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRT 486
           +   E +  +     L   + D  + R D  R+A G  PTAA+R +MQ  MQ  A VFR 
Sbjct: 420 LHLKETLKPNGSHKPLPKDAADLALSRLDTYRNAKGGSPTAAIRLEMQHTMQKHAAVFRD 479

Query: 487 QDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKES 546
            + L++G + ++ +   M D+ V DRSLIWN+DL+ETLEL NLM +A+ T+ SAE RKES
Sbjct: 480 SELLAEGVQKMAQVNKRMEDVSVADRSLIWNTDLIETLELDNLMSSAVCTMVSAENRKES 539

Query: 547 RGSHAREDFKDGEFGGRDDVNWRKHSLCWVD-W--NTGKIKLDYRPVHTELLCGGVDYSK 603
           RG+HA EDF +     RDD NW KH++ W D W    GK+ LDYRPVH   L    DY  
Sbjct: 540 RGAHAHEDFPN-----RDDENWMKHTISWFDGWGGQGGKVSLDYRPVHDYTLTDEADY-- 592

Query: 604 IAPKARVY 611
           I PKARVY
Sbjct: 593 IKPKARVY 600


>gi|289665885|ref|ZP_06487466.1| succinate dehydrogenase flavoprotein subunit [Xanthomonas
           campestris pv. vasculorum NCPPB702]
          Length = 596

 Score =  828 bits (2140), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/603 (65%), Positives = 466/603 (77%), Gaps = 8/603 (1%)

Query: 9   SSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLA 68
           S+Y   +H YD+VVVGAGGAGLRAT G+A+KG +T C+TKVFPTRSHTVAAQGGI+A+L 
Sbjct: 2   SAYKITEHKYDMVVVGAGGAGLRATFGLAQKGLQTVCLTKVFPTRSHTVAAQGGISAALG 61

Query: 69  NMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRP 128
           NM  D W++H YDTIKGSDWLGD DAI+Y+  EA  ++ ELEHYGVPFSR E GKIYQRP
Sbjct: 62  NMGEDDWRYHFYDTIKGSDWLGDQDAIEYMCREAIPAIIELEHYGVPFSRTEDGKIYQRP 121

Query: 129 FGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCC 188
           FGG    YGEGP  QRTCAAADRTGHA+LHTLY Q+L +NA F IEYFALDLI + EG C
Sbjct: 122 FGGMTTKYGEGPSAQRTCAAADRTGHAMLHTLYQQSLAHNARFMIEYFALDLIFDEEGVC 181

Query: 189 VGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDME 248
            GV+A  +  G +H F A  VVLATGGYGRAYFSATSAHTCTGDG G+V RAGLP+QDME
Sbjct: 182 RGVLALDMAEGSLHLFRAHGVVLATGGYGRAYFSATSAHTCTGDGGGLVMRAGLPVQDME 241

Query: 249 FVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEI 308
           FVQFHPTGIYGAGCLITEG RGEGG L NS GERFMERYAP  KDLASRDVVSR M +EI
Sbjct: 242 FVQFHPTGIYGAGCLITEGVRGEGGILRNSNGERFMERYAPHYKDLASRDVVSRSMTVEI 301

Query: 309 REGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMG 368
           REGRGVG+ KDHI L L HL P V+ E+LPGI+ESA IFAGVDVT+ PIPV+PTVHYNMG
Sbjct: 302 REGRGVGEHKDHILLDLTHLGPEVINEKLPGIAESAHIFAGVDVTKQPIPVLPTVHYNMG 361

Query: 369 GIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIR 428
           GIPTN++GEV+     +P+   PGL AIGEA C SVHGANRLGSNSL+DLVVFGRA   R
Sbjct: 362 GIPTNFYGEVVRKQGDDPDAVVPGLYAIGEAACVSVHGANRLGSNSLLDLVVFGRAVANR 421

Query: 429 ASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQD 488
            +E +  + P  +L   +CD+ +   D+LRHA+G  PT+ +R+ MQR MQ DA VFRT  
Sbjct: 422 CAETVKPNQPHKTLPSDACDKALGLLDKLRHANGSTPTSVIRDNMQRTMQSDAAVFRTSK 481

Query: 489 SLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRG 548
           +L +G   ++ ++    D+KV DRSL+WNSDL+ET EL NL++NA+AT+ SAE RKESRG
Sbjct: 482 TLKEGVNKMAEIFATFEDVKVSDRSLVWNSDLIETYELNNLLLNAVATINSAEQRKESRG 541

Query: 549 SHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPKA 608
           +H+ EDF D     RDDVNW+KH+L  VD + GK + DYRPVH   L   VD   + PK 
Sbjct: 542 AHSHEDFPD-----RDDVNWQKHTLVTVD-DKGKCEFDYRPVHMYTLSKDVDV--VPPKP 593

Query: 609 RVY 611
           RVY
Sbjct: 594 RVY 596


>gi|166712286|ref|ZP_02243493.1| succinate dehydrogenase flavoprotein subunit [Xanthomonas oryzae
           pv. oryzicola BLS256]
          Length = 596

 Score =  828 bits (2139), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/603 (65%), Positives = 466/603 (77%), Gaps = 8/603 (1%)

Query: 9   SSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLA 68
           S+Y   +H YD+VVVGAGGAGLRAT G+A+KG +T C+TKVFPTRSHTVAAQGGI+A+L 
Sbjct: 2   SAYKITEHKYDMVVVGAGGAGLRATFGLAQKGLQTVCLTKVFPTRSHTVAAQGGISAALG 61

Query: 69  NMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRP 128
           NM  D W++H YDTIKGSDWLGD DAI+Y+  EA  ++ ELEHYGVPFSR E GKIYQRP
Sbjct: 62  NMGEDDWRYHFYDTIKGSDWLGDQDAIEYMCREAIPAIIELEHYGVPFSRTEDGKIYQRP 121

Query: 129 FGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCC 188
           FGG    YGEGP  QRTCAAADRTGHA+LHTLY Q+L +NA F IEYFALDLI + EG C
Sbjct: 122 FGGMTTKYGEGPSAQRTCAAADRTGHAMLHTLYQQSLAHNARFMIEYFALDLIFDEEGVC 181

Query: 189 VGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDME 248
            GV+A  +  G +H F A  VVLATGGYGRAYFSATSAHTCTGDG G+V RAGLP+QDME
Sbjct: 182 RGVLALDMAEGSLHLFRAHGVVLATGGYGRAYFSATSAHTCTGDGGGLVMRAGLPVQDME 241

Query: 249 FVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEI 308
           FVQFHPTGIYGAGCLITEG RGEGG L NS GERFMERYAP  KDLASRDVVSR M +EI
Sbjct: 242 FVQFHPTGIYGAGCLITEGVRGEGGILRNSNGERFMERYAPHYKDLASRDVVSRSMTVEI 301

Query: 309 REGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMG 368
           REGRGVG+ KDHI L L HL P V+ E+LPGI+ESA IFAGVDVT+ PIPV+PTVHYNMG
Sbjct: 302 REGRGVGEHKDHILLDLTHLGPEVINEKLPGIAESAHIFAGVDVTKQPIPVLPTVHYNMG 361

Query: 369 GIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIR 428
           GIPTN++GEV+     +P+   PGL AIGEA C SVHGANRLGSNSL+DLVVFGRA   R
Sbjct: 362 GIPTNFYGEVVRKQGDDPDAVVPGLYAIGEAACVSVHGANRLGSNSLLDLVVFGRAVANR 421

Query: 429 ASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQD 488
            +E +  + P  +L   +CD+ +   D+LRHA+G  PT+ +R+ MQR MQ DA VFRT  
Sbjct: 422 CAETVKPNQPHKTLPSDACDKALGLLDKLRHANGSTPTSVIRDNMQRTMQSDAAVFRTSK 481

Query: 489 SLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRG 548
           +L +G   ++ ++    D+KV DRSL+WNSDL+ET EL NL++NA+AT+ SAE RKESRG
Sbjct: 482 TLKEGVDKMAQIFATFEDVKVSDRSLVWNSDLIETYELNNLLLNAVATINSAEQRKESRG 541

Query: 549 SHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPKA 608
           +H+ EDF D     RDDVNW+KH+L  VD + GK + DYRPVH   L   VD   + PK 
Sbjct: 542 AHSHEDFPD-----RDDVNWQKHTLVTVD-DKGKCEFDYRPVHMYTLSKDVDV--VPPKP 593

Query: 609 RVY 611
           RVY
Sbjct: 594 RVY 596


>gi|262277893|ref|ZP_06055686.1| succinate dehydrogenase, flavoprotein subunit [alpha
           proteobacterium HIMB114]
 gi|262224996|gb|EEY75455.1| succinate dehydrogenase, flavoprotein subunit [alpha
           proteobacterium HIMB114]
          Length = 592

 Score =  828 bits (2138), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 404/602 (67%), Positives = 481/602 (79%), Gaps = 11/602 (1%)

Query: 10  SYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLAN 69
           SY  ++H YDVVVVGAGG+GLRA +G++E G KTAC++KVFPTRSHT AAQGGI+A+L N
Sbjct: 2   SYDVINHEYDVVVVGAGGSGLRAAVGLSEAGLKTACVSKVFPTRSHTAAAQGGISAALGN 61

Query: 70  MTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRPF 129
           M  D W+WH+YDT+KG+DWLGD DAI++L  EAPQ+V ELE YGVPFSR E GKIYQRPF
Sbjct: 62  MCEDDWRWHMYDTVKGADWLGDQDAIEFLCKEAPQAVIELEKYGVPFSRTEEGKIYQRPF 121

Query: 130 GGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCCV 189
           GG  +NYG G  VQRTCAAADRTGHAILHTLYGQALK + EFFIEYFALDLI+ + G C 
Sbjct: 122 GGMTKNYGNGV-VQRTCAAADRTGHAILHTLYGQALKRDTEFFIEYFALDLIMEN-GKCQ 179

Query: 190 GVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDMEF 249
           G++AW L+ G IHRF +K+V+LATGGYGRAYFSATSAHTCTGDG GMV RAGLPLQDMEF
Sbjct: 180 GIIAWNLQDGTIHRFRSKMVILATGGYGRAYFSATSAHTCTGDGGGMVLRAGLPLQDMEF 239

Query: 250 VQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEIR 309
           VQFHPTGIYGAGCLITEG+RGEGG+LVNS+GERFMERYAPSAKDLASRDVVSR M +EI 
Sbjct: 240 VQFHPTGIYGAGCLITEGSRGEGGFLVNSEGERFMERYAPSAKDLASRDVVSRSMTVEIN 299

Query: 310 EGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMGG 369
           EGRGVGK+KDHI L+LNHLD  +L+ERLPGISESA++FAGVDVT++PIPV+PTVHYNMGG
Sbjct: 300 EGRGVGKNKDHIFLHLNHLDSKILKERLPGISESAKVFAGVDVTKEPIPVLPTVHYNMGG 359

Query: 370 IPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIRA 429
           IPTNY+GEVL  ++   +    GLMA+GEA C SVHGANRLGSNSLIDLVVFG+AA +RA
Sbjct: 360 IPTNYFGEVLSKDANGSDTIVDGLMAVGEAACVSVHGANRLGSNSLIDLVVFGKAAAVRA 419

Query: 430 SEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQDS 489
           +E +  +S    +  +   + +DRFD++R+ADG  PT+ LR+KMQR MQ    VFRT  +
Sbjct: 420 AEKVKPNSKHEDISDAETQKCLDRFDKMRNADGDTPTSVLRDKMQRTMQSKCAVFRTDKT 479

Query: 490 LSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRGS 549
           L +G   +   W  + ++ + DRSLI+N+DLVE LE  NL+  +  TV SAE RKESRG+
Sbjct: 480 LREGLNEIQEPWQGLNNISIKDRSLIFNTDLVEALEFDNLIRQSQVTVASAENRKESRGA 539

Query: 550 HAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPKAR 609
           H+REDFK+     RDD NW KH+L W +   GK+KL+YR VH   L   V Y    PKAR
Sbjct: 540 HSREDFKE-----RDDNNWMKHTLAWHE--DGKVKLNYRDVHNYTLTNDVQY--FPPKAR 590

Query: 610 VY 611
           VY
Sbjct: 591 VY 592


>gi|300024741|ref|YP_003757352.1| succinate dehydrogenase, flavoprotein subunit [Hyphomicrobium
           denitrificans ATCC 51888]
 gi|299526562|gb|ADJ25031.1| succinate dehydrogenase, flavoprotein subunit [Hyphomicrobium
           denitrificans ATCC 51888]
          Length = 615

 Score =  828 bits (2138), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 416/603 (68%), Positives = 472/603 (78%), Gaps = 7/603 (1%)

Query: 9   SSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLA 68
            +Y  VDH YDVVVVGAGGAGLRATLG AE G KTAC+TKVFPTRSHTVAAQGG+AA+L 
Sbjct: 20  KAYPIVDHQYDVVVVGAGGAGLRATLGCAEAGLKTACVTKVFPTRSHTVAAQGGVAAALG 79

Query: 69  NMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRP 128
           NM PD W+WH+YDT+KGSDWLGD DAI+YL   AP +VYELEHYGVPFSR E GKIYQRP
Sbjct: 80  NMGPDDWRWHMYDTVKGSDWLGDQDAIEYLCRHAPAAVYELEHYGVPFSRTEDGKIYQRP 139

Query: 129 FGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCC 188
           FGG   ++GEGPP QRTCAAADRTGHA+LHTLYGQ+L+  AEFF+EYFALDLI++ +G C
Sbjct: 140 FGGMTTDFGEGPPAQRTCAAADRTGHAMLHTLYGQSLRYAAEFFVEYFALDLIMDRDGAC 199

Query: 189 VGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDME 248
            G++A  LE G +HRF AK  +LATGGYGR YFS TSAHTCTGDG  MV RAGLPLQDME
Sbjct: 200 RGIIALSLEDGTLHRFRAKKTILATGGYGRTYFSCTSAHTCTGDGNAMVLRAGLPLQDME 259

Query: 249 FVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEI 308
           FVQFHPTGIYGAG LITEGARGEGGYL NSKGERFMERYAP AKDLASRDVVSR M +EI
Sbjct: 260 FVQFHPTGIYGAGVLITEGARGEGGYLTNSKGERFMERYAPHAKDLASRDVVSRSMTVEI 319

Query: 309 REGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMG 368
           REGRGVG   DHI L+L+HLDP +L ERLPGI+ESA++FAGVD+ R PIPV+PTVHYNMG
Sbjct: 320 REGRGVGAEGDHIFLHLDHLDPKILAERLPGITESAKVFAGVDLRRQPIPVLPTVHYNMG 379

Query: 369 GIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIR 428
           GIPTNY GEVL     NP+   PGLMAIGEA C SVHGANRLGSNSLIDLVVFGRAA +R
Sbjct: 380 GIPTNYHGEVLTKKDGNPDHVVPGLMAIGEAACVSVHGANRLGSNSLIDLVVFGRAAGLR 439

Query: 429 ASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQD 488
            +E I+  +    L   + D+I+DR DR R A G  PT+ALR +MQ+ MQ +  VFR   
Sbjct: 440 CAETIETGAMQTELPKDADDKILDRLDRFRFAKGSTPTSALRLRMQKTMQANCAVFRDGP 499

Query: 489 SLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRG 548
            L +G   ++ +W + AD+ V DRSLIWNSDLVETLE  NL+  A  TV  AE RKESRG
Sbjct: 500 VLKEGVEKIAAVWRDAADISVTDRSLIWNSDLVETLEFDNLIAQAAVTVTGAENRKESRG 559

Query: 549 SHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPKA 608
           +HARED+       RDDVNW KH+L W D+ T  +KLD RPVHT  +   V Y  I PKA
Sbjct: 560 AHAREDYPK-----RDDVNWMKHTLAWADYATKTVKLDERPVHTRTMTNEVKY--IEPKA 612

Query: 609 RVY 611
           RVY
Sbjct: 613 RVY 615


>gi|58581931|ref|YP_200947.1| succinate dehydrogenase flavoprotein subunit [Xanthomonas oryzae
           pv. oryzae KACC10331]
 gi|84623843|ref|YP_451215.1| succinate dehydrogenase flavoprotein subunit [Xanthomonas oryzae
           pv. oryzae MAFF 311018]
 gi|50313517|gb|AAT74621.1| succinate dehydrogenase flavoprotein subunit [Xanthomonas oryzae
           pv. oryzae]
 gi|58426525|gb|AAW75562.1| succinate dehydrogenase flavoprotein subunit [Xanthomonas oryzae
           pv. oryzae KACC10331]
 gi|84367783|dbj|BAE68941.1| succinate dehydrogenase flavoprotein subunit [Xanthomonas oryzae
           pv. oryzae MAFF 311018]
          Length = 596

 Score =  827 bits (2137), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/603 (65%), Positives = 466/603 (77%), Gaps = 8/603 (1%)

Query: 9   SSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLA 68
           S+Y   +H YD+VVVGAGGAGLRAT G+A+KG +T C+TKVFPTRSHTVAAQGGI+A+L 
Sbjct: 2   SAYKITEHKYDMVVVGAGGAGLRATFGLAQKGLQTVCLTKVFPTRSHTVAAQGGISAALG 61

Query: 69  NMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRP 128
           NM  D W++H YDTIKGSDWLGD DAI+Y+  EA  ++ ELEHYGVPFSR E GKIYQRP
Sbjct: 62  NMGEDDWRYHFYDTIKGSDWLGDQDAIEYMCREAIPAIIELEHYGVPFSRTEDGKIYQRP 121

Query: 129 FGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCC 188
           FGG    YGEGP  QRTCAAADRTGHA+LHTLY Q+L +NA F IEYFALDLI + EG C
Sbjct: 122 FGGMTTKYGEGPSAQRTCAAADRTGHAMLHTLYQQSLAHNARFMIEYFALDLIFDEEGVC 181

Query: 189 VGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDME 248
            GV+A  +  G +H F A  VVLATGGYGRAYFSATSAHTCTGDG G+V RAGLP+QDME
Sbjct: 182 RGVLALDMAEGSLHLFRAHGVVLATGGYGRAYFSATSAHTCTGDGGGLVMRAGLPVQDME 241

Query: 249 FVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEI 308
           FVQFHPTGIYGAGCLITEG RGEGG L NS GERFMERYAP  KDLASRDVVSR M +EI
Sbjct: 242 FVQFHPTGIYGAGCLITEGVRGEGGILRNSNGERFMERYAPHYKDLASRDVVSRSMTVEI 301

Query: 309 REGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMG 368
           REGRGVG+ KDHI L L HL P V+ E+LPGI+ESA IFAGVDVT+ PIPV+PTVHYNMG
Sbjct: 302 REGRGVGEHKDHILLDLTHLGPEVINEKLPGIAESAHIFAGVDVTKQPIPVLPTVHYNMG 361

Query: 369 GIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIR 428
           GIPTN++GEV+     +P+   PGL AIGEA C SVHGANRLGSNSL+DLVVFGRA   R
Sbjct: 362 GIPTNFYGEVVRKQGDDPDAVVPGLYAIGEAACVSVHGANRLGSNSLLDLVVFGRAVANR 421

Query: 429 ASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQD 488
            +E +  + P  +L   +CD+ +   D+LRHA+G  PT+ +R+ MQR MQ DA VFRT  
Sbjct: 422 CAETVKPNQPHKTLPSYACDKALGLLDKLRHANGSTPTSVIRDNMQRTMQSDAAVFRTSK 481

Query: 489 SLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRG 548
           +L +G   ++ ++    D+KV DRSL+WNSDL+ET EL NL++NA+AT+ SAE RKESRG
Sbjct: 482 TLKEGVDKMAEIFATFEDVKVSDRSLVWNSDLIETYELNNLLLNAVATINSAEQRKESRG 541

Query: 549 SHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPKA 608
           +H+ EDF D     RDDVNW+KH+L  VD + GK + DYRPVH   L   VD   + PK 
Sbjct: 542 AHSHEDFPD-----RDDVNWQKHTLVTVD-DKGKCEFDYRPVHMYTLSKDVDV--VPPKP 593

Query: 609 RVY 611
           RVY
Sbjct: 594 RVY 596


>gi|289669026|ref|ZP_06490101.1| succinate dehydrogenase flavoprotein subunit [Xanthomonas
           campestris pv. musacearum NCPPB4381]
          Length = 596

 Score =  827 bits (2137), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/603 (65%), Positives = 465/603 (77%), Gaps = 8/603 (1%)

Query: 9   SSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLA 68
           S+Y   +H YD+VVVGAGGAGLRAT G+A+KG +T C+TKVFPTRSHTVAAQGGI+A+L 
Sbjct: 2   SAYKITEHKYDMVVVGAGGAGLRATFGLAQKGLQTVCLTKVFPTRSHTVAAQGGISAALG 61

Query: 69  NMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRP 128
           NM  D W++H YDTIKGSDWLGD DAI+Y+  EA  ++ ELEHYGVPFSR E GKIYQRP
Sbjct: 62  NMGEDDWRYHFYDTIKGSDWLGDQDAIEYMCREAIPAIIELEHYGVPFSRTEDGKIYQRP 121

Query: 129 FGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCC 188
           FGG    YGEGP  QRTCAAADRTGHA+LHTLY Q+L +NA F IEYFALDLI + EG C
Sbjct: 122 FGGMTTKYGEGPSAQRTCAAADRTGHAMLHTLYQQSLAHNARFMIEYFALDLIFDEEGVC 181

Query: 189 VGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDME 248
            GV+A  +  G +H F A  VVLATGGYGRAYFSATSAHTCTGDG G+V RAGLP+QDME
Sbjct: 182 RGVLALDMAEGSLHLFRAHGVVLATGGYGRAYFSATSAHTCTGDGGGLVMRAGLPVQDME 241

Query: 249 FVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEI 308
           FVQFHPTGIYGAGCLITEG RGEGG L NS GERFMERYAP  KDLASRDVVSR M +EI
Sbjct: 242 FVQFHPTGIYGAGCLITEGVRGEGGILRNSNGERFMERYAPHYKDLASRDVVSRSMTVEI 301

Query: 309 REGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMG 368
           REGRGVG+ KDHI L L HL P V+ E+LPGI+ESA IFAGVDVT+ PIPV+PTVHYNMG
Sbjct: 302 REGRGVGEHKDHILLDLTHLGPEVINEKLPGIAESAHIFAGVDVTKQPIPVLPTVHYNMG 361

Query: 369 GIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIR 428
           GIPTN++GEV+     +P+   PGL AIGEA C SVHGANRLGSNSL+DLVVFGRA   R
Sbjct: 362 GIPTNFYGEVVRKQGDDPDAVVPGLYAIGEAACVSVHGANRLGSNSLLDLVVFGRAVANR 421

Query: 429 ASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQD 488
            +E +  + P  +L   +CD+ +   D+LRHA+G  PT+ +R+ MQR MQ DA VFRT  
Sbjct: 422 CAETVKPNQPHKTLPSDACDKALGLLDKLRHANGSTPTSVIRDNMQRTMQSDAAVFRTSK 481

Query: 489 SLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRG 548
           +L +G   ++ ++    D+KV DRSL+WNSDL+ET EL NL++NA+AT+ SAE RKESRG
Sbjct: 482 TLKEGVNKMAEIFATFEDVKVSDRSLVWNSDLIETYELNNLLLNAVATINSAEQRKESRG 541

Query: 549 SHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPKA 608
           +H  EDF D     RDDVNW+KH+L  VD + GK + DYRPVH   L   VD   + PK 
Sbjct: 542 AHLHEDFPD-----RDDVNWQKHTLVTVD-DKGKCEFDYRPVHMYTLSKDVDV--VPPKP 593

Query: 609 RVY 611
           RVY
Sbjct: 594 RVY 596


>gi|194365315|ref|YP_002027925.1| succinate dehydrogenase flavoprotein subunit [Stenotrophomonas
           maltophilia R551-3]
 gi|194348119|gb|ACF51242.1| succinate dehydrogenase, flavoprotein subunit [Stenotrophomonas
           maltophilia R551-3]
          Length = 596

 Score =  827 bits (2136), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/603 (66%), Positives = 463/603 (76%), Gaps = 8/603 (1%)

Query: 9   SSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLA 68
           S+Y   +H YD+VVVGAGGAGLRAT G+A KG +T C+TKVFPTRSHTVAAQGGI+A+LA
Sbjct: 2   SAYKITEHKYDMVVVGAGGAGLRATFGLAAKGLQTVCLTKVFPTRSHTVAAQGGISAALA 61

Query: 69  NMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRP 128
           NM  D W++H +DTIKGSDWLGD DAI+Y+  EA  ++ ELEHYGVPFSR   GKIYQRP
Sbjct: 62  NMGEDDWRYHFFDTIKGSDWLGDQDAIEYMCREAIPAIIELEHYGVPFSRTAEGKIYQRP 121

Query: 129 FGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCC 188
           FGG    YGEGP  QRTCAAADRTGHA+LHTLY Q+LK++A F IEYFALDLI + EG C
Sbjct: 122 FGGMTTKYGEGPAAQRTCAAADRTGHAMLHTLYQQSLKHDARFMIEYFALDLIFDDEGAC 181

Query: 189 VGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDME 248
            GV+A  +  G +H F A+ VVLATGGYGRAYFSATSAHTCTGDG G+  RAG+ +QDME
Sbjct: 182 RGVLALDMSDGTLHLFRAQGVVLATGGYGRAYFSATSAHTCTGDGGGLAMRAGIAMQDME 241

Query: 249 FVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEI 308
           FVQFHPTGIYGAGCLITEG RGEGG L NS GERFMERYAP  KDLASRDVVSR M +EI
Sbjct: 242 FVQFHPTGIYGAGCLITEGVRGEGGILRNSSGERFMERYAPHYKDLASRDVVSRSMTIEI 301

Query: 309 REGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMG 368
           REGRGVG+ KDHI L L HL P V+ E+LPGI+ESARIFAGVDV + PIPVIPTVHYNMG
Sbjct: 302 REGRGVGEHKDHILLDLTHLGPGVIDEKLPGIAESARIFAGVDVHKQPIPVIPTVHYNMG 361

Query: 369 GIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIR 428
           GIPTNY GEV+  +  NP+   PGL AIGEA C SVHGANRLGSNSL+DLVVFGRA   R
Sbjct: 362 GIPTNYHGEVVRKDGDNPDAVIPGLYAIGEAACVSVHGANRLGSNSLLDLVVFGRAVANR 421

Query: 429 ASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQD 488
            +E I   +    L   +CD+ +   D+LRHA+G  PT+ +R++MQR MQ DA VFRT  
Sbjct: 422 CAETIKPGASHKPLAADACDKALGLLDKLRHANGDTPTSVIRDRMQRTMQADAAVFRTSQ 481

Query: 489 SLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRG 548
           +L +GC  +  ++D   D+KV DRSL+WNSDL+ET EL NL++NA+AT+ SAE RKESRG
Sbjct: 482 TLKEGCEKMDKIFDSFQDVKVSDRSLVWNSDLIETYELNNLLLNAVATINSAEQRKESRG 541

Query: 549 SHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPKA 608
           +HA EDF D     RDDVNW+KH+L  VD   GK   DYRPVH   L    D S + PK 
Sbjct: 542 AHAHEDFPD-----RDDVNWQKHTLVSVD-EKGKCSFDYRPVHMYTLTD--DVSVVPPKP 593

Query: 609 RVY 611
           RVY
Sbjct: 594 RVY 596


>gi|188576493|ref|YP_001913422.1| succinate dehydrogenase flavoprotein subunit [Xanthomonas oryzae
           pv. oryzae PXO99A]
 gi|188520945|gb|ACD58890.1| succinate dehydrogenase, flavoprotein subunit [Xanthomonas oryzae
           pv. oryzae PXO99A]
          Length = 596

 Score =  827 bits (2136), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/603 (65%), Positives = 466/603 (77%), Gaps = 8/603 (1%)

Query: 9   SSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLA 68
           S+Y   +H YD+VVVGAGGAGLRAT G+A+KG +T C+TKVFPTRSHTVAAQGGI+A+L 
Sbjct: 2   SAYKITEHKYDMVVVGAGGAGLRATFGLAQKGLQTVCLTKVFPTRSHTVAAQGGISAALG 61

Query: 69  NMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRP 128
           NM  D W++H YDTIKGSDWLGD DAI+Y+  EA  ++ ELEHYGVPFSR E GKIYQRP
Sbjct: 62  NMGEDDWRYHFYDTIKGSDWLGDQDAIEYMCREAIPAIIELEHYGVPFSRTEDGKIYQRP 121

Query: 129 FGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCC 188
           FGG    YGEGP  QRTCAAADRTGHA+LHTLY Q+L +NA F IEYFALDLI + EG C
Sbjct: 122 FGGMTTKYGEGPSAQRTCAAADRTGHAMLHTLYQQSLAHNARFMIEYFALDLIFDEEGVC 181

Query: 189 VGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDME 248
            GV+A  +  G +H F A  VVLATGGYGRAYFSATSAHTCTGDG G+V RAGLP+QDME
Sbjct: 182 RGVLALDMAEGSLHLFRAHGVVLATGGYGRAYFSATSAHTCTGDGGGLVMRAGLPVQDME 241

Query: 249 FVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEI 308
           FVQFHPTGIYGAGCLITEG RGEGG L NS GERFMERYAP  KDLASRDVVSR M +EI
Sbjct: 242 FVQFHPTGIYGAGCLITEGVRGEGGILRNSNGERFMERYAPHYKDLASRDVVSRSMTVEI 301

Query: 309 REGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMG 368
           REGRGVG+ KDHI L L HL P V+ E+LPGI+ESA IFAGVDVT+ PIPV+PTVHYNMG
Sbjct: 302 REGRGVGEHKDHILLDLTHLGPEVINEKLPGIAESAHIFAGVDVTKQPIPVLPTVHYNMG 361

Query: 369 GIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIR 428
           GIPTN++GEV+     +P+   PGL AIGEA C SVHGANRLGSNSL+DLVVFGRA   R
Sbjct: 362 GIPTNFYGEVVRNQGDDPDAVVPGLYAIGEAACVSVHGANRLGSNSLLDLVVFGRAVANR 421

Query: 429 ASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQD 488
            +E +  + P  +L   +CD+ +   D+LRHA+G  PT+ +R+ MQR MQ DA VFRT  
Sbjct: 422 CAETVKPNQPHKTLPSYACDKALGLLDKLRHANGSTPTSVIRDNMQRTMQSDAAVFRTSK 481

Query: 489 SLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRG 548
           +L +G   ++ ++    D+KV DRSL+WNSDL+ET EL NL++NA+AT+ SAE RKESRG
Sbjct: 482 TLKEGVDKMAEIFATFEDVKVSDRSLVWNSDLIETYELNNLLLNAVATINSAEQRKESRG 541

Query: 549 SHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPKA 608
           +H+ EDF D     RDDVNW+KH+L  VD + GK + DYRPVH   L   VD   + PK 
Sbjct: 542 AHSHEDFPD-----RDDVNWQKHTLVTVD-DKGKCEFDYRPVHMYTLSKDVDV--VPPKP 593

Query: 609 RVY 611
           RVY
Sbjct: 594 RVY 596


>gi|170744096|ref|YP_001772751.1| succinate dehydrogenase flavoprotein subunit [Methylobacterium sp.
           4-46]
 gi|168198370|gb|ACA20317.1| succinate dehydrogenase, flavoprotein subunit [Methylobacterium sp.
           4-46]
          Length = 608

 Score =  827 bits (2135), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 410/603 (67%), Positives = 479/603 (79%), Gaps = 8/603 (1%)

Query: 9   SSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLA 68
            +Y  V+HS+DVVVVGAGGAGLRAT+G ++ G +TACITKVFPTRSHTVAAQGGI+ASL 
Sbjct: 14  QAYPIVEHSFDVVVVGAGGAGLRATVGCSQAGLRTACITKVFPTRSHTVAAQGGISASLG 73

Query: 69  NMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRP 128
           NM PD W+WH+YDT+KGSDWLGD DAI+YL   AP +VYELEH+GVPFSR   GKIYQRP
Sbjct: 74  NMGPDDWRWHMYDTVKGSDWLGDQDAIEYLVRNAPAAVYELEHWGVPFSRTAEGKIYQRP 133

Query: 129 FGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCC 188
           FGG   +YG+G   QRTCAAADRTGHA+LHTLYGQA+KN   FFIEYFALDLI++ EG C
Sbjct: 134 FGGMTTDYGKGT-AQRTCAAADRTGHAMLHTLYGQAVKNRTNFFIEYFALDLIMDEEGRC 192

Query: 189 VGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDME 248
            GV+A    TGEIHRF A + +LATGGYGRAYFSATSAHTCTGDG  MV RAGL L+DME
Sbjct: 193 RGVIALDQATGEIHRFRAAMTILATGGYGRAYFSATSAHTCTGDGNAMVLRAGLALEDME 252

Query: 249 FVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEI 308
           FVQFHPTGIYGAGCLITEGARGEGGYL NS+GERFMERYAPSAKDLASRDVVSR M MEI
Sbjct: 253 FVQFHPTGIYGAGCLITEGARGEGGYLTNSEGERFMERYAPSAKDLASRDVVSRSMTMEI 312

Query: 309 REGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMG 368
           R GRGVGK+KDHI+L+L+HLDP +L ERLPGISESA+IFAGVDVT++PIPV+PTVHYNMG
Sbjct: 313 RAGRGVGKNKDHIYLHLDHLDPKILHERLPGISESAKIFAGVDVTKEPIPVLPTVHYNMG 372

Query: 369 GIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIR 428
           GIPTNY GEVL     NP+   PGLMAIGEA C SVHGANRLGSNSLIDLVVFGRAA +R
Sbjct: 373 GIPTNYHGEVLTLRDGNPDYVVPGLMAIGEAACVSVHGANRLGSNSLIDLVVFGRAAGLR 432

Query: 429 ASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQD 488
            +E+++ +  +P L   S D+ + R DR R+A+G  PTA LR  MQR MQ +  VFRT +
Sbjct: 433 CAEIVEANGRLPDLPKDSADKALARLDRFRYANGGRPTAELRLDMQRTMQNNCAVFRTGE 492

Query: 489 SLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRG 548
            L +G   +  +W  + D++V DRSL+WN+DL+ETLE  NL+  A+ T+ SA  R ESRG
Sbjct: 493 VLEEGKHLIHKVWSGIDDIRVTDRSLVWNTDLLETLEFDNLIGQAVVTMESAVNRTESRG 552

Query: 549 SHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPKA 608
           +HAREDF D     R+D +W KH+L W+D    K+ +DYRPVHT  +   + Y  I PKA
Sbjct: 553 AHAREDFPD-----RNDKDWMKHTLAWLDPEGRKVTIDYRPVHTYTMSNDIAY--IEPKA 605

Query: 609 RVY 611
           RVY
Sbjct: 606 RVY 608


>gi|285018594|ref|YP_003376305.1| succinate dehydrogenase flavoprotein subunit [Xanthomonas
           albilineans GPE PC73]
 gi|283473812|emb|CBA16314.1| putative succinate dehydrogenase flavoprotein subunit [Xanthomonas
           albilineans]
          Length = 596

 Score =  827 bits (2135), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/603 (66%), Positives = 463/603 (76%), Gaps = 8/603 (1%)

Query: 9   SSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLA 68
           S+Y   +H YD+VVVGAGGAGLRAT G+A+KG +T C+TKVFPTRSHTVAAQGGI+A+L 
Sbjct: 2   SAYKITEHKYDMVVVGAGGAGLRATFGLAQKGLQTVCLTKVFPTRSHTVAAQGGISAALG 61

Query: 69  NMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRP 128
           NM  D W++H YDTIKGSDWLGD DAI+Y+  EA  ++ ELEHYGVPFSR E GKIYQRP
Sbjct: 62  NMGEDDWRYHFYDTIKGSDWLGDQDAIEYMCREAIPAIIELEHYGVPFSRTEDGKIYQRP 121

Query: 129 FGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCC 188
           FGG    YGEGP  QRTCAAADRTGHA+LHTLY Q+L +NA F +EYFALDLI + EG C
Sbjct: 122 FGGMTTKYGEGPSAQRTCAAADRTGHAMLHTLYQQSLAHNARFMVEYFALDLIFDEEGVC 181

Query: 189 VGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDME 248
            GV+A  +  G +H F A  VVLATGGYGRAYFSATSAHTCTGDG G+V RAGLP+QDME
Sbjct: 182 RGVLALDMAEGSLHLFRAHGVVLATGGYGRAYFSATSAHTCTGDGGGLVMRAGLPMQDME 241

Query: 249 FVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEI 308
           FVQFHPTGIYGAGCLITEG RGEGG L NS GERFMERYAP  KDLASRDVVSR M +EI
Sbjct: 242 FVQFHPTGIYGAGCLITEGVRGEGGILRNSSGERFMERYAPHYKDLASRDVVSRSMTIEI 301

Query: 309 REGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMG 368
           REGRGVG  KDHI L L HL P V+ E+LPGI+ESARIFAGVDV + PIPV+PTVHYNMG
Sbjct: 302 REGRGVGVHKDHILLDLTHLGPGVIDEKLPGIAESARIFAGVDVHKQPIPVLPTVHYNMG 361

Query: 369 GIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIR 428
           GIPTNY GEV+  +  NP+   PGL +IGEA C SVHGANRLGSNSL+DLVVFGRA   R
Sbjct: 362 GIPTNYHGEVVRKDGDNPDAVVPGLYSIGEAACVSVHGANRLGSNSLLDLVVFGRAVANR 421

Query: 429 ASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQD 488
            +E I   +P   L   +CD+ +   D+LRHA+G  PT+ +R+KMQR MQ DA VFRT  
Sbjct: 422 CAETIKTGAPHKDLPGDACDKALGMLDKLRHANGSTPTSVIRDKMQRTMQSDAAVFRTSK 481

Query: 489 SLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRG 548
           +L +G   ++ ++    D+KV DRSL+WNSDL+ET EL NL++NA+AT+ SAE RKESRG
Sbjct: 482 TLKEGVDKMAEIFASFEDVKVSDRSLVWNSDLIETYELNNLLLNAVATINSAEQRKESRG 541

Query: 549 SHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPKA 608
           +HA EDF D     RDD NW+KH+L  VD + G+   DYRPVH   L   VD   + PK 
Sbjct: 542 AHAHEDFPD-----RDDANWQKHTLVTVD-DKGRCSFDYRPVHMYTLSNDVDV--VPPKP 593

Query: 609 RVY 611
           RVY
Sbjct: 594 RVY 596


>gi|295687608|ref|YP_003591301.1| succinate dehydrogenase flavoprotein subunit [Caulobacter segnis
           ATCC 21756]
 gi|295429511|gb|ADG08683.1| succinate dehydrogenase, flavoprotein subunit [Caulobacter segnis
           ATCC 21756]
          Length = 595

 Score =  827 bits (2135), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/603 (67%), Positives = 485/603 (80%), Gaps = 9/603 (1%)

Query: 9   SSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLA 68
           S+Y ++DH +DVVVVGAGG+GLRA LG A+ G KTACITKVFPTRSHTVAAQGGI+ASL 
Sbjct: 2   SAYKFIDHKFDVVVVGAGGSGLRAALGAAQAGLKTACITKVFPTRSHTVAAQGGISASLG 61

Query: 69  NMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRP 128
           NM+ D W+WH++DT+KGSDWLGD DAI+YL   AP +VYELEH+GVPFSR   GKIYQR 
Sbjct: 62  NMSHDDWRWHMFDTVKGSDWLGDQDAIEYLTRNAPAAVYELEHWGVPFSRTSDGKIYQRA 121

Query: 129 FGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCC 188
           FGG  +N+GEGP +QRTCAAADRTGHA+LHT+YGQ+L ++ EFFIEYFALDLI++ +G C
Sbjct: 122 FGGMTKNFGEGP-IQRTCAAADRTGHAMLHTMYGQSLAHDTEFFIEYFALDLIMD-DGVC 179

Query: 189 VGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDME 248
            GV AW+L+ G +HRF A++V+LATGGYGRAYFSATSAHTCTGDG  M  RAGLPLQDME
Sbjct: 180 RGVTAWKLDDGTLHRFQAQMVILATGGYGRAYFSATSAHTCTGDGNAMALRAGLPLQDME 239

Query: 249 FVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEI 308
           FVQFHPTGIYGAGCLITEGARGEGGYL NS+GERFMERYAPS KDLA RD+VSR M +EI
Sbjct: 240 FVQFHPTGIYGAGCLITEGARGEGGYLTNSEGERFMERYAPSVKDLAPRDMVSRAMTIEI 299

Query: 309 REGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMG 368
           REGRGVG +KDHI L+L+HLDP +L ERLPGISE+A++FAGVDVT+ PIPV+PTVHYNMG
Sbjct: 300 REGRGVGPNKDHIFLHLDHLDPKILHERLPGISETAKVFAGVDVTKAPIPVLPTVHYNMG 359

Query: 369 GIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIR 428
           GIPTNY GEV+  N  NP++  PGLMA+GEA C SVHGANRLGSNSLIDLVVFGRAA +R
Sbjct: 360 GIPTNYHGEVVTKNGDNPDQVIPGLMAVGEAACVSVHGANRLGSNSLIDLVVFGRAAALR 419

Query: 429 ASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQD 488
            +E++   +  P L  +  +  + RFDR R+A G   TA LR +MQ+AMQ DA VFRT +
Sbjct: 420 CAEILKPGAKQPELKDAQTEAHLARFDRFRNASGSTGTAELRLEMQKAMQEDAAVFRTGE 479

Query: 489 SLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRG 548
           SL  G + L  +WD+ +D+KV DR L+WN+DL+ETLE  NL+  A+ TV  A  R ESRG
Sbjct: 480 SLESGVKRLQSVWDKKSDIKVSDRGLVWNTDLMETLEFDNLIGQAVVTVNGAVNRTESRG 539

Query: 549 SHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPKA 608
           +HAREDF D     R+D  W KH+L W+D +TGK+K+DYRPVH+  +   + Y  I PK 
Sbjct: 540 AHAREDFSD-----RNDTEWMKHTLAWLDVDTGKVKIDYRPVHSYTMSDDIAY--IPPKQ 592

Query: 609 RVY 611
           RVY
Sbjct: 593 RVY 595


>gi|78047799|ref|YP_363974.1| succinate dehydrogenase flavoprotein subunit [Xanthomonas
           campestris pv. vesicatoria str. 85-10]
 gi|294665036|ref|ZP_06730343.1| succinate dehydrogenase [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 10535]
 gi|325928375|ref|ZP_08189570.1| succinate dehydrogenase subunit A [Xanthomonas perforans 91-118]
 gi|78036229|emb|CAJ23920.1| succinate dehydrogenase flavoprotein subunit [Xanthomonas
           campestris pv. vesicatoria str. 85-10]
 gi|292605193|gb|EFF48537.1| succinate dehydrogenase [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 10535]
 gi|325541251|gb|EGD12798.1| succinate dehydrogenase subunit A [Xanthomonas perforans 91-118]
          Length = 596

 Score =  826 bits (2134), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/603 (65%), Positives = 465/603 (77%), Gaps = 8/603 (1%)

Query: 9   SSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLA 68
           S+Y   +H YD+VVVGAGGAGLRAT G+A+KG +T C+TKVFPTRSHTVAAQGGI+A+L 
Sbjct: 2   SAYKITEHKYDMVVVGAGGAGLRATFGLAQKGLQTVCLTKVFPTRSHTVAAQGGISAALG 61

Query: 69  NMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRP 128
           NM  D W++H YDTIKGSDWLGD DAI+Y+  EA  ++ ELEHYGVPFSR E GKIYQRP
Sbjct: 62  NMGEDDWRYHFYDTIKGSDWLGDQDAIEYMCREAIPAIIELEHYGVPFSRTEEGKIYQRP 121

Query: 129 FGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCC 188
           FGG    YGEGP  QRTCAAADRTGHA+LHTLY Q+L +NA F IEYFALDLI + EG C
Sbjct: 122 FGGMTTKYGEGPSAQRTCAAADRTGHAMLHTLYQQSLAHNARFMIEYFALDLIFDEEGVC 181

Query: 189 VGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDME 248
            GV+A  +  G +H F A  VVLATGGYGRAYFSATSAHTCTGDG G+V RAGLP+QDME
Sbjct: 182 RGVLALDMAEGSLHLFRAHGVVLATGGYGRAYFSATSAHTCTGDGGGLVMRAGLPVQDME 241

Query: 249 FVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEI 308
           FVQFHPTGIYGAGCLITEG RGEGG L NS GERFMERYAP  KDLASRDVVSR M +EI
Sbjct: 242 FVQFHPTGIYGAGCLITEGVRGEGGILRNSNGERFMERYAPHYKDLASRDVVSRSMTVEI 301

Query: 309 REGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMG 368
           REGRGVG+ KDHI L L HL P V+ E+LPGI+ESA IFAGVDVT+ PIPV+PTVHYNMG
Sbjct: 302 REGRGVGEHKDHILLDLTHLGPEVINEKLPGIAESAHIFAGVDVTKQPIPVLPTVHYNMG 361

Query: 369 GIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIR 428
           GIPTN++GEV+     + +   PGL AIGEA C SVHGANRLGSNSL+DLVVFGRA   R
Sbjct: 362 GIPTNFYGEVVRKQGDDADAVVPGLYAIGEAACVSVHGANRLGSNSLLDLVVFGRAVANR 421

Query: 429 ASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQD 488
            +E +  + P  +L   +CD+ +   D+LRHA+G  PTA +R+ MQR MQ DA VFRT  
Sbjct: 422 CAETVKPNQPHKTLPSDACDKALGLLDKLRHANGSTPTAVIRDNMQRTMQSDAAVFRTSK 481

Query: 489 SLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRG 548
           +L +G   ++ ++    D+KV DRSL+WNSDL+ET EL NL++NA+AT+ SAE RKESRG
Sbjct: 482 TLKEGVDKMAEIFATFEDVKVSDRSLVWNSDLIETYELNNLLLNAVATINSAEQRKESRG 541

Query: 549 SHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPKA 608
           +H+ EDF D     RDDVNW+KH+L  VD + GK + DYRPVH   L   VD   + PK 
Sbjct: 542 AHSHEDFPD-----RDDVNWQKHTLVTVD-DKGKCEFDYRPVHMYTLSKDVDV--VPPKP 593

Query: 609 RVY 611
           RVY
Sbjct: 594 RVY 596


>gi|21242816|ref|NP_642398.1| succinate dehydrogenase flavoprotein subunit [Xanthomonas
           axonopodis pv. citri str. 306]
 gi|21108302|gb|AAM36934.1| succinate dehydrogenase flavoprotein subunit [Xanthomonas
           axonopodis pv. citri str. 306]
 gi|51536980|gb|AAU05602.1| succinate dehydrogenase subunit A [Xanthomonas citri]
          Length = 596

 Score =  826 bits (2133), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/603 (65%), Positives = 465/603 (77%), Gaps = 8/603 (1%)

Query: 9   SSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLA 68
           S+Y   +H YD+VVVGAGGAGLRAT G+A+KG +T C+TKVFPTRSHTVAAQGGI+A+L 
Sbjct: 2   SAYKITEHKYDMVVVGAGGAGLRATFGLAQKGLQTVCLTKVFPTRSHTVAAQGGISAALG 61

Query: 69  NMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRP 128
           NM  D W++H YDTIKGSDWLGD DAI+Y+  EA  ++ ELEHYGVPFSR E GKIYQRP
Sbjct: 62  NMGEDDWRYHFYDTIKGSDWLGDQDAIEYMCREAIPAIIELEHYGVPFSRTEEGKIYQRP 121

Query: 129 FGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCC 188
           FGG    YGEGP  QRTCAAADRTGHA+LHTLY Q+L +NA F IEYFALDLI + EG C
Sbjct: 122 FGGMTTKYGEGPSAQRTCAAADRTGHAMLHTLYQQSLAHNARFMIEYFALDLIFDEEGVC 181

Query: 189 VGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDME 248
            GV+A  +  G +H F A  VVLATGGYGRAYFSATSAHTCTGDG G+V RAGLP+QDME
Sbjct: 182 RGVLALDMAEGSLHLFRAHGVVLATGGYGRAYFSATSAHTCTGDGGGLVMRAGLPVQDME 241

Query: 249 FVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEI 308
           FVQFHPTGIYGAGCLITEG RGEGG L NS GERFMERYAP  KDLASRDVVSR M +EI
Sbjct: 242 FVQFHPTGIYGAGCLITEGVRGEGGILRNSNGERFMERYAPHYKDLASRDVVSRSMTVEI 301

Query: 309 REGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMG 368
           REGRGVG+ KDHI L L HL P V+ E+LPGI+ESA IFAGVDVT+ PIPV+PTVHYNMG
Sbjct: 302 REGRGVGEHKDHILLDLTHLGPEVINEKLPGIAESAHIFAGVDVTKQPIPVLPTVHYNMG 361

Query: 369 GIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIR 428
           GIPTN++GEV+     + +   PGL AIGEA C SVHGANRLGSNSL+DLVVFGRA   R
Sbjct: 362 GIPTNFYGEVVRKRGDDADAVVPGLYAIGEAACVSVHGANRLGSNSLLDLVVFGRAVANR 421

Query: 429 ASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQD 488
            +E +  + P  +L   +CD+ +   D+LRHA+G  PTA +R+ MQR MQ DA VFRT  
Sbjct: 422 CAETVKPNQPHKTLPSDACDKALGLLDKLRHANGSTPTAVIRDNMQRTMQSDAAVFRTSK 481

Query: 489 SLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRG 548
           +L +G   ++ ++    D+KV DRSL+WNSDL+ET EL NL++NA+AT+ SAE RKESRG
Sbjct: 482 TLKEGVDKMAEIFATFEDVKVSDRSLVWNSDLIETYELNNLLLNAVATINSAEQRKESRG 541

Query: 549 SHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPKA 608
           +H+ EDF D     RDDVNW+KH+L  VD + GK + DYRPVH   L   VD   + PK 
Sbjct: 542 AHSHEDFPD-----RDDVNWQKHTLVTVD-DKGKCEFDYRPVHMYTLSKDVDV--VPPKP 593

Query: 609 RVY 611
           RVY
Sbjct: 594 RVY 596


>gi|220926984|ref|YP_002502286.1| succinate dehydrogenase flavoprotein subunit [Methylobacterium
           nodulans ORS 2060]
 gi|219951591|gb|ACL61983.1| succinate dehydrogenase, flavoprotein subunit [Methylobacterium
           nodulans ORS 2060]
          Length = 608

 Score =  825 bits (2132), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 410/602 (68%), Positives = 475/602 (78%), Gaps = 8/602 (1%)

Query: 10  SYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLAN 69
           +Y  VDH++DVVVVGAGGAGLRAT+G ++ G +TACITKVFPTRSHTVAAQGGI+ASL N
Sbjct: 15  AYPIVDHTFDVVVVGAGGAGLRATVGCSQAGLRTACITKVFPTRSHTVAAQGGISASLGN 74

Query: 70  MTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRPF 129
           M PD W+WH+YDT+KGSDWLGD DAI+YL   AP +VYELEH+GVPFSR   GKIYQRPF
Sbjct: 75  MGPDDWRWHMYDTVKGSDWLGDQDAIEYLVRNAPAAVYELEHWGVPFSRTAEGKIYQRPF 134

Query: 130 GGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCCV 189
           GG    YG+G   QRTCAAADRTGHA+LHTLYGQA KN   FFIEYFALDLI++ EG C 
Sbjct: 135 GGMTTEYGKGT-AQRTCAAADRTGHAMLHTLYGQAAKNKTNFFIEYFALDLIMDEEGRCR 193

Query: 190 GVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDMEF 249
           GV+A    TGEIHRF A + +LATGGYGRAYFSATSAHTCTGDG  MV RAGL L+DMEF
Sbjct: 194 GVIALDQSTGEIHRFRAAMTILATGGYGRAYFSATSAHTCTGDGNAMVLRAGLALEDMEF 253

Query: 250 VQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEIR 309
           VQFHPTGIYGAGCLITEGARGEGGYL NS+GERFMERYAPSAKDLASRDVVSR M MEIR
Sbjct: 254 VQFHPTGIYGAGCLITEGARGEGGYLTNSEGERFMERYAPSAKDLASRDVVSRSMTMEIR 313

Query: 310 EGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMGG 369
            GRGVGK+KDHI L+L+HLDP +L ERLPGISESA+IFAGVDVTR+PIPV+PTVHYNMGG
Sbjct: 314 AGRGVGKNKDHIFLHLDHLDPKILHERLPGISESAKIFAGVDVTREPIPVLPTVHYNMGG 373

Query: 370 IPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIRA 429
           IPTNY GEVL     NP+   PGLMAIGEA C SVHGANRLGSNSLIDLVVFGRAA +R 
Sbjct: 374 IPTNYHGEVLTLKDGNPDYVVPGLMAIGEAACVSVHGANRLGSNSLIDLVVFGRAAGLRC 433

Query: 430 SEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQDS 489
           +E+I+ +   P L   S D+ + R DR R+A+G  PTA LR  MQ+ MQ +  VFRT + 
Sbjct: 434 AEVIEANGRQPDLPRDSADKALARLDRFRYANGSKPTAELRLDMQKTMQNNCAVFRTGEV 493

Query: 490 LSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRGS 549
           L +G   +  +W  + D++V DRS++WN+DL+ETLE  NL+  A+ T+ SA  R ESRG+
Sbjct: 494 LEEGKHLIHQVWSGIDDIRVTDRSMVWNTDLLETLEFDNLIGQAVVTMESAVNRTESRGA 553

Query: 550 HAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPKAR 609
           HAREDF D     R+D +W KH+L W+D    K+ +DYRPVHT  +   + Y  I PKAR
Sbjct: 554 HAREDFPD-----RNDKDWMKHTLAWLDSEGRKVTIDYRPVHTYTMSNDIAY--IEPKAR 606

Query: 610 VY 611
           VY
Sbjct: 607 VY 608


>gi|254524717|ref|ZP_05136772.1| succinate dehydrogenase, flavoprotein subunit [Stenotrophomonas sp.
           SKA14]
 gi|219722308|gb|EED40833.1| succinate dehydrogenase, flavoprotein subunit [Stenotrophomonas sp.
           SKA14]
          Length = 596

 Score =  825 bits (2132), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/603 (66%), Positives = 462/603 (76%), Gaps = 8/603 (1%)

Query: 9   SSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLA 68
           S+Y   +H YD+VVVGAGGAGLRAT G+A KG +T C+TKVFPTRSHTVAAQGGI+A+LA
Sbjct: 2   SAYKITEHKYDMVVVGAGGAGLRATFGLAAKGLQTVCLTKVFPTRSHTVAAQGGISAALA 61

Query: 69  NMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRP 128
           NM  D W++H +DTIKGSDWLGD DAI+Y+  EA  ++ ELEHYGVPFSR   GKIYQRP
Sbjct: 62  NMGEDDWRYHFFDTIKGSDWLGDQDAIEYMCREAIPAIIELEHYGVPFSRTAEGKIYQRP 121

Query: 129 FGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCC 188
           FGG    YGEGP  QRTCAAADRTGHA+LHTLY Q+LK++A F IEYFALDLI + EG C
Sbjct: 122 FGGMTTKYGEGPAAQRTCAAADRTGHAMLHTLYQQSLKHDARFMIEYFALDLIFDDEGAC 181

Query: 189 VGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDME 248
            GV+A  +  G +H F A+ VVLATGGYGRAYFSATSAHTCTGDG G+  RAG+ +QDME
Sbjct: 182 RGVLALDMSDGTLHLFRAQGVVLATGGYGRAYFSATSAHTCTGDGGGLAMRAGIAMQDME 241

Query: 249 FVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEI 308
           FVQFHPTGIYGAGCLITEG RGEGG L NS GERFMERYAP  KDLASRDVVSR M +EI
Sbjct: 242 FVQFHPTGIYGAGCLITEGVRGEGGILRNSSGERFMERYAPHYKDLASRDVVSRSMTIEI 301

Query: 309 REGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMG 368
           REGRGVG+ KDHI L L HL P V+ E+LPGI+ESARIFAGVDV + PIPVIPTVHYNMG
Sbjct: 302 REGRGVGEHKDHILLDLTHLGPGVIDEKLPGIAESARIFAGVDVHKQPIPVIPTVHYNMG 361

Query: 369 GIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIR 428
           GIPTNY GEV+     NP+   PGL AIGEA C SVHGANRLGSNSL+DLVVFGRA   R
Sbjct: 362 GIPTNYHGEVVRKVGDNPDAVVPGLYAIGEAACVSVHGANRLGSNSLLDLVVFGRAVANR 421

Query: 429 ASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQD 488
            +E I   +    L   +CD+ +   D+LRHA+G  PT+ +R++MQR MQ DA VFRT  
Sbjct: 422 CAETIKPGASHKPLASDACDKALGLLDKLRHANGDTPTSVIRDRMQRTMQADAAVFRTSQ 481

Query: 489 SLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRG 548
           +L +GC  +  ++D   D+KV DRSL+WNSDL+ET EL NL++NA+AT+ SAE RKESRG
Sbjct: 482 TLKEGCEKMDKIFDSFQDVKVSDRSLVWNSDLIETYELNNLLLNAVATINSAEQRKESRG 541

Query: 549 SHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPKA 608
           +HA EDF D     RDDVNW+KH+L  VD   GK   DYRPVH   L    D S + PK 
Sbjct: 542 AHAHEDFPD-----RDDVNWQKHTLVSVD-EKGKCSFDYRPVHMYTLTD--DVSVVPPKP 593

Query: 609 RVY 611
           RVY
Sbjct: 594 RVY 596


>gi|325917573|ref|ZP_08179773.1| succinate dehydrogenase subunit A [Xanthomonas vesicatoria ATCC
           35937]
 gi|325536207|gb|EGD08003.1| succinate dehydrogenase subunit A [Xanthomonas vesicatoria ATCC
           35937]
          Length = 596

 Score =  825 bits (2131), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/603 (65%), Positives = 466/603 (77%), Gaps = 8/603 (1%)

Query: 9   SSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLA 68
           S+Y   +H YD+VVVGAGGAGLRAT G+A+KG +T C+TKVFPTRSHTVAAQGGI+A+L 
Sbjct: 2   SAYKITEHKYDMVVVGAGGAGLRATFGLAQKGLQTVCLTKVFPTRSHTVAAQGGISAALG 61

Query: 69  NMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRP 128
           NM  D W++H YDTIKGSDWLGD DAI+Y+  EA  ++ ELEHYGVPFSR E GKIYQRP
Sbjct: 62  NMGEDDWRYHFYDTIKGSDWLGDQDAIEYMCREAIPAIIELEHYGVPFSRTEEGKIYQRP 121

Query: 129 FGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCC 188
           FGG    YGEGP  QRTCAAADRTGHA+LHTLY Q+L +NA F IEYFALDLI + EG C
Sbjct: 122 FGGMTTKYGEGPSAQRTCAAADRTGHAMLHTLYQQSLAHNARFMIEYFALDLIFDEEGVC 181

Query: 189 VGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDME 248
            GV+A  +  G +H F A  VVLATGGYGRAYFSATSAHTCTGDG G+V RAGLP+QDME
Sbjct: 182 RGVLALDMAEGSLHLFRAHGVVLATGGYGRAYFSATSAHTCTGDGGGLVMRAGLPVQDME 241

Query: 249 FVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEI 308
           FVQFHPTGIYGAGCLITEG RGEGG L NS GERFMERYAP  KDLASRDVVSR M +EI
Sbjct: 242 FVQFHPTGIYGAGCLITEGVRGEGGILRNSNGERFMERYAPHYKDLASRDVVSRSMTVEI 301

Query: 309 REGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMG 368
           REGRGVG+ KDHI L L HL P V+ E+LPGI+ESA IFAGVDVT+ PIPV+PTVHYNMG
Sbjct: 302 REGRGVGEHKDHILLDLTHLGPEVINEKLPGIAESAHIFAGVDVTKQPIPVLPTVHYNMG 361

Query: 369 GIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIR 428
           GIPTN++GEV+     +P+   PGL AIGEA C SVHGANRLGSNSL+DLVVFGRA   R
Sbjct: 362 GIPTNFYGEVVRKQGDDPDAVVPGLYAIGEAACVSVHGANRLGSNSLLDLVVFGRAVANR 421

Query: 429 ASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQD 488
            +E +  + P  +L   +CD+ +   D+LR+A+G  PT+ +R+ MQR MQ DA VFRT  
Sbjct: 422 CAETVKPNQPHKTLPSDACDKALGLLDKLRYANGSTPTSVIRDNMQRTMQSDAAVFRTSK 481

Query: 489 SLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRG 548
           +L +G   ++ ++    D+KV DRSL+WNSDL+ET EL NL++NA+AT+ SAE RKESRG
Sbjct: 482 TLKEGVDKMAEIFATFEDVKVSDRSLVWNSDLIETYELNNLLLNAVATINSAEQRKESRG 541

Query: 549 SHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPKA 608
           +H+ EDF D     RDDVNW+KH+L  VD + GK + +YRPVH   L   VD   + PK 
Sbjct: 542 AHSHEDFPD-----RDDVNWQKHTLVTVD-DKGKCEFEYRPVHMYTLSKDVDV--VPPKP 593

Query: 609 RVY 611
           RVY
Sbjct: 594 RVY 596


>gi|294624873|ref|ZP_06703530.1| succinate dehydrogenase [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 11122]
 gi|292600832|gb|EFF44912.1| succinate dehydrogenase [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 11122]
          Length = 596

 Score =  824 bits (2129), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/603 (65%), Positives = 464/603 (76%), Gaps = 8/603 (1%)

Query: 9   SSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLA 68
           S+Y   +H YD+VVVGAGGAGLRAT G+A+KG +T C+TKVFPTRSHTVAAQGGI+A+L 
Sbjct: 2   SAYKITEHKYDMVVVGAGGAGLRATFGLAQKGLQTVCLTKVFPTRSHTVAAQGGISAALG 61

Query: 69  NMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRP 128
           NM  D W++H YDTIKGSDWLGD DAI+Y+  EA  ++ ELEHYGVPFSR E GKIYQRP
Sbjct: 62  NMGEDDWRYHFYDTIKGSDWLGDQDAIEYMCREAIPAIIELEHYGVPFSRTEEGKIYQRP 121

Query: 129 FGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCC 188
           FGG    YGEGP  QRTCAAADRTGHA+LHTLY Q+L +NA F IEYFALDLI + EG C
Sbjct: 122 FGGMTTKYGEGPSAQRTCAAADRTGHAMLHTLYQQSLAHNARFMIEYFALDLIFDEEGVC 181

Query: 189 VGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDME 248
            GV+A  +  G +H F A  VVLATGGYGRAYFSATSAHTCTGDG G+V RAGLP+QDME
Sbjct: 182 RGVLALDMAEGSLHLFRAHGVVLATGGYGRAYFSATSAHTCTGDGGGLVMRAGLPVQDME 241

Query: 249 FVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEI 308
           FVQFHPTGIYGAGCLITEG RGEGG L NS GERFMERYAP  KDLASRDVVSR M +EI
Sbjct: 242 FVQFHPTGIYGAGCLITEGVRGEGGILRNSNGERFMERYAPHYKDLASRDVVSRSMTVEI 301

Query: 309 REGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMG 368
           REGRGVG+ KDHI L L HL P V+ E+LPGI+ESA IFAGVDVT+ PIPV+PTVHYNMG
Sbjct: 302 REGRGVGEHKDHILLDLTHLGPEVINEKLPGIAESAHIFAGVDVTKQPIPVLPTVHYNMG 361

Query: 369 GIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIR 428
           GIPTN++GE +     + +   PGL AIGEA C SVHGANRLGSNSL+DLVVFGRA   R
Sbjct: 362 GIPTNFYGEAVRKQGDDADAVVPGLYAIGEAACVSVHGANRLGSNSLLDLVVFGRAVANR 421

Query: 429 ASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQD 488
            +E +  + P  +L   +CD+ +   D+LRHA+G  PTA +R+ MQR MQ DA VFRT  
Sbjct: 422 CAETVKPNQPHKTLPSDACDKALGLLDKLRHANGSTPTAVIRDNMQRTMQSDAAVFRTSK 481

Query: 489 SLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRG 548
           +L +G   ++ ++    D+KV DRSL+WNSDL+ET EL NL++NA+AT+ SAE RKESRG
Sbjct: 482 TLKEGVDKMAEIFATFEDVKVSDRSLVWNSDLIETYELNNLLLNAVATINSAEQRKESRG 541

Query: 549 SHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPKA 608
           +H+ EDF D     RDDVNW+KH+L  VD + GK + DYRPVH   L   VD   + PK 
Sbjct: 542 AHSHEDFPD-----RDDVNWQKHTLVTVD-DKGKCEFDYRPVHMYTLSKDVDV--VPPKP 593

Query: 609 RVY 611
           RVY
Sbjct: 594 RVY 596


>gi|153868750|ref|ZP_01998497.1| Succinate dehydrogenase/fumarate reductase, flavoprotein subunit
           [Beggiatoa sp. PS]
 gi|152074661|gb|EDN71495.1| Succinate dehydrogenase/fumarate reductase, flavoprotein subunit
           [Beggiatoa sp. PS]
          Length = 597

 Score =  824 bits (2129), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/603 (66%), Positives = 477/603 (79%), Gaps = 9/603 (1%)

Query: 9   SSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLA 68
           S+Y  +DH YDVV+VGAGGAGLRAT+GMAEKG  TACITKVFPTRSHTVAAQGGI+ASL 
Sbjct: 4   SAYEIIDHRYDVVIVGAGGAGLRATVGMAEKGLTTACITKVFPTRSHTVAAQGGISASLG 63

Query: 69  NMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRP 128
           NM  D W+WH+YDTIKGSDWLGD DAI+Y+  EA  ++ ELEHYGVPFSR EAGKIYQRP
Sbjct: 64  NMGQDDWRWHMYDTIKGSDWLGDQDAIEYMCREAVPAITELEHYGVPFSRTEAGKIYQRP 123

Query: 129 FGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCC 188
           FGG   +YGEG   +RTCAAADRTGHAILHTLY Q+LK  AEFFIEYFALDLI++ EG C
Sbjct: 124 FGGMTTHYGEGI-AKRTCAAADRTGHAILHTLYQQSLKYRAEFFIEYFALDLIMDDEGAC 182

Query: 189 VGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDME 248
            G++A  +  G IHRF A +VVLATGGYGR YFSATSAHTCTGDG GM+ RAGLPLQDME
Sbjct: 183 RGIMALNMMDGTIHRFRAHMVVLATGGYGRVYFSATSAHTCTGDGNGMILRAGLPLQDME 242

Query: 249 FVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEI 308
           FVQFHPTGIYG+GCLITEGARGEGGYL N +GERFM RYAP AKDLASRDVVSR + MEI
Sbjct: 243 FVQFHPTGIYGSGCLITEGARGEGGYLSNFEGERFMPRYAPHAKDLASRDVVSRAITMEI 302

Query: 309 REGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMG 368
           REGRGVG+ KDHI+L+L HLD  ++ ERLPGI+ESARIFA VDVT++PIPV+PTVHYNMG
Sbjct: 303 REGRGVGEHKDHIYLHLEHLDVEIINERLPGIAESARIFADVDVTKEPIPVLPTVHYNMG 362

Query: 369 GIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIR 428
           GIPTN++GEV+      PER  PGLMAIGE  C SVHGANRLGSNSL+D+VVFGRAA IR
Sbjct: 363 GIPTNHYGEVVTLKEGKPERVVPGLMAIGECACVSVHGANRLGSNSLLDIVVFGRAASIR 422

Query: 429 ASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQD 488
            S+++ + +P   L  ++ D  ++R D++R+A+G + TA +R  MQR MQ  A VFRT +
Sbjct: 423 CSKILARKAPHRPLPKNAGDNSLERLDKIRYANGSLSTAEIRLNMQRIMQNHAAVFRTGE 482

Query: 489 SLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRG 548
           +L +G + ++ +++  +D+KV DRSLIWNSDL+ETLEL N+   A+ T+ SA  R ESRG
Sbjct: 483 TLEEGSQKITEMFNAFSDVKVTDRSLIWNSDLIETLELDNMRGQAVVTMNSALNRTESRG 542

Query: 549 SHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPKA 608
           +HARED+ +     RDD NW KH+L W++   G + ++YR VH   L    D   + PKA
Sbjct: 543 AHAREDYPN-----RDDENWLKHTLAWLE-PQGNLTINYRSVHVYTLTN--DVGVVPPKA 594

Query: 609 RVY 611
           RVY
Sbjct: 595 RVY 597


>gi|325920386|ref|ZP_08182317.1| succinate dehydrogenase subunit A [Xanthomonas gardneri ATCC 19865]
 gi|325549133|gb|EGD20056.1| succinate dehydrogenase subunit A [Xanthomonas gardneri ATCC 19865]
          Length = 596

 Score =  824 bits (2129), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/603 (65%), Positives = 466/603 (77%), Gaps = 8/603 (1%)

Query: 9   SSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLA 68
           S+Y   +H YD+VVVGAGGAGLRAT G+A+KG +T C+TKVFPTRSHTVAAQGGI+A+L 
Sbjct: 2   SAYKITEHKYDMVVVGAGGAGLRATFGLAQKGLQTVCLTKVFPTRSHTVAAQGGISAALG 61

Query: 69  NMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRP 128
           NM  D W++H YDTIKGSDWLGD DAI+Y+  EA  ++ ELEHYGVPFSR E GKIYQRP
Sbjct: 62  NMGEDDWRYHFYDTIKGSDWLGDQDAIEYMCREAIPAIIELEHYGVPFSRTEEGKIYQRP 121

Query: 129 FGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCC 188
           FGG    YGEGP  QRTCAAADRTGHA+LHTLY Q+L +NA F IEYFALDLI + EG C
Sbjct: 122 FGGMTTKYGEGPSAQRTCAAADRTGHAMLHTLYQQSLAHNARFMIEYFALDLIFDEEGVC 181

Query: 189 VGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDME 248
            GV+A  +  G +H F A  VVLATGGYGRAYFSATSAHTCTGDG G+V RAGLP+QDME
Sbjct: 182 RGVLALDMADGTLHLFRAHGVVLATGGYGRAYFSATSAHTCTGDGGGLVMRAGLPVQDME 241

Query: 249 FVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEI 308
           FVQFHPTGIYGAGCLITEG RGEGG L NS GERFMERYAP  KDLASRDVVSR M +EI
Sbjct: 242 FVQFHPTGIYGAGCLITEGVRGEGGILRNSNGERFMERYAPHYKDLASRDVVSRSMTVEI 301

Query: 309 REGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMG 368
           REGRGVG+ KDHI L L HL P V+ E+LPGI+ESA IFAGVDVT+ PIPV+PTVHYNMG
Sbjct: 302 REGRGVGEHKDHILLDLTHLGPEVINEKLPGIAESAHIFAGVDVTKQPIPVLPTVHYNMG 361

Query: 369 GIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIR 428
           GIPTN++GEV+     +P+   PGL AIGEA C SVHGANRLGSNSL+DLVVFGRA   R
Sbjct: 362 GIPTNFYGEVVRKQGDDPDAVVPGLYAIGEAACVSVHGANRLGSNSLLDLVVFGRAVANR 421

Query: 429 ASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQD 488
            +E +  + P  +L   +CD+ +   D+LR+A+G  PT+ +R+ MQR MQ DA VFRT  
Sbjct: 422 CAETVKPNQPHKTLPSDACDKALGLLDKLRYANGSTPTSVIRDNMQRTMQSDAAVFRTSK 481

Query: 489 SLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRG 548
           +L +G   ++ ++    D+KV DRSL+WNSDL+ET EL NL++NA+AT+ SAE RKESRG
Sbjct: 482 TLKEGVDKMAEIFASFEDVKVSDRSLVWNSDLIETYELNNLLLNAVATINSAEQRKESRG 541

Query: 549 SHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPKA 608
           +H+ EDF D     RDDVNW+KH+L  VD + GK + +YRPVH   L   VD   + PK 
Sbjct: 542 AHSHEDFPD-----RDDVNWQKHTLVTVD-DKGKCEFEYRPVHMYTLSQDVDV--VPPKP 593

Query: 609 RVY 611
           RVY
Sbjct: 594 RVY 596


>gi|188991443|ref|YP_001903453.1| succinate dehydrogenase flavoprotein subunit [Xanthomonas
           campestris pv. campestris str. B100]
 gi|167733203|emb|CAP51401.1| succinate dehydrogenase (ubiquinone) flavoprotein subunit
           [Xanthomonas campestris pv. campestris]
          Length = 596

 Score =  823 bits (2127), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/603 (65%), Positives = 462/603 (76%), Gaps = 8/603 (1%)

Query: 9   SSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLA 68
           S+Y   +H YD+VVVGAGGAGLRAT G+A+KG +T C+TKVFPTRSHTVAAQGGI+A+L 
Sbjct: 2   SAYKITEHKYDMVVVGAGGAGLRATFGLAQKGLQTVCLTKVFPTRSHTVAAQGGISAALG 61

Query: 69  NMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRP 128
           NM  D W++H YDTIKGSDWLGD DAI+Y+  EA  ++ ELEHYGVPFSR E GKIYQRP
Sbjct: 62  NMGEDDWRYHFYDTIKGSDWLGDQDAIEYMCREAIPAIIELEHYGVPFSRTEEGKIYQRP 121

Query: 129 FGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCC 188
           FGG    YGEGP  QRTCAAADRTGHA+LHTLY Q+L +NA F IEYFALDLI + EG C
Sbjct: 122 FGGMTTKYGEGPSAQRTCAAADRTGHAMLHTLYQQSLAHNARFMIEYFALDLIFDEEGVC 181

Query: 189 VGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDME 248
            GV+A  +  G +H F A  VVLATGGYGRAYFSATSAHTCTGDG G+V RAGLP+QDME
Sbjct: 182 RGVLALDMAEGSLHLFRAHGVVLATGGYGRAYFSATSAHTCTGDGGGLVMRAGLPMQDME 241

Query: 249 FVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEI 308
           FVQFHPTGIYGAGCLITEG RGEGG L NS GERFMERYAP  KDLASRDVVSR M +EI
Sbjct: 242 FVQFHPTGIYGAGCLITEGVRGEGGILRNSNGERFMERYAPHYKDLASRDVVSRSMTIEI 301

Query: 309 REGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMG 368
           REGRGVG+ KDHI L L HL P V+ ++LPGI+ESA IFAGVDV + PIPV+PTVHYNMG
Sbjct: 302 REGRGVGEHKDHILLDLTHLGPEVINDKLPGIAESAHIFAGVDVAKQPIPVLPTVHYNMG 361

Query: 369 GIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIR 428
           GIPTNY GEV+     NP+   PGL AIGEA C SVHGANRLGSNSL+DLVVFGRA   R
Sbjct: 362 GIPTNYHGEVVRKQGDNPDAVVPGLYAIGEAACVSVHGANRLGSNSLLDLVVFGRAVANR 421

Query: 429 ASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQD 488
            +E +  + P   L   +CD+ +   D+LRHA+G  PT+ +R+ MQR MQ DA VFRT  
Sbjct: 422 CAETVKTNQPHKPLPSDACDKALGLLDKLRHANGSTPTSVIRDNMQRTMQSDAAVFRTSK 481

Query: 489 SLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRG 548
           +L +G   ++ ++    D+KV DRSL+WNSDL+ET EL NL++NA+AT+ SAE RKESRG
Sbjct: 482 TLKEGVDKMAEIFATFEDVKVSDRSLVWNSDLIETYELNNLLLNAVATINSAEQRKESRG 541

Query: 549 SHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPKA 608
           +HA EDF D     RDDVNW+KH+L  VD + G+   +YRPVH   L   VD   + PK 
Sbjct: 542 AHAHEDFPD-----RDDVNWQKHTLVTVD-DKGQCDFEYRPVHMYTLSKEVDV--VPPKP 593

Query: 609 RVY 611
           RVY
Sbjct: 594 RVY 596


>gi|16127757|ref|NP_422321.1| succinate dehydrogenase flavoprotein subunit [Caulobacter
           crescentus CB15]
 gi|221236578|ref|YP_002519015.1| succinate dehydrogenase flavoprotein subunit [Caulobacter
           crescentus NA1000]
 gi|13425259|gb|AAK25489.1| succinate dehydrogenase, flavoprotein subunit [Caulobacter
           crescentus CB15]
 gi|220965751|gb|ACL97107.1| succinate dehydrogenase flavoprotein subunit [Caulobacter
           crescentus NA1000]
          Length = 596

 Score =  823 bits (2127), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 406/605 (67%), Positives = 483/605 (79%), Gaps = 9/605 (1%)

Query: 7   LKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAAS 66
           + S+Y ++DH +DVVVVGAGG+GLRA LG A+ G KTACITKVFPTRSHTVAAQGGI+AS
Sbjct: 1   MMSAYKFIDHKFDVVVVGAGGSGLRAALGAAQAGLKTACITKVFPTRSHTVAAQGGISAS 60

Query: 67  LANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQ 126
           L NM  D W+WH++DT+KGSDWLGD DAI+YL   AP +VYELEH+GVPFSR   GKIYQ
Sbjct: 61  LGNMGQDDWRWHMFDTVKGSDWLGDQDAIEYLTRNAPAAVYELEHWGVPFSRTPDGKIYQ 120

Query: 127 RPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEG 186
           R FGG  +N+GEGP +QRTCAAADRTGHA+LHT+YGQ+L ++ EFFIEYFALDLI++ +G
Sbjct: 121 RAFGGMTKNFGEGP-IQRTCAAADRTGHAMLHTMYGQSLAHDTEFFIEYFALDLIMD-DG 178

Query: 187 CCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQD 246
            C GV AW+L+ G +HRF A++V+LATGGYGRAYFSATSAHTCTGDG  M  RAGLPLQD
Sbjct: 179 VCRGVTAWKLDDGTLHRFQAQMVILATGGYGRAYFSATSAHTCTGDGNAMALRAGLPLQD 238

Query: 247 MEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMM 306
           MEFVQFHPTGIYGAGCLITEGARGEGGYL NS+GERFMERYAP+ KDLA RD+VSR M +
Sbjct: 239 MEFVQFHPTGIYGAGCLITEGARGEGGYLTNSEGERFMERYAPTVKDLAPRDMVSRAMTI 298

Query: 307 EIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYN 366
           EIREGRGVG +KDHI L+L+HLDP +L ERLPGISE+A++FAGVDVT+ PIPV+PTVHYN
Sbjct: 299 EIREGRGVGPNKDHIFLHLDHLDPKILAERLPGISETAKVFAGVDVTKAPIPVLPTVHYN 358

Query: 367 MGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAV 426
           MGGIPTNY GEV+  +  NP++  PGLMA+GEA C SVHGANRLGSNSLIDLVVFGRAA 
Sbjct: 359 MGGIPTNYHGEVVTKSGDNPDQVIPGLMAVGEAACVSVHGANRLGSNSLIDLVVFGRAAA 418

Query: 427 IRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRT 486
           +R +E++   +  P L     D  + RFDR R+A G   TA LR +MQ+AMQ DA VFRT
Sbjct: 419 LRCAEILKPGAKQPELKDVQTDAHLARFDRFRNASGSTGTAELRLEMQKAMQEDAAVFRT 478

Query: 487 QDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKES 546
            +SL  G   L  +WD+ ADLKV DR L+WN+DL+ETLE  NL+  A+ TV  A  R ES
Sbjct: 479 GESLDSGVARLQAVWDKKADLKVSDRGLVWNTDLMETLEFDNLIGQAVVTVNGAANRTES 538

Query: 547 RGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAP 606
           RG+HAREDF D     R+D  W KH+L W+D +TGK+K+DYRPVH+  +   + Y  I P
Sbjct: 539 RGAHAREDFSD-----RNDAEWMKHTLAWLDLDTGKVKIDYRPVHSYTMSDDIAY--IPP 591

Query: 607 KARVY 611
           K RVY
Sbjct: 592 KQRVY 596


>gi|315497257|ref|YP_004086061.1| succinate dehydrogenase, flavoprotein subunit [Asticcacaulis
           excentricus CB 48]
 gi|315415269|gb|ADU11910.1| succinate dehydrogenase, flavoprotein subunit [Asticcacaulis
           excentricus CB 48]
          Length = 594

 Score =  823 bits (2126), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 415/602 (68%), Positives = 478/602 (79%), Gaps = 9/602 (1%)

Query: 10  SYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLAN 69
           +Y  ++H YDVVVVGAGGAGLRA LG  + G KTACITKVFPTRSHTVAAQGG+AASL N
Sbjct: 2   TYKIIEHEYDVVVVGAGGAGLRAALGCGQSGLKTACITKVFPTRSHTVAAQGGVAASLGN 61

Query: 70  MTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRPF 129
           M  D WQWH+YDT+KGSDWLGD DAI+YL   AP +VYELEH+GVPFSR E GKIYQRPF
Sbjct: 62  MGEDKWQWHMYDTVKGSDWLGDQDAIEYLVRNAPDAVYELEHWGVPFSRTEDGKIYQRPF 121

Query: 130 GGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCCV 189
           GG  +N+GEGP VQRTCAAADRTGHA+LHTLYGQ+LK + EFFIEYFALDLI++ +G C 
Sbjct: 122 GGMTKNFGEGP-VQRTCAAADRTGHAMLHTLYGQSLKEDVEFFIEYFALDLIMD-DGVCR 179

Query: 190 GVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDMEF 249
           GV  W+L+ G IH F A LV+LATGGYGRAYFSATSAHTCTGDG GMV RAGLPLQD+EF
Sbjct: 180 GVTCWKLDDGTIHVFRAHLVILATGGYGRAYFSATSAHTCTGDGGGMVLRAGLPLQDLEF 239

Query: 250 VQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEIR 309
           VQFHPTGIYG+GCLITEGARGEGGYL NS GERFMERYAPSAKDLASRDVVSR M MEIR
Sbjct: 240 VQFHPTGIYGSGCLITEGARGEGGYLTNSAGERFMERYAPSAKDLASRDVVSRSMTMEIR 299

Query: 310 EGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMGG 369
           EGRGVG  KDHI L+L+HL P +L +RLPGISESA+IFAGVDVT++PIPVIPTVHYNMGG
Sbjct: 300 EGRGVGPHKDHIFLHLDHLPPDLLHKRLPGISESAKIFAGVDVTKEPIPVIPTVHYNMGG 359

Query: 370 IPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIRA 429
           IPTNY GEV+     NP+   PGLMA+GEA C SVHGANRLGSNSLIDLVVFGRAA  RA
Sbjct: 360 IPTNYHGEVVTLKDGNPDAVVPGLMAVGEAACVSVHGANRLGSNSLIDLVVFGRAAGKRA 419

Query: 430 SEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQDS 489
            E++   +P   +  S+ +  + R D+ R+A+G  PTA LR KMQRAMQ DA VFRT ++
Sbjct: 420 PELVKAGTPHKDIGKSAVEAHLSRLDKFRNANGQAPTADLRLKMQRAMQEDAAVFRTGET 479

Query: 490 LSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRGS 549
           L  G R L  ++    D+ + DR +IWN+DL+E LE  NL+  A+ TV SA  RKESRG+
Sbjct: 480 LEQGVRRLDEIFKASKDIGIKDRGMIWNTDLLEALEYDNLIAQAVITVNSALNRKESRGA 539

Query: 550 HAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPKAR 609
           HARED+ +     RDD NW KH+L W+D  TG++  DYRPVHT  +   + Y  IAPKAR
Sbjct: 540 HAREDYPN-----RDDENWMKHTLMWLDTETGQVTTDYRPVHTYTMTNEIAY--IAPKAR 592

Query: 610 VY 611
           VY
Sbjct: 593 VY 594


>gi|254419444|ref|ZP_05033168.1| succinate dehydrogenase, flavoprotein subunit [Brevundimonas sp.
           BAL3]
 gi|196185621|gb|EDX80597.1| succinate dehydrogenase, flavoprotein subunit [Brevundimonas sp.
           BAL3]
          Length = 594

 Score =  823 bits (2126), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/603 (67%), Positives = 474/603 (78%), Gaps = 10/603 (1%)

Query: 9   SSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLA 68
           ++Y  +DH YDVVVVGAGG+GLRA LG A++G K AC+TKVFPTRSHTVAAQGGI+ASL 
Sbjct: 2   AAYELIDHEYDVVVVGAGGSGLRAALGAAQQGLKVACVTKVFPTRSHTVAAQGGISASLG 61

Query: 69  NMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRP 128
           NM  DSWQWH+YDT+KGSDWLGD D+I+YL   AP++VYELEH+GVPFSR + GKIYQR 
Sbjct: 62  NMGEDSWQWHMYDTVKGSDWLGDQDSIEYLVRNAPKAVYELEHWGVPFSRTDEGKIYQRA 121

Query: 129 FGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCC 188
           FGG  +N+GEGP VQRTCAAADRTGHAILHTLYGQ+++   +FF+EYFALDLI+  +G C
Sbjct: 122 FGGMTRNFGEGP-VQRTCAAADRTGHAILHTLYGQSVRREVKFFVEYFALDLIMQ-DGAC 179

Query: 189 VGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDME 248
            GV A QL+ G++H+F AK+VVLATGGYGRAYFSATSAHTCTGDG  MV RAGLPLQDME
Sbjct: 180 TGVTALQLDNGQLHQFRAKMVVLATGGYGRAYFSATSAHTCTGDGNAMVLRAGLPLQDME 239

Query: 249 FVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEI 308
           FVQFHPTGIYGAGCLITEGARGEGGYL NS+GERFMERYAP+ KDLA RD+VSR M +EI
Sbjct: 240 FVQFHPTGIYGAGCLITEGARGEGGYLTNSEGERFMERYAPTVKDLAPRDMVSRSMTIEI 299

Query: 309 REGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMG 368
           REGRGVG +KDHI L+L+HLDP +L +RLPGISESA+IFAGVDVT+ PIPV+PTVHYNMG
Sbjct: 300 REGRGVGPNKDHIFLHLDHLDPKILHQRLPGISESAKIFAGVDVTKAPIPVLPTVHYNMG 359

Query: 369 GIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIR 428
           GIPTNY GEVL     NP+   PGLMA+GEA C SVHGANRLGSNSL DLVVFGRA  +R
Sbjct: 360 GIPTNYHGEVLTLRDGNPDSVVPGLMAVGEAACVSVHGANRLGSNSLTDLVVFGRAVGLR 419

Query: 429 ASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQD 488
             E++DK+S +PS   +  D  + R DR R ADG  PTA LR  MQRAMQ DA VFRT +
Sbjct: 420 CGEVVDKASAVPSASKTQTDAHLARLDRFRFADGSTPTAELRLSMQRAMQADAAVFRTGE 479

Query: 489 SLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRG 548
           +L  G   L  +    AD+K  DR LIWN+DL+ETLE  NL+  A+ T+ S   R ESRG
Sbjct: 480 TLQQGTDKLRAIDAAGADIKTTDRGLIWNTDLMETLEYDNLIAQAVVTIESGLNRTESRG 539

Query: 549 SHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPKA 608
           +HARED+ D     RDD NW KH+L W      ++++DYRPVH   +   + Y  I PKA
Sbjct: 540 AHAREDYPD-----RDDANWMKHTLAWKRPGE-QVQIDYRPVHNYTMSDDIAY--IEPKA 591

Query: 609 RVY 611
           RVY
Sbjct: 592 RVY 594


>gi|148260875|ref|YP_001235002.1| succinate dehydrogenase flavoprotein subunit [Acidiphilium cryptum
           JF-5]
 gi|146402556|gb|ABQ31083.1| succinate dehydrogenase subunit A [Acidiphilium cryptum JF-5]
          Length = 603

 Score =  822 bits (2123), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/602 (65%), Positives = 467/602 (77%), Gaps = 9/602 (1%)

Query: 10  SYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLAN 69
           +YT +DH+YDV+VVGAGG+GLRATLGM + G KTACI+KVFPTRSHTVAAQGGI A+L N
Sbjct: 11  AYTIIDHTYDVIVVGAGGSGLRATLGMGQAGLKTACISKVFPTRSHTVAAQGGIGAALGN 70

Query: 70  MTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRPF 129
           M PD W+WH+YDT+KGSDWLGD DAI+Y+  EA  +++ELEH+GVPFSR E GKIYQRPF
Sbjct: 71  MEPDDWRWHMYDTVKGSDWLGDQDAIEYMCREAIPAIHELEHFGVPFSRTEDGKIYQRPF 130

Query: 130 GGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCCV 189
           GGHM+++G+ P V+R CAAADRTGHAILHTLY Q+LK + EFF+EYFA DLI++ EG C 
Sbjct: 131 GGHMKDFGQAP-VRRACAAADRTGHAILHTLYQQSLKADVEFFVEYFATDLIMDDEGACR 189

Query: 190 GVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDMEF 249
           GV+AW LE G IHRF A+LVVLATGGYGRAY S TSAHTCTGDG GM  RAGLP+QDMEF
Sbjct: 190 GVMAWCLEDGTIHRFRAQLVVLATGGYGRAYLSCTSAHTCTGDGGGMALRAGLPMQDMEF 249

Query: 250 VQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEIR 309
           VQFHPTGI+ AGCLITEGARGEGGYL N++GERFMERYAP+AKDLASRDVVSR M +EI 
Sbjct: 250 VQFHPTGIFPAGCLITEGARGEGGYLTNAEGERFMERYAPTAKDLASRDVVSRSMTIEIM 309

Query: 310 EGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMGG 369
           EGRG G +KDHI L+L  L P  L ERLPGISE+AR+FAGVDVT+ PIPV+PTVHYNMGG
Sbjct: 310 EGRGCGPNKDHILLHLEGLKPEQLHERLPGISETARVFAGVDVTKAPIPVLPTVHYNMGG 369

Query: 370 IPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIRA 429
           IPTNY  EVL     NP+   PGLMA+GEA C SVHGANRLG+NSL+DLVVFGRAA  +A
Sbjct: 370 IPTNYRAEVLRPTKDNPDAIVPGLMAVGEAACVSVHGANRLGTNSLLDLVVFGRAAAHQA 429

Query: 430 SEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQDS 489
           ++++   +  P+L   + +  +DR D  RHA G    AALR++MQR MQ  A VFR   +
Sbjct: 430 AKVVTPGASQPALPARAGEASLDRLDATRHAKGGTTVAALRDQMQRTMQNHAAVFRNSKT 489

Query: 490 LSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRGS 549
           L +G   +S LW  + D+ V DR LIWNSDL+E LEL NLM NAI T+ SAEAR ESRG+
Sbjct: 490 LKEGVAKMSGLWQGLKDISVSDRGLIWNSDLMEALELHNLMGNAITTMASAEARHESRGA 549

Query: 550 HAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPKAR 609
           HA +DF +     RDD  W KHSL     + G++ LDYRPV  + L    D S   PK R
Sbjct: 550 HAHDDFPE-----RDDAEWMKHSLAHCT-DEGEVALDYRPVRMQTLTN--DVSVFPPKKR 601

Query: 610 VY 611
           VY
Sbjct: 602 VY 603


>gi|144898839|emb|CAM75703.1| succinate dehydrogenase flavoprotein subunit [Magnetospirillum
           gryphiswaldense MSR-1]
          Length = 593

 Score =  822 bits (2122), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 410/603 (67%), Positives = 481/603 (79%), Gaps = 11/603 (1%)

Query: 9   SSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLA 68
           ++Y  +DH+YDVVVVGAGGAGLRAT+GM   G KTACITKVFPTRSHTVAAQGGI ASL 
Sbjct: 2   AAYKIIDHTYDVVVVGAGGAGLRATMGMGAAGLKTACITKVFPTRSHTVAAQGGIGASLG 61

Query: 69  NMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRP 128
           NM  D+W+WH+YDT+KGSDWLGD DAI+Y+  EA  +VYELEH+GVPFSR   GKIYQRP
Sbjct: 62  NMAEDNWKWHMYDTVKGSDWLGDQDAIEYMCREAVPAVYELEHFGVPFSRTPEGKIYQRP 121

Query: 129 FGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCC 188
           FGGHM N+GE  PVQR CAAADRTGHAILHTLY Q+LK++ EFF+EYFALDLI+  +G C
Sbjct: 122 FGGHMSNFGE-KPVQRACAAADRTGHAILHTLYSQSLKHSCEFFVEYFALDLIME-DGAC 179

Query: 189 VGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDME 248
            GVVAW L+ G +HRF A  VVLA+GGYGRAYFS TSAHTCTGDG GMV+RAGLPLQDME
Sbjct: 180 RGVVAWNLDDGSLHRFRAHKVVLASGGYGRAYFSCTSAHTCTGDGHGMVSRAGLPLQDME 239

Query: 249 FVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEI 308
           FVQFHPTGIYG+GCLITEGARGEGG L NS GERFMERYAP+AKDLASRDVVSR M +EI
Sbjct: 240 FVQFHPTGIYGSGCLITEGARGEGGILRNSAGERFMERYAPTAKDLASRDVVSRAMTVEI 299

Query: 309 REGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMG 368
           REGRGVG   DHI L+L+HLDPA L+ RLPGISE+++IFAGVDVT+ PIPV+PTVHYNMG
Sbjct: 300 REGRGVGAGNDHIFLHLDHLDPADLELRLPGISETSKIFAGVDVTKQPIPVLPTVHYNMG 359

Query: 369 GIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIR 428
           GIPTN  GEVL   + NP+    GLMAIGEA C SVHGANRLG+NSL+D+VVFGRAA +R
Sbjct: 360 GIPTNVHGEVLRPTADNPDATVEGLMAIGEAACVSVHGANRLGTNSLLDIVVFGRAAALR 419

Query: 429 ASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQD 488
           A+E +   +    L   + D  + RFDRLR+A+G + T+ +R  MQ+ MQ DA VFRT  
Sbjct: 420 AAETLKPGTTHKPLAKDAGDNAVARFDRLRNANGSLHTSEIRLAMQKTMQNDAAVFRTSK 479

Query: 489 SLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRG 548
           +L++GC  +  +   +  +K++DRS +WNSDLVE LEL+NLM  A AT+ SAEAR ESRG
Sbjct: 480 TLAEGCAKMEQVASTLPQIKINDRSTVWNSDLVEALELENLMDCAQATIVSAEARHESRG 539

Query: 549 SHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPKA 608
           +HA ED+ D     RDDVNW+KHSL WV+   GK+KLDYRPVHT  L   V+Y  I P+ 
Sbjct: 540 AHAHEDYPD-----RDDVNWQKHSLAWVE--NGKVKLDYRPVHTYTLTDEVEY--IKPQK 590

Query: 609 RVY 611
           RVY
Sbjct: 591 RVY 593


>gi|326404269|ref|YP_004284351.1| succinate dehydrogenase flavoprotein subunit [Acidiphilium
           multivorum AIU301]
 gi|325051131|dbj|BAJ81469.1| succinate dehydrogenase flavoprotein subunit [Acidiphilium
           multivorum AIU301]
          Length = 603

 Score =  822 bits (2122), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/602 (65%), Positives = 467/602 (77%), Gaps = 9/602 (1%)

Query: 10  SYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLAN 69
           +YT +DH+YDV+VVGAGG+GLRATLGM + G KTACI+KVFPTRSHTVAAQGGI A+L N
Sbjct: 11  AYTIIDHTYDVIVVGAGGSGLRATLGMGQAGLKTACISKVFPTRSHTVAAQGGIGAALGN 70

Query: 70  MTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRPF 129
           M PD W+WH+YDT+KGSDWLGD DAI+Y+  EA  +++ELEH+GVPFSR E GKIYQRPF
Sbjct: 71  MEPDDWRWHMYDTVKGSDWLGDQDAIEYMCREAIPAIHELEHFGVPFSRTEDGKIYQRPF 130

Query: 130 GGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCCV 189
           GGHM+++G+ P V+R CAAADRTGHAILHTLY Q+LK + EFF+EYFA DLI++ EG C 
Sbjct: 131 GGHMKDFGQAP-VRRACAAADRTGHAILHTLYQQSLKADVEFFVEYFATDLIMDDEGACR 189

Query: 190 GVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDMEF 249
           GV+AW LE G IHRF A+LVVLATGGYGRAY S TSAHTCTGDG GM  RAGLP+QDMEF
Sbjct: 190 GVMAWCLEDGTIHRFRAQLVVLATGGYGRAYLSCTSAHTCTGDGGGMALRAGLPMQDMEF 249

Query: 250 VQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEIR 309
           VQFHPTGI+ AGCLITEGARGEGGYL N++GERFMERYAP+AKDLASRDVVSR M +EI 
Sbjct: 250 VQFHPTGIFPAGCLITEGARGEGGYLTNAEGERFMERYAPTAKDLASRDVVSRSMTIEIM 309

Query: 310 EGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMGG 369
           EGRG G +KDHI L+L  L P  L ERLPGISE+AR+FAGVDVT+ PIPV+PTVHYNMGG
Sbjct: 310 EGRGCGPNKDHILLHLEGLKPEQLHERLPGISETARVFAGVDVTKAPIPVLPTVHYNMGG 369

Query: 370 IPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIRA 429
           IPTNY  EVL     NP+   PGLMA+GEA C SVHGANRLG+NSL+DLVVFGRAA  +A
Sbjct: 370 IPTNYRAEVLRPTRDNPDAIVPGLMAVGEAACVSVHGANRLGTNSLLDLVVFGRAAAHQA 429

Query: 430 SEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQDS 489
           ++++   +  P+L   + +  +DR D  RHA G    AALR++MQR MQ  A VFR   +
Sbjct: 430 AKVVTPGASQPALPARAGEASLDRLDATRHAKGGTTVAALRDQMQRTMQNHAAVFRNSKT 489

Query: 490 LSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRGS 549
           L +G   +S LW  + D+ V DR LIWNSDL+E LEL NLM NAI T+ SAEAR ESRG+
Sbjct: 490 LKEGVAKMSGLWQGLKDISVSDRGLIWNSDLMEALELHNLMGNAITTMASAEARHESRGA 549

Query: 550 HAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPKAR 609
           HA +DF +     RDD  W KHSL     + G++ LDYRPV  + L    D S   PK R
Sbjct: 550 HAHDDFPE-----RDDAEWMKHSLAHCT-DEGEVALDYRPVRMQTLTN--DVSVFPPKKR 601

Query: 610 VY 611
           VY
Sbjct: 602 VY 603


>gi|312112886|ref|YP_004010482.1| succinate dehydrogenase, flavoprotein subunit [Rhodomicrobium
           vannielii ATCC 17100]
 gi|311218015|gb|ADP69383.1| succinate dehydrogenase, flavoprotein subunit [Rhodomicrobium
           vannielii ATCC 17100]
          Length = 610

 Score =  820 bits (2119), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 408/602 (67%), Positives = 478/602 (79%), Gaps = 9/602 (1%)

Query: 10  SYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLAN 69
           +Y   DH++DVVVVGAGGAGLRATLG A+ G KTAC+TKVFPTRSHTVAAQGGIAA+L N
Sbjct: 18  AYKIHDHTFDVVVVGAGGAGLRATLGCAQAGLKTACVTKVFPTRSHTVAAQGGIAAALGN 77

Query: 70  MTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRPF 129
           M PD W+WH+YDT+KGSDWLGD DAI+YL   AP +VYELEHYG+PFSR EAGKIYQRPF
Sbjct: 78  MGPDDWRWHMYDTVKGSDWLGDQDAIEYLCRNAPAAVYELEHYGMPFSRTEAGKIYQRPF 137

Query: 130 GGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCCV 189
           GG    +GEGPP QRTCAAADRTGHA+LHTLYGQ+L+ +A+FF+E+FALDLI+  +G C 
Sbjct: 138 GGMTTEFGEGPPAQRTCAAADRTGHAMLHTLYGQSLRYSADFFVEHFALDLIM-EDGICR 196

Query: 190 GVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDMEF 249
           GV++  LE G IHR  AK  ++ATGGYGR YFSATSAHTCTGDG  MV RAGLPLQDMEF
Sbjct: 197 GVMSLSLEDGSIHRIRAKKTIIATGGYGRTYFSATSAHTCTGDGNAMVLRAGLPLQDMEF 256

Query: 250 VQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEIR 309
           VQFHPTGIYGAG LITEGARGEGGYL NS+GERFMERYAP AKDLASRDVVSR M +EIR
Sbjct: 257 VQFHPTGIYGAGVLITEGARGEGGYLTNSQGERFMERYAPHAKDLASRDVVSRSMTIEIR 316

Query: 310 EGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMGG 369
           EGRGVG +KDHI+L+L+HLDP +L ERLPGI+ESA+IFAGVD+ R PIPVIPTVHYNMGG
Sbjct: 317 EGRGVGPNKDHIYLHLDHLDPKILAERLPGITESAQIFAGVDLRRQPIPVIPTVHYNMGG 376

Query: 370 IPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIRA 429
           IPTN+ GE L+  + +P+   PGLMAIGEA CASVHGANRLGSNSLIDLVVFGRAA +R 
Sbjct: 377 IPTNHLGEALNPRAGDPDATIPGLMAIGEASCASVHGANRLGSNSLIDLVVFGRAAALRC 436

Query: 430 SEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQDS 489
           +E I+K     +L  ++ +  + R DR RHA+G  PT+ LR KMQR MQ +  VFR  D 
Sbjct: 437 AETIEKGEH-SNLPANAGEEAIARLDRFRHANGSTPTSVLRGKMQRIMQNNCAVFRQADV 495

Query: 490 LSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRGS 549
           L +G R +  +WD + D++V DRSL+WN+DL ETLE  N++  A+ATV  A AR+ESRG+
Sbjct: 496 LEEGVRLIKEVWDGIEDVRVTDRSLVWNTDLTETLEFNNMIGLALATVSGAHARQESRGA 555

Query: 550 HAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPKAR 609
           HAREDF +     RDD NW KH+L + D     + L+YRPVHT  L   V Y  I PKAR
Sbjct: 556 HAREDFPN-----RDDENWMKHTLAYGDDEKRSVALEYRPVHTHTLTNDVQY--IQPKAR 608

Query: 610 VY 611
           VY
Sbjct: 609 VY 610


>gi|21231574|ref|NP_637491.1| succinate dehydrogenase flavoprotein subunit [Xanthomonas
           campestris pv. campestris str. ATCC 33913]
 gi|66768304|ref|YP_243066.1| succinate dehydrogenase flavoprotein subunit [Xanthomonas
           campestris pv. campestris str. 8004]
 gi|21113261|gb|AAM41415.1| succinate dehydrogenase flavoprotein subunit [Xanthomonas
           campestris pv. campestris str. ATCC 33913]
 gi|66573636|gb|AAY49046.1| succinate dehydrogenase flavoprotein subunit [Xanthomonas
           campestris pv. campestris str. 8004]
          Length = 596

 Score =  820 bits (2118), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/603 (65%), Positives = 461/603 (76%), Gaps = 8/603 (1%)

Query: 9   SSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLA 68
           S+Y   +H YD+VVVGAGGAGLRAT G+A+KG +T C+TKVFPTRSHTVAAQGGI+A+L 
Sbjct: 2   SAYKITEHKYDMVVVGAGGAGLRATFGLAQKGLQTVCLTKVFPTRSHTVAAQGGISAALG 61

Query: 69  NMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRP 128
           NM  D W++H YDTIKGSDWLGD DAI+Y+  EA  ++ ELEHYGVPFSR E GKIYQRP
Sbjct: 62  NMGEDDWRYHFYDTIKGSDWLGDQDAIEYMCREAIPAIIELEHYGVPFSRTEEGKIYQRP 121

Query: 129 FGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCC 188
           FGG    YGEGP  QRTCAAADRTGHA+LHTLY Q+L +NA F IEYFALDLI + EG C
Sbjct: 122 FGGMTTKYGEGPSAQRTCAAADRTGHAMLHTLYQQSLAHNARFMIEYFALDLIFDEEGVC 181

Query: 189 VGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDME 248
            GV+A  +  G +H F A  VVLATGGYGRAYFSATSAHTCTGDG G+V RAGLP+QDME
Sbjct: 182 RGVLALDMAEGSLHLFRAHGVVLATGGYGRAYFSATSAHTCTGDGGGLVMRAGLPMQDME 241

Query: 249 FVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEI 308
           FVQFHPTGIYGAGCLITEG RGEGG L NS GERFMERYAP  KDLASRDVVSR M +EI
Sbjct: 242 FVQFHPTGIYGAGCLITEGVRGEGGILRNSNGERFMERYAPHYKDLASRDVVSRSMTIEI 301

Query: 309 REGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMG 368
           REGRGVG+ KDHI L L HL P V+ ++LPGI+ESA IFAGVDV + PIPV+PTVHYNMG
Sbjct: 302 REGRGVGEHKDHILLDLTHLGPEVINDKLPGIAESAHIFAGVDVAKQPIPVLPTVHYNMG 361

Query: 369 GIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIR 428
           GIPTNY GEV+     NP+   PGL AIGEA C SVHGANRLGSNSL+DLVVFGRA   R
Sbjct: 362 GIPTNYHGEVVRKQGDNPDAVVPGLYAIGEAACVSVHGANRLGSNSLLDLVVFGRAVANR 421

Query: 429 ASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQD 488
            +E +  + P   L   +CD+ +   D+LRHA+G  PT+ +R+ MQR MQ DA VFRT  
Sbjct: 422 CAETVKTNQPHKPLPSDACDKALGLLDKLRHANGSTPTSVIRDNMQRTMQSDAAVFRTSK 481

Query: 489 SLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRG 548
           +L +G   ++ ++    D+KV DRSL+WNSDL+ET EL NL++NA+AT+ SAE RKESRG
Sbjct: 482 TLKEGVDKMAEIFATFEDVKVSDRSLVWNSDLIETYELNNLLLNAVATINSAEQRKESRG 541

Query: 549 SHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPKA 608
           +HA EDF D     RDDVNW+KH+L  VD + G+   +YR VH   L   VD   + PK 
Sbjct: 542 AHAHEDFPD-----RDDVNWQKHTLVTVD-DKGQCDFEYRQVHMYTLSKEVDV--VPPKP 593

Query: 609 RVY 611
           RVY
Sbjct: 594 RVY 596


>gi|190573778|ref|YP_001971623.1| succinate dehydrogenase flavoprotein subunit [Stenotrophomonas
           maltophilia K279a]
 gi|190011700|emb|CAQ45319.1| putative succinate dehydrogenase flavoprotein subunit
           [Stenotrophomonas maltophilia K279a]
          Length = 596

 Score =  819 bits (2116), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/603 (65%), Positives = 460/603 (76%), Gaps = 8/603 (1%)

Query: 9   SSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLA 68
           S+Y   +H YD+VVVGAGGAGLRAT G+A KG +T C+TKVFPTRSHTVAAQGGI+A+LA
Sbjct: 2   SAYKITEHKYDMVVVGAGGAGLRATFGLAAKGLQTVCLTKVFPTRSHTVAAQGGISAALA 61

Query: 69  NMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRP 128
           NM  D W++H +DTIKGSDWLGD DAI+Y+  EA  ++ ELEHYGVPFSR   GKIYQRP
Sbjct: 62  NMGEDDWRYHFFDTIKGSDWLGDQDAIEYMCREAIPAIIELEHYGVPFSRTAEGKIYQRP 121

Query: 129 FGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCC 188
           FGG    YGEGP  QRTCAAADRTGHA+LHTLY Q+LK++A F IEYFALDLI + EG C
Sbjct: 122 FGGMTTKYGEGPAAQRTCAAADRTGHAMLHTLYQQSLKHDARFMIEYFALDLIFDDEGAC 181

Query: 189 VGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDME 248
            GV+A  +  G +H F A+ VVLATGGYGRAYFSATSAHTCTGDG G+  RAG+ +QDME
Sbjct: 182 RGVLALDMSDGTLHLFRAQGVVLATGGYGRAYFSATSAHTCTGDGGGLAMRAGIAMQDME 241

Query: 249 FVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEI 308
           FVQFHPTGIYGAGCLITEG RGEGG L NS GERFMERYAP  KDLASRDVVSR M +EI
Sbjct: 242 FVQFHPTGIYGAGCLITEGVRGEGGILRNSSGERFMERYAPHYKDLASRDVVSRSMTIEI 301

Query: 309 REGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMG 368
           REGRGVG+ KDHI L L HL P V+ ++LPGI+ESARIFAGVDV + PIPVIPTVHYNMG
Sbjct: 302 REGRGVGEHKDHILLDLTHLGPGVIDDKLPGIAESARIFAGVDVHKQPIPVIPTVHYNMG 361

Query: 369 GIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIR 428
           GIPTNY GEV+     N     PGL AIGEA C SVHGANRLGSNSL+DLVVFGRA   R
Sbjct: 362 GIPTNYHGEVVQKVGDNDNAVVPGLYAIGEAACVSVHGANRLGSNSLLDLVVFGRAVANR 421

Query: 429 ASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQD 488
            +E I   +    L   +CD+ +   D+LRHA+G  PT+ +R++MQR MQ DA VFRT  
Sbjct: 422 CAETIKPGASHKPLPADACDKALGLLDKLRHANGDTPTSVIRDRMQRTMQADAAVFRTSQ 481

Query: 489 SLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRG 548
           +L +GC  +  ++D   D+KV DRSL+WNSDL+ET EL NL++NA+AT+ SAE RKESRG
Sbjct: 482 TLKEGCEKMDKIFDSFQDVKVSDRSLVWNSDLIETYELNNLLLNAVATINSAEQRKESRG 541

Query: 549 SHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPKA 608
           +HA ED+ D     RDDVNW+KH+L  VD   GK   DYRPVH   L    D S + PK 
Sbjct: 542 AHAHEDYPD-----RDDVNWQKHTLVSVD-EKGKCSFDYRPVHMYTLTD--DVSVVPPKP 593

Query: 609 RVY 611
           RVY
Sbjct: 594 RVY 596


>gi|298293272|ref|YP_003695211.1| succinate dehydrogenase, flavoprotein subunit [Starkeya novella DSM
           506]
 gi|296929783|gb|ADH90592.1| succinate dehydrogenase, flavoprotein subunit [Starkeya novella DSM
           506]
          Length = 621

 Score =  817 bits (2111), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/603 (67%), Positives = 480/603 (79%), Gaps = 8/603 (1%)

Query: 9   SSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLA 68
           ++Y   DHSYDVVVVGAGGAGLRA +G +E G +TAC+TKVFPTRSHTVAAQGGIAASL 
Sbjct: 27  AAYPITDHSYDVVVVGAGGAGLRAVVGCSEAGLRTACVTKVFPTRSHTVAAQGGIAASLG 86

Query: 69  NMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRP 128
           NM+ D W++H+YDT+KGSDWLGD DAI+YL  +AP +VYELEH+GVPFSR E GKIYQRP
Sbjct: 87  NMSRDDWRFHMYDTVKGSDWLGDQDAIEYLVRQAPAAVYELEHWGVPFSRTEEGKIYQRP 146

Query: 129 FGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCC 188
           FGG   +YG+G   QRTCAAADRTGHAILHTLYG ALK++AEFFIEYFALDLI++ +G C
Sbjct: 147 FGGMTTDYGKGT-AQRTCAAADRTGHAILHTLYGAALKHSAEFFIEYFALDLIMDEDGRC 205

Query: 189 VGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDME 248
            G+VA +++ G +HRF A++V+LATGGYGRAYFSATSAHTCTGDG  MV RAGLPLQDME
Sbjct: 206 RGIVALKMDDGTLHRFRAQMVILATGGYGRAYFSATSAHTCTGDGNAMVLRAGLPLQDME 265

Query: 249 FVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEI 308
           FVQFHPTGIYGAGCLITEGARGEGGYL NS+GERFMERYAPSAKDLASRDVVSR M MEI
Sbjct: 266 FVQFHPTGIYGAGCLITEGARGEGGYLTNSEGERFMERYAPSAKDLASRDVVSRSMTMEI 325

Query: 309 REGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMG 368
           REGRGVGK+KDHI+L+L+HLDPAVL ERLPGISESARIFAGVD+T++PIPV+PTVHYNMG
Sbjct: 326 REGRGVGKNKDHIYLHLDHLDPAVLHERLPGISESARIFAGVDLTKEPIPVLPTVHYNMG 385

Query: 369 GIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIR 428
           GIPTN+ GEVL     N +   PGLMA+GE  C SVHGANRLGSNSL DLVVFGRAA +R
Sbjct: 386 GIPTNFHGEVLTKKGGNADHVVPGLMAVGECACVSVHGANRLGSNSLTDLVVFGRAAALR 445

Query: 429 ASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQD 488
            +E++        L   S D  + R DR R+ADG  PTA LR +MQ+ MQ +  V+RT +
Sbjct: 446 CAELLTSGEKQRELPADSADAAISRLDRFRNADGGTPTAELRLQMQKVMQNNCAVYRTGE 505

Query: 489 SLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRG 548
            L +G + ++ ++    D+ V DRSL+WNSDL+ETLE  NL+  A  T+  A AR ESRG
Sbjct: 506 VLEEGRKLIAEVFAGTDDIDVTDRSLVWNSDLIETLEYDNLIGLATVTMEGAAARTESRG 565

Query: 549 SHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPKA 608
           +HARED+ +     RDD NW KH+L +VD++   ++LD RPVHT  L   + Y  I P+ 
Sbjct: 566 AHAREDYPE-----RDDANWMKHTLAFVDFDKRSVRLDDRPVHTYTLSNDIQY--IEPRK 618

Query: 609 RVY 611
           RVY
Sbjct: 619 RVY 621


>gi|149184714|ref|ZP_01863032.1| succinate dehydrogenase flavoprotein subunit [Erythrobacter sp.
           SD-21]
 gi|148832034|gb|EDL50467.1| succinate dehydrogenase flavoprotein subunit [Erythrobacter sp.
           SD-21]
          Length = 588

 Score =  817 bits (2111), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 402/595 (67%), Positives = 457/595 (76%), Gaps = 13/595 (2%)

Query: 23  VGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLANMTPDSWQWHLYDT 82
           +GAGG+GLRAT+G AE G KTACITKVFPTRSHTVAAQGGIAASL N TPD W WH+YDT
Sbjct: 1   MGAGGSGLRATMGSAEAGLKTACITKVFPTRSHTVAAQGGIAASLGNNTPDHWSWHMYDT 60

Query: 83  IKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRPFGGHMQNYGEGPPV 142
           +KGSDWLGD DAI+Y+  EAPQ+VYELEH GVPFSRN+ G IYQRPFGGHMQN GEGPPV
Sbjct: 61  VKGSDWLGDQDAIEYMVREAPQAVYELEHAGVPFSRNDDGTIYQRPFGGHMQNMGEGPPV 120

Query: 143 QRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSE---GCCVGVVAWQLETG 199
           QRTCAAADRTGHA+LH LY Q+LK +A+FFIEYFALDLI+        C GV+A  L+ G
Sbjct: 121 QRTCAAADRTGHAMLHALYQQSLKYDADFFIEYFALDLIMEDGPDGKVCRGVIAMCLDDG 180

Query: 200 EIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDMEFVQFHPTGIYG 259
            IHRF ++ VVLATGGYGR YF+ATSAHTCTGDG GMV RAGLPLQDMEFVQFHPTGIYG
Sbjct: 181 TIHRFRSQAVVLATGGYGRCYFTATSAHTCTGDGGGMVLRAGLPLQDMEFVQFHPTGIYG 240

Query: 260 AGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEIREGRGVGKSKD 319
           AG LITEGARGEGGYL NS+GERFMERYAPSAKDLASRDVVSR M +E+REGRGVG   D
Sbjct: 241 AGVLITEGARGEGGYLTNSEGERFMERYAPSAKDLASRDVVSRSMALEMREGRGVGPDGD 300

Query: 320 HIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMGGIPTNYWGEVL 379
           HI L+L+H+DP VL ERLPGI+ES +IFAGVD+T+ P+PV PTVHYNMGGIP N+ GEV+
Sbjct: 301 HIFLHLDHIDPKVLGERLPGITESGKIFAGVDLTKQPLPVTPTVHYNMGGIPCNFHGEVM 360

Query: 380 DANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIRASEMIDKSSPI 439
             + K+PE+  PGL A+GEA C SVHGANRLGSNSLIDLVVFGRA   R  E++   +  
Sbjct: 361 AGDPKDPEKIVPGLFAVGEAACVSVHGANRLGSNSLIDLVVFGRATGHRLKEIVKPGASH 420

Query: 440 PSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQDSLSDGCRNLSC 499
             L   S D  + R D  RHADG  PTA +R +MQ+ MQ  A VFR    L++G   L  
Sbjct: 421 AELPKGSADMALGRLDHFRHADGASPTAEVRAEMQKGMQKHAAVFRDSKLLAEGVEVLKT 480

Query: 500 LWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRGSHAREDFKDGE 559
           +   M D+KV DRSLIWNSDL+ETLEL NLM  A  T+ SAE RKESRG+HA EDF +  
Sbjct: 481 VNKRMEDIKVFDRSLIWNSDLIETLELDNLMAQANVTMASAENRKESRGAHAHEDFPE-- 538

Query: 560 FGGRDDVNWRKHSLCWVD---WNTGKIKLDYRPVHTELLCGGVDYSKIAPKARVY 611
              RDD NW KH++ W D      G +K+DYRPVH   L   V Y  I PK RVY
Sbjct: 539 ---RDDANWMKHTIAWFDGWGGQGGGVKIDYRPVHEYTLTDDVKY--IEPKKRVY 588


>gi|114320490|ref|YP_742173.1| succinate dehydrogenase flavoprotein subunit [Alkalilimnicola
           ehrlichii MLHE-1]
 gi|114226884|gb|ABI56683.1| succinate dehydrogenase subunit A [Alkalilimnicola ehrlichii
           MLHE-1]
          Length = 596

 Score =  817 bits (2110), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 412/606 (67%), Positives = 478/606 (78%), Gaps = 11/606 (1%)

Query: 7   LKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAAS 66
           +   Y  +DH YDVVVVGAGGAGLRAT GMAEKG KTAC+TKVFPTRSHTVAAQGG++A+
Sbjct: 1   MAGDYKIIDHHYDVVVVGAGGAGLRATFGMAEKGLKTACVTKVFPTRSHTVAAQGGVSAA 60

Query: 67  LANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQ 126
           L NM  D W++H YDTIKGSDWLGD DAI+Y+  EA  ++ ELEHYGVPFSR E GKIYQ
Sbjct: 61  LGNMGEDDWRYHAYDTIKGSDWLGDQDAIEYMCREAIPAIIELEHYGVPFSRTEEGKIYQ 120

Query: 127 RPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEG 186
           RPFGG    YGEG   QRTCAAADRTGHAILHTLY QAL + AEFFIEYFA+DLI+  + 
Sbjct: 121 RPFGGMTVRYGEGT-AQRTCAAADRTGHAILHTLYQQALAHQAEFFIEYFAIDLIMEDDR 179

Query: 187 CCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQD 246
           C  GVVA  L  G IHRF  ++ VLATGGYGR+YFS TSAHTCTGDG+GMV RAGLPLQD
Sbjct: 180 C-RGVVALNLADGTIHRFIGQITVLATGGYGRSYFSCTSAHTCTGDGSGMVLRAGLPLQD 238

Query: 247 MEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMM 306
           MEFVQFHPTG+YG+GCLITEG RGEGGYL NS+GERFMERYAP+AKDLASRDVVSR M +
Sbjct: 239 MEFVQFHPTGVYGSGCLITEGVRGEGGYLTNSEGERFMERYAPNAKDLASRDVVSRSMTV 298

Query: 307 EIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYN 366
           EIREGRGVG  KDHIHL+L HL   V+ ERLPGI+E+ARIFAGVDVT++PIPVIPTVHYN
Sbjct: 299 EIREGRGVGPKKDHIHLHLEHLGAEVIHERLPGIAETARIFAGVDVTKEPIPVIPTVHYN 358

Query: 367 MGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAV 426
           MGGIPTNY GEV+     NP++  PGLMAIGEA C SVHGANRLGSNSL+DLVVFGRAA 
Sbjct: 359 MGGIPTNYQGEVVTLKDGNPDQVVPGLMAIGEAACVSVHGANRLGSNSLLDLVVFGRAAA 418

Query: 427 IRASEMIDKSSPIP-SLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFR 485
           IRA+E+I +   +  +L   + D  ++R +RLR+A G  PTA +R+ MQ  MQ  A VFR
Sbjct: 419 IRAAELIKEGDTVQRALQPGAGDLALERLERLRNAKGSKPTAEIRDGMQETMQNFAAVFR 478

Query: 486 TQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKE 545
           T +SL +GC  ++ ++    D+ V DRSLIWNSDLVETLEL+NL+ NA+AT+ SA  R+E
Sbjct: 479 TGESLQEGCERMAAVYASFEDVAVSDRSLIWNSDLVETLELENLLGNAVATIESARNREE 538

Query: 546 SRGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIA 605
           SRG+HAREDF +     RDD NW KH+L WV  + GK+KLDYRPVH   L   ++   I 
Sbjct: 539 SRGAHAREDFPE-----RDDDNWHKHTLSWVGQD-GKVKLDYRPVHMYTLTDEMEV--IP 590

Query: 606 PKARVY 611
           PKARVY
Sbjct: 591 PKARVY 596


>gi|323138217|ref|ZP_08073289.1| succinate dehydrogenase, flavoprotein subunit [Methylocystis sp.
           ATCC 49242]
 gi|322396469|gb|EFX98998.1| succinate dehydrogenase, flavoprotein subunit [Methylocystis sp.
           ATCC 49242]
          Length = 610

 Score =  816 bits (2108), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 409/602 (67%), Positives = 475/602 (78%), Gaps = 7/602 (1%)

Query: 10  SYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLAN 69
           +Y  VDH++DVVVVGAGGAGLRA +G A+ G   AC+TKVFPTRSHTVAAQGG+AA+L N
Sbjct: 16  AYQVVDHTFDVVVVGAGGAGLRAVVGCAKAGLNVACVTKVFPTRSHTVAAQGGVAAALGN 75

Query: 70  MTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRPF 129
           M PD W+WH+YDT+KGSDWLGD DAI+YL   APQ+VYELEH+GVPFSR E GKIYQRPF
Sbjct: 76  MGPDDWKWHMYDTVKGSDWLGDQDAIEYLCRNAPQAVYELEHWGVPFSRTEEGKIYQRPF 135

Query: 130 GGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCCV 189
           GG   ++G+GPP QRTCAAADRTGHA+LHT+YGQALK+  +FFIEYFA+DLI++S+G C 
Sbjct: 136 GGMTTDFGKGPPAQRTCAAADRTGHAMLHTMYGQALKHETKFFIEYFAIDLIMDSDGACR 195

Query: 190 GVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDMEF 249
           GVV  +L+ G IHRF A L VLATGGYGR Y SATSAHTCTGDG GMV RAGLPLQDMEF
Sbjct: 196 GVVCLKLDDGTIHRFRAGLTVLATGGYGRVYLSATSAHTCTGDGGGMVLRAGLPLQDMEF 255

Query: 250 VQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEIR 309
           VQFHPTGIYGAGCLITEGARGEGGYL NS+GERFMERYAPS KDLA RD+VSR + ME+R
Sbjct: 256 VQFHPTGIYGAGCLITEGARGEGGYLTNSEGERFMERYAPSVKDLAPRDMVSRAITMEVR 315

Query: 310 EGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMGG 369
           EGRGVGK KDH +L+L HLDPA+L ERLPGISES++IFAGVDVTR PIP+IPT HYNMGG
Sbjct: 316 EGRGVGKHKDHAYLHLEHLDPAILHERLPGISESSKIFAGVDVTRQPIPIIPTAHYNMGG 375

Query: 370 IPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIRA 429
           IPTNY GEVL     NP+   PGLMAIGEA C SVHGANRLGSNSLIDLVVFGRAA  RA
Sbjct: 376 IPTNYHGEVLRKVDGNPDAVVPGLMAIGEAACVSVHGANRLGSNSLIDLVVFGRAAGQRA 435

Query: 430 SEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQDS 489
           +E++        L   S +  + R D  RHA G  PTA LR++MQR MQ    V+RT + 
Sbjct: 436 AELVKPGETQQELPADSLELPLSRLDGFRHASGGTPTAELRDRMQRTMQSHCAVYRTGEV 495

Query: 490 LSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRGS 549
           L++G   ++ +W  +AD+KV DRSLIWNSDLVETLE  NL++ A+ T+ SA  RKESRG+
Sbjct: 496 LAEGVAGINDVWRAVADVKVSDRSLIWNSDLVETLEFDNLIVQAVTTMESAANRKESRGA 555

Query: 550 HAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPKAR 609
           HAREDF +     RDD NW KH+L  +D +     +DYRPVH+  +   VDY  I PKAR
Sbjct: 556 HAREDFPN-----RDDANWMKHTLATIDRDQKTTTIDYRPVHSYTMTNEVDY--IEPKAR 608

Query: 610 VY 611
           VY
Sbjct: 609 VY 610


>gi|304320537|ref|YP_003854180.1| succinate dehydrogenase [Parvularcula bermudensis HTCC2503]
 gi|303299439|gb|ADM09038.1| succinate dehydrogenase [Parvularcula bermudensis HTCC2503]
          Length = 580

 Score =  816 bits (2108), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 402/591 (68%), Positives = 463/591 (78%), Gaps = 11/591 (1%)

Query: 21  VVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLANMTPDSWQWHLY 80
           +VVGAGGAGLRATLG A+ G KTAC+TKVFPTRSHTVAAQGGI+ASL NM  D W+WH+Y
Sbjct: 1   MVVGAGGAGLRATLGAAQAGLKTACVTKVFPTRSHTVAAQGGISASLGNMGEDDWRWHMY 60

Query: 81  DTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRPFGGHMQNYGEGP 140
           DT+KGSDWLGD DAI+YL   AP +VYELEH+GVPFSR E GKIYQR FGG  +N+GEG 
Sbjct: 61  DTVKGSDWLGDQDAIEYLCKNAPAAVYELEHWGVPFSRTEDGKIYQRAFGGMTKNFGEGQ 120

Query: 141 PVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCCVGVVAWQLETGE 200
            VQRTCAAADRTGHAILHTLYGQA++  AEFFIEYFALDLI+  +G C G++A +L+TGE
Sbjct: 121 -VQRTCAAADRTGHAILHTLYGQAVRQQAEFFIEYFALDLIM-EDGECRGIMALELDTGE 178

Query: 201 IHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDMEFVQFHPTGIYGA 260
           IHRF AK+VVLATGGYGRAYFS TSAHTCTGDG  MV RAGLPLQDMEFVQFHPTGIYGA
Sbjct: 179 IHRFRAKMVVLATGGYGRAYFSCTSAHTCTGDGNAMVLRAGLPLQDMEFVQFHPTGIYGA 238

Query: 261 GCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEIREGRGVGKSKDH 320
           GCLITEGARGEGGYL NS+GERFMERYAPSAKDLASRDVVSR M +EIREGRGVG + DH
Sbjct: 239 GCLITEGARGEGGYLTNSEGERFMERYAPSAKDLASRDVVSRAMTIEIREGRGVGPNGDH 298

Query: 321 IHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMGGIPTNYWGEVLD 380
           IHL LNH+    L ERLPGISE+A+IF+GVDVT+ PIPV+PTVHYNMGGIPTNY GEVL 
Sbjct: 299 IHLNLNHIPAETLHERLPGISETAKIFSGVDVTKGPIPVLPTVHYNMGGIPTNYHGEVLT 358

Query: 381 ANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIRASEMIDKSSPIP 440
                 +   PGLMAIGEAGC SVHGANRLGSNSLIDLVVFGRAA +R +E++DK +P P
Sbjct: 359 KKDGRDDVVVPGLMAIGEAGCVSVHGANRLGSNSLIDLVVFGRAAGLRCAEILDKDAPTP 418

Query: 441 SLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQDSLSDGCRNLSCL 500
                + D  ++R D  R+ADG  PTA LR +MQ+ MQ +  VFRT D L +G   +  +
Sbjct: 419 DFKNGAGDAALERLDHFRYADGGTPTAELRGRMQKVMQENCAVFRTGDVLKEGQGKIREV 478

Query: 501 WDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRGSHAREDFKDGEF 560
              + D+ V DRSL+WN+DLVETLE  NL+  A+ T+ SA  R+ESRG+HAREDF D   
Sbjct: 479 QKGINDVSVSDRSLVWNTDLVETLEFDNLIAQAMVTMDSAANREESRGAHAREDFSD--- 535

Query: 561 GGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPKARVY 611
             R+D  W KH++ W  +  G   LDYR VHT  +   + Y  I PK RVY
Sbjct: 536 --RNDDEWMKHTIAW--YADGDTTLDYRQVHTWTMSNEISY--IEPKKRVY 580


>gi|148554231|ref|YP_001261813.1| succinate dehydrogenase flavoprotein subunit [Sphingomonas
           wittichii RW1]
 gi|148499421|gb|ABQ67675.1| succinate dehydrogenase subunit A [Sphingomonas wittichii RW1]
          Length = 595

 Score =  816 bits (2107), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/605 (65%), Positives = 467/605 (77%), Gaps = 10/605 (1%)

Query: 7   LKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAAS 66
           +  +Y  VDH YD VVVGAGG+GLRAT+G A  G KTACITKVFPTRSHTVAAQGGIAAS
Sbjct: 1   MSEAYKIVDHLYDAVVVGAGGSGLRATMGAAGAGLKTACITKVFPTRSHTVAAQGGIAAS 60

Query: 67  LANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQ 126
           L NM PD W WH+YDT+KGSDWLGD DAI+Y+  EAP +V ELEH GVPFSR E GKIYQ
Sbjct: 61  LGNMGPDHWTWHMYDTVKGSDWLGDQDAIEYMVREAPAAVIELEHAGVPFSRTEEGKIYQ 120

Query: 127 RPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEG 186
           RPFGGHMQN G GPPVQRTCAAADRTGHA+LH LY Q+LK +A+F+IEYFALDLI+  +G
Sbjct: 121 RPFGGHMQNMGAGPPVQRTCAAADRTGHAMLHALYQQSLKYDADFYIEYFALDLIME-DG 179

Query: 187 CCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQD 246
            C GV+A  +E G IHRF ++ VVLATGG GR YFSATSAHTCTGDG GMV RAGLPLQD
Sbjct: 180 ACKGVIALCMEDGSIHRFRSQAVVLATGGSGRTYFSATSAHTCTGDGGGMVLRAGLPLQD 239

Query: 247 MEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMM 306
           MEFVQFHPTGIYGAG LITEGARGEGGYL NS+GERFMERYAPSAKDLASRDVVSR M M
Sbjct: 240 MEFVQFHPTGIYGAGVLITEGARGEGGYLTNSQGERFMERYAPSAKDLASRDVVSRSMAM 299

Query: 307 EIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYN 366
           E+REGRGVGK+ D+I+L+L+H+DP VL ERLPGI+E+ +IFAGVD+TR P+PV PTVHYN
Sbjct: 300 EMREGRGVGKNGDYIYLHLDHIDPKVLAERLPGITETGKIFAGVDLTRQPLPVTPTVHYN 359

Query: 367 MGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAV 426
           MGG+P NY GEV+     NP+   PGL A+GEA C SVHGANRLGSNSLIDLVVFGRA  
Sbjct: 360 MGGVPCNYHGEVVTLKDGNPDAVVPGLFAVGEAACVSVHGANRLGSNSLIDLVVFGRATG 419

Query: 427 IRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRT 486
            R +E++  +S    ++  + ++ + R D  R+A G  PTA +R  MQ  MQ    VFR 
Sbjct: 420 FRLAELVKPNSKHGGINKEADEKALGRLDHYRNAKGGTPTAQIRLDMQHTMQKHCAVFRD 479

Query: 487 QDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKES 546
            + L +G   +  ++  + D+ + DRSLI+N+DL+ETLEL N++  A+ T++SA  RKES
Sbjct: 480 SELLGEGQGKIDKVYTRLDDIGITDRSLIFNTDLIETLELDNMLPQAVVTMHSAANRKES 539

Query: 547 RGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAP 606
           RG+H  ED+ D     RDD NW KH++ W D   G++K+DYRPVH   L   V+Y  I P
Sbjct: 540 RGAHMHEDYPD-----RDDANWMKHTITWFD--KGEVKIDYRPVHDYTLTDDVEY--IKP 590

Query: 607 KARVY 611
           KARVY
Sbjct: 591 KARVY 595


>gi|296285022|ref|ZP_06863020.1| succinate dehydrogenase flavoprotein subunit [Citromicrobium
           bathyomarinum JL354]
          Length = 624

 Score =  815 bits (2105), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 413/614 (67%), Positives = 475/614 (77%), Gaps = 19/614 (3%)

Query: 10  SYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLAN 69
           +Y  +DH +DVVVVGAGG+GLRAT+G AE GFKTA I+KVFPTRSHTVAAQGGIAASL N
Sbjct: 18  AYPIIDHDFDVVVVGAGGSGLRATMGAAEAGFKTANISKVFPTRSHTVAAQGGIAASLGN 77

Query: 70  MTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRPF 129
            TPD W WH+YDT+KGSDWLGD DAI+YLA EAPQ+VYELEH GVPFSRN+ G IYQRPF
Sbjct: 78  NTPDHWTWHMYDTVKGSDWLGDQDAIEYLAREAPQAVYELEHAGVPFSRNKDGTIYQRPF 137

Query: 130 GGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGC-- 187
           GGHMQN GEGPPVQRTCAAADRTGHA+LH LY Q+LK +A+FFIEYFA+DLI+  EG   
Sbjct: 138 GGHMQNMGEGPPVQRTCAAADRTGHAMLHALYQQSLKYDADFFIEYFAIDLIMTGEGANR 197

Query: 188 -CVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQD 246
            CVGV+A  L+ G IHRF A  VVLATGGYGR Y++ATSAHTCTGDG GMV RAGLPLQD
Sbjct: 198 RCVGVIAMCLDDGTIHRFRAHAVVLATGGYGRCYYTATSAHTCTGDGGGMVLRAGLPLQD 257

Query: 247 MEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMM 306
           MEFVQFHPTGIYGAG LITEGARGEGGYL NS+GERFMERYAPSAKDLASRDVVSR M +
Sbjct: 258 MEFVQFHPTGIYGAGVLITEGARGEGGYLTNSEGERFMERYAPSAKDLASRDVVSRSMAL 317

Query: 307 EIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYN 366
           E+REGRGVGK  DHI+L+L+H+DP VL ERLPGI+ES +IFAGVD+TR+P+PV PTVHYN
Sbjct: 318 EMREGRGVGKDGDHIYLHLDHIDPKVLAERLPGITESGKIFAGVDLTREPLPVTPTVHYN 377

Query: 367 MGGIPTNYWGEVLDANSK-NPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAA 425
           MGGIPTNY GEV+      NP+   PGL A GEAGC SVHGANRLGSNSLIDLVVFGRA 
Sbjct: 378 MGGIPTNYHGEVVTIGPDGNPDHVVPGLYAAGEAGCVSVHGANRLGSNSLIDLVVFGRAI 437

Query: 426 VIRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFR 485
             R +E +   +   +L   S D  + R D  RHA G +PTA +RE MQ+ MQ  A VFR
Sbjct: 438 GHRLAETMKPGASHDALPADSADLALTRLDHFRHAKGSLPTARIREDMQKTMQKHAAVFR 497

Query: 486 TQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKE 545
             ++L+ G ++L+ +   M D+ V DRSLIWNSDL+ETLEL NLM  A  T+ SA+ RKE
Sbjct: 498 DTETLAAGKKHLAEVNASMQDIHVSDRSLIWNSDLIETLELDNLMAQASVTMTSADNRKE 557

Query: 546 SRGSHAREDFKDGEFGGRDDVNWRKHSLCWVD--------WNTGKIKLDYRPVHTELLCG 597
           SRG+HA EDF D     R+D  W KH++ W D           G +K+DYRPVH   L  
Sbjct: 558 SRGAHAHEDFPD-----RNDAEWMKHTVTWFDGWGGGAKGSGKGDMKIDYRPVHEYTLTD 612

Query: 598 GVDYSKIAPKARVY 611
            ++Y  I PK RVY
Sbjct: 613 DIEY--IKPKKRVY 624


>gi|27375625|ref|NP_767154.1| succinate dehydrogenase flavoprotein subunit [Bradyrhizobium
           japonicum USDA 110]
 gi|3169724|gb|AAC17942.1| succinate dehydrogenase flavoprotein subunit [Bradyrhizobium
           japonicum]
 gi|27348762|dbj|BAC45779.1| succinate dehydrogenase flavoprotein subunit [Bradyrhizobium
           japonicum USDA 110]
          Length = 611

 Score =  812 bits (2098), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/602 (66%), Positives = 476/602 (79%), Gaps = 9/602 (1%)

Query: 10  SYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLAN 69
           +Y   DH+YDVVVVGAGGAGLRA +G +E G +TACITKVFPTRSHTVAAQGGI+ASL N
Sbjct: 19  AYPIEDHTYDVVVVGAGGAGLRAVVGCSEAGLRTACITKVFPTRSHTVAAQGGISASLGN 78

Query: 70  MTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRPF 129
           M  D W+WH+YDT+KGSDWLGD DAI+Y+   AP +VYELEH+GVPFSR E GKIYQRPF
Sbjct: 79  MHKDDWRWHMYDTVKGSDWLGDQDAIEYMVRNAPDAVYELEHWGVPFSRTEDGKIYQRPF 138

Query: 130 GGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCCV 189
           GG   ++G+G   QRTCAAADRTGHA+LHT+YGQ+L++ AEFFIE+FA+DLI++ +G C 
Sbjct: 139 GGMTLDFGKGQ-AQRTCAAADRTGHAMLHTMYGQSLRHAAEFFIEFFAIDLIMDDQGTCR 197

Query: 190 GVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDMEF 249
           GV+A +L+ G +HRF A+ V+LATGGYGRAY S TSAHTCTGDG GMV RAGLP+QDMEF
Sbjct: 198 GVIALKLDDGTLHRFRAQTVILATGGYGRAYASCTSAHTCTGDGGGMVLRAGLPMQDMEF 257

Query: 250 VQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEIR 309
           VQFHPTGIYG+GCL+TEGARGEGGYLVNS+GERFMERYAPSAKDLASRDVVSR M +EIR
Sbjct: 258 VQFHPTGIYGSGCLVTEGARGEGGYLVNSEGERFMERYAPSAKDLASRDVVSRAMTIEIR 317

Query: 310 EGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMGG 369
           EGRGVGK KDHI L+L+HLDPAVL ERLPGISESA+IFA VDVTR+PIP++PTVHYNMGG
Sbjct: 318 EGRGVGKKKDHIFLHLDHLDPAVLAERLPGISESAKIFANVDVTREPIPIVPTVHYNMGG 377

Query: 370 IPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIRA 429
           IPTNY GEVL     +     PGLMAIGEA C SVHGANRLGSNSLIDLVVFGRAA +R 
Sbjct: 378 IPTNYHGEVLTKKDGDDNAVIPGLMAIGEAACVSVHGANRLGSNSLIDLVVFGRAAALRL 437

Query: 430 SEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQDS 489
           +E +  ++  P L  +S +  + R D  R+A G  PTA LRE MQ  MQ +  VFRT + 
Sbjct: 438 AEKLTPNAKQPELPANSAELALGRLDHYRYASGGTPTAKLREGMQHVMQSNCAVFRTGEV 497

Query: 490 LSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRGS 549
           LS+G   +  +   + D+ V DRSL+WNSDLVETLE  NL+  A+ T+ SA  R ESRG+
Sbjct: 498 LSEGQNLIEKVHSGITDIAVSDRSLVWNSDLVETLEFDNLIAQAVVTMNSAANRTESRGA 557

Query: 550 HAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPKAR 609
           HAREDF +     RDD NW KH+L W+D + GK+K++YRPVH   +   V Y  I PKAR
Sbjct: 558 HAREDFSE-----RDDKNWMKHTLAWLD-DAGKVKIEYRPVHDYTMTNDVQY--IPPKAR 609

Query: 610 VY 611
           VY
Sbjct: 610 VY 611


>gi|294011059|ref|YP_003544519.1| succinate dehydrogenase/fumarate reductase flavoprotein subunit
           [Sphingobium japonicum UT26S]
 gi|292674389|dbj|BAI95907.1| succinate dehydrogenase/fumarate reductase flavoprotein subunit
           [Sphingobium japonicum UT26S]
          Length = 604

 Score =  812 bits (2097), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/611 (65%), Positives = 467/611 (76%), Gaps = 13/611 (2%)

Query: 7   LKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAAS 66
           +  +Y  +DH+YD VVVGAGG+GLRAT+G AE G KTACITK+FPTRSHTVAAQGGIAAS
Sbjct: 1   MSEAYKIIDHTYDTVVVGAGGSGLRATMGSAEAGLKTACITKLFPTRSHTVAAQGGIAAS 60

Query: 67  LANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQ 126
           L N +PD W WH+YDT+KGSDWLGD DAI+Y+  EAP +V ELEH GVPFSRN+ G IYQ
Sbjct: 61  LGNNSPDHWTWHMYDTVKGSDWLGDQDAIEYMVREAPAAVIELEHAGVPFSRNDNGTIYQ 120

Query: 127 RPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIIN--- 183
           RPFGGHMQN G GPPVQRTCAAADRTGHA+LH LY Q+LK +A+F+IEYFA+DLI+    
Sbjct: 121 RPFGGHMQNMGAGPPVQRTCAAADRTGHAMLHALYQQSLKYDADFYIEYFAIDLIMEDGP 180

Query: 184 SEGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLP 243
           +   C GV+A  +E G IHRF +  VVLATGGYGRAYFSATSAH+CTGDG GMV RAGLP
Sbjct: 181 NGKECRGVIAICMEDGSIHRFRSHAVVLATGGYGRAYFSATSAHSCTGDGGGMVLRAGLP 240

Query: 244 LQDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRC 303
           LQD+EFVQFHPTGIYGAG LITEGARGEGGYL NS+GERFMERYAPSAKDLASRDVVSR 
Sbjct: 241 LQDLEFVQFHPTGIYGAGVLITEGARGEGGYLTNSEGERFMERYAPSAKDLASRDVVSRS 300

Query: 304 MMMEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTV 363
           M ME+REGRGVG +KDHI+L+L+H+DP VL ERLPGI+ES +IFAGVD+TR P+PV PTV
Sbjct: 301 MAMEMREGRGVGPNKDHIYLHLDHIDPKVLAERLPGITESGKIFAGVDLTRQPLPVTPTV 360

Query: 364 HYNMGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGR 423
           HYNMGGIP NY G+V+     +PE   PGL A+GEA C SVHGANRLGSNSLIDLVVFGR
Sbjct: 361 HYNMGGIPCNYHGQVVTKVGDDPEVVVPGLYAVGEAACVSVHGANRLGSNSLIDLVVFGR 420

Query: 424 AAVIRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGV 483
           A  +   E +  ++    L   + D  + R D  R+A G  PTA +R +MQ  MQ  A V
Sbjct: 421 ATGLHLKETLKPNASHRPLPKDAADLALGRLDHYRNAKGGSPTAKIRLEMQHTMQKHAAV 480

Query: 484 FRTQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEAR 543
           FR    L++G   ++ +   +AD+ V DRSLIWN+DL+ETLEL NLM  A+ T+ SAE R
Sbjct: 481 FRDSALLAEGVTKMAQVNQSLADVGVSDRSLIWNTDLIETLELDNLMSQAVCTMVSAENR 540

Query: 544 KESRGSHAREDFKDGEFGGRDDVNWRKHSLCWVD-W--NTGKIKLDYRPVHTELLCGGVD 600
           KESRG+HA EDF +     RDD  W KH++ W D W    GK+ LDYRPVH   L    +
Sbjct: 541 KESRGAHAHEDFPN-----RDDNEWMKHTVSWFDGWGGKGGKVTLDYRPVHDYTLTDEAE 595

Query: 601 YSKIAPKARVY 611
           Y  I PKARVY
Sbjct: 596 Y--IKPKARVY 604


>gi|146337399|ref|YP_001202447.1| succinate dehydrogenase flavoprotein subunit [Bradyrhizobium sp.
           ORS278]
 gi|146190205|emb|CAL74197.1| Succinate dehydrogenase flavoprotein subunit [Bradyrhizobium sp.
           ORS278]
          Length = 612

 Score =  811 bits (2096), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/602 (66%), Positives = 468/602 (77%), Gaps = 8/602 (1%)

Query: 10  SYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLAN 69
           +Y   DH+YDVVVVGAGGAGLRA +G +E G +TACITKVFPTRSHTVAAQGGI+ASL N
Sbjct: 19  AYPIEDHTYDVVVVGAGGAGLRAVVGCSEAGLRTACITKVFPTRSHTVAAQGGISASLGN 78

Query: 70  MTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRPF 129
           M  D W+WH+YDT+KGSDWLGD DAI+Y+   AP +VYELEH+GVPFSR E GKIYQRPF
Sbjct: 79  MHQDDWRWHMYDTVKGSDWLGDQDAIEYMVRNAPDAVYELEHWGVPFSRTEDGKIYQRPF 138

Query: 130 GGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCCV 189
           GG   +YG+G   QRTCAAADRTGHA+LHT+YGQ+L++ AEFFIE+FA+DLI++ +G C 
Sbjct: 139 GGMTMDYGKGQ-AQRTCAAADRTGHAMLHTMYGQSLRHAAEFFIEFFAIDLIMDDQGTCR 197

Query: 190 GVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDMEF 249
           GV+A +L+ G +HRF A+  +LATGGYGRAY S TSAHTCTGDG GM  RAGLPLQDMEF
Sbjct: 198 GVIAIKLDDGTLHRFRAQTTILATGGYGRAYASCTSAHTCTGDGGGMALRAGLPLQDMEF 257

Query: 250 VQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEIR 309
           VQFHPTGIYG+GCL+TEGARGEGGYLVNS+GERFMERYAPSAKDLASRDVVSR M +EIR
Sbjct: 258 VQFHPTGIYGSGCLVTEGARGEGGYLVNSEGERFMERYAPSAKDLASRDVVSRAMTIEIR 317

Query: 310 EGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMGG 369
           EGRGVGK KDHI L+L+HLDP VL ERLPGISESA+IFA VDVTR+PIP++PTVHYNMGG
Sbjct: 318 EGRGVGKKKDHIFLHLDHLDPKVLAERLPGISESAKIFANVDVTREPIPIVPTVHYNMGG 377

Query: 370 IPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIRA 429
           IPTNY  EVL     +     PGLMA+GEA C SVHGANRLGSNSLIDLVVFGRAA +R 
Sbjct: 378 IPTNYHAEVLTKKDGDDNAIVPGLMAVGEAACVSVHGANRLGSNSLIDLVVFGRAAALRL 437

Query: 430 SEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQDS 489
           +E +  +   P L   S D+ + R D  R+A G  PTA LRE MQ  MQ +  VFRT + 
Sbjct: 438 AEKLTPNGKQPDLPKDSADKALSRLDHYRYASGGTPTAKLRESMQHVMQTNCAVFRTGEV 497

Query: 490 LSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRGS 549
           L +G   +  ++  + D+ V DRSL+WNSDL+ETLE  NL+  A+ T+ SA  R ESRG+
Sbjct: 498 LQEGHNLIHKVYGGIGDIAVSDRSLVWNSDLIETLEFDNLIAQAVVTMDSAVNRTESRGA 557

Query: 550 HAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPKAR 609
           HAREDF D     RDD NW KH+L W+D   GK  +DYRPVH   +   V Y  I PKAR
Sbjct: 558 HAREDFPD-----RDDKNWMKHTLAWIDNKDGKTTIDYRPVHNYTMTNDVQY--IPPKAR 610

Query: 610 VY 611
           VY
Sbjct: 611 VY 612


>gi|307295107|ref|ZP_07574949.1| succinate dehydrogenase, flavoprotein subunit [Sphingobium
           chlorophenolicum L-1]
 gi|306879581|gb|EFN10799.1| succinate dehydrogenase, flavoprotein subunit [Sphingobium
           chlorophenolicum L-1]
          Length = 609

 Score =  811 bits (2095), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/616 (64%), Positives = 466/616 (75%), Gaps = 18/616 (2%)

Query: 7   LKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAAS 66
           +  +Y  +DH+YD VVVGAGG+GLRAT+G AE G KTACITK+FPTRSHTVAAQGGIAAS
Sbjct: 1   MSEAYKIIDHTYDTVVVGAGGSGLRATMGSAEAGLKTACITKLFPTRSHTVAAQGGIAAS 60

Query: 67  LANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQ 126
           L N +PD W WH+YDT+KGSDWLGD DAI+Y+  EAP +V ELEH GVPFSRN+ G IYQ
Sbjct: 61  LGNNSPDHWTWHMYDTVKGSDWLGDQDAIEYMVREAPAAVIELEHAGVPFSRNDNGTIYQ 120

Query: 127 RPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIIN--- 183
           RPFGGHMQN G GPPVQRTCAAADRTGHA+LH LY Q+LK +A+F+IEYFA+DLI+    
Sbjct: 121 RPFGGHMQNMGAGPPVQRTCAAADRTGHAMLHALYQQSLKYDADFYIEYFAIDLIMEDGP 180

Query: 184 SEGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLP 243
           +   C GV+A  +E G IHRF +K VVLATGGYGRAYFSATSAH+CTGDG GMV RAGLP
Sbjct: 181 NGKECRGVIAICMEDGSIHRFRSKAVVLATGGYGRAYFSATSAHSCTGDGGGMVLRAGLP 240

Query: 244 LQDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRC 303
           LQD+EFVQFHPTGIYGAG LITEGARGEGGYL NS+GERFMERYAPSAKDLASRDVVSR 
Sbjct: 241 LQDLEFVQFHPTGIYGAGVLITEGARGEGGYLTNSEGERFMERYAPSAKDLASRDVVSRS 300

Query: 304 MMMEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTV 363
           M ME+REGRGVG +KDHI+L+L+H+DP VL ERLPGI+ES +IFAGVD+TR P+PV PTV
Sbjct: 301 MAMEMREGRGVGPNKDHIYLHLDHIDPKVLAERLPGITESGKIFAGVDLTRQPLPVTPTV 360

Query: 364 HYNMGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGR 423
           HYNMGGIP NY G+V+     +PE   PGL A+GEA C SVHGANRLGSNSLIDLVVFGR
Sbjct: 361 HYNMGGIPCNYHGQVVTKVGDDPEVVVPGLYAVGEAACVSVHGANRLGSNSLIDLVVFGR 420

Query: 424 AAVIRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGV 483
           A  +   E I  +     L   + D  + R D  R+A G  PTA +R +MQ  MQ  A V
Sbjct: 421 ATGLHLKETIKPNGSHRPLPADAADLALSRLDHYRNAKGGSPTAKIRLEMQHTMQKHAAV 480

Query: 484 FRTQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEAR 543
           FR    L++G   ++ +   +AD+ V DRSLIWN+DL+ETLEL NLM  A+ T+ SAE R
Sbjct: 481 FRDSALLAEGVTKMAQVNQSLADVGVSDRSLIWNTDLIETLELDNLMSQAVCTMVSAENR 540

Query: 544 KESRGSHAREDFKDGEFGGRDDVNWRKHSLCWVD--------WNTGKIKLDYRPVHTELL 595
           KESRG+HA EDF +     RDD  W KH++ W +           GK+ LDYRPVH   L
Sbjct: 541 KESRGAHAHEDFPN-----RDDAEWMKHTVSWFEGWGGGAQGSGGGKVTLDYRPVHDYTL 595

Query: 596 CGGVDYSKIAPKARVY 611
               +Y  I PKARVY
Sbjct: 596 TDEAEY--IKPKARVY 609


>gi|115522540|ref|YP_779451.1| succinate dehydrogenase flavoprotein subunit [Rhodopseudomonas
           palustris BisA53]
 gi|115516487|gb|ABJ04471.1| succinate dehydrogenase subunit A [Rhodopseudomonas palustris
           BisA53]
          Length = 607

 Score =  810 bits (2091), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/602 (66%), Positives = 471/602 (78%), Gaps = 9/602 (1%)

Query: 10  SYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLAN 69
           +Y   DH+YDVVVVGAGGAGLRA +G +E G  TACITKVFPTRSHTVAAQGGI+A+L N
Sbjct: 15  AYPIEDHTYDVVVVGAGGAGLRAVVGCSEAGLHTACITKVFPTRSHTVAAQGGISAALGN 74

Query: 70  MTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRPF 129
           M  D W+WH+YDT+KGSDWLGD D+I+Y+   APQ+VYELEH+GVPFSR E GKIYQRPF
Sbjct: 75  MHKDDWRWHMYDTVKGSDWLGDQDSIEYMVRNAPQAVYELEHWGVPFSRTEDGKIYQRPF 134

Query: 130 GGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCCV 189
           GG    +G+G   QRTCAAADRTGHA+LHT+YGQAL++NAEF+IE+FA+DLI++ +G C 
Sbjct: 135 GGMTMEFGKGQ-AQRTCAAADRTGHAMLHTMYGQALRHNAEFYIEFFAIDLIMDDQGVCR 193

Query: 190 GVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDMEF 249
           GV+A +L+ G +HRF A+  +LATGGYGRAY S TSAHTCTGDG  M  RAGLPLQDMEF
Sbjct: 194 GVIALKLDDGTLHRFKAQTTILATGGYGRAYASCTSAHTCTGDGGAMALRAGLPLQDMEF 253

Query: 250 VQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEIR 309
           VQFHPTGIYG+GCL+TEGARGEGGYLVNS+GERFMERYAPSAKDLASRDVVSR M +EIR
Sbjct: 254 VQFHPTGIYGSGCLVTEGARGEGGYLVNSEGERFMERYAPSAKDLASRDVVSRAMTIEIR 313

Query: 310 EGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMGG 369
           EGRGVGK KDHI L+L+HLDPAVL ERLPGISESARIFAGVDVTR+PIP+IPTVHYNMGG
Sbjct: 314 EGRGVGKKKDHIFLHLDHLDPAVLHERLPGISESARIFAGVDVTREPIPMIPTVHYNMGG 373

Query: 370 IPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIRA 429
           IPTNY GEV+     +     PGLMA+GEA C SVHGANRLGSNSLIDLVVFGRAA +R 
Sbjct: 374 IPTNYHGEVVTKKEGDDNAVVPGLMALGEAACVSVHGANRLGSNSLIDLVVFGRAAALRC 433

Query: 430 SEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQDS 489
           +E +      P L   S D+ + R D  R+A G  PTA LR++MQ  MQ +  VFRT D 
Sbjct: 434 AEKLTPHGKQPELPADSADKALARLDHFRYASGGTPTAKLRDRMQHVMQNNCAVFRTGDV 493

Query: 490 LSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRGS 549
           L +G   +  +   +AD+ V DRSLIWNSDLVETLE  NL++ A+ T+ SA  R ESRG+
Sbjct: 494 LQEGKGLIHEVHHGIADVGVTDRSLIWNSDLVETLEFDNLIVQAVVTMESAANRTESRGA 553

Query: 550 HAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPKAR 609
           HAREDF D     RDD NW KH+L W+D ++    +DYRPVH   +   V Y  I PKAR
Sbjct: 554 HAREDFAD-----RDDKNWMKHTLAWIDHDS-TTTIDYRPVHDYTMTNDVQY--IPPKAR 605

Query: 610 VY 611
           VY
Sbjct: 606 VY 607


>gi|71275601|ref|ZP_00651886.1| Succinate dehydrogenase or fumarate reductase, flavoprotein
           subunit:Succinate dehydrogenase, flavoprotein subunit
           [Xylella fastidiosa Dixon]
 gi|71899498|ref|ZP_00681655.1| Succinate dehydrogenase or fumarate reductase, flavoprotein
           subunit:Succinate dehydrogenase, flavoprotein subunit
           [Xylella fastidiosa Ann-1]
 gi|170729591|ref|YP_001775024.1| succinate dehydrogenase flavoprotein subunit [Xylella fastidiosa
           M12]
 gi|71163492|gb|EAO13209.1| Succinate dehydrogenase or fumarate reductase, flavoprotein
           subunit:Succinate dehydrogenase, flavoprotein subunit
           [Xylella fastidiosa Dixon]
 gi|71730718|gb|EAO32792.1| Succinate dehydrogenase or fumarate reductase, flavoprotein
           subunit:Succinate dehydrogenase, flavoprotein subunit
           [Xylella fastidiosa Ann-1]
 gi|167964384|gb|ACA11394.1| Succinate dehydrogenase [Xylella fastidiosa M12]
          Length = 596

 Score =  810 bits (2091), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/603 (66%), Positives = 465/603 (77%), Gaps = 8/603 (1%)

Query: 9   SSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLA 68
           S+YT  +H YD+VVVGAGGAGLRAT G+A+KG +T C+TKVFPTRSHTVAAQGGI+A+L 
Sbjct: 2   SAYTITEHKYDMVVVGAGGAGLRATFGLAQKGLQTVCLTKVFPTRSHTVAAQGGISAALG 61

Query: 69  NMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRP 128
           NM  D W++H YDTIKGSDWLGD DAI+Y+  EA  +V ELEHYGVPFSR   GKIYQRP
Sbjct: 62  NMGEDDWRYHFYDTIKGSDWLGDQDAIEYMCREAIPAVIELEHYGVPFSRTAQGKIYQRP 121

Query: 129 FGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCC 188
           FGG    YGEGP  +RTCAAADRTGHA+LHTLY QAL ++A F IEYFALDLI ++EG C
Sbjct: 122 FGGMTTRYGEGPRAERTCAAADRTGHAMLHTLYQQALAHDARFMIEYFALDLIFDNEGVC 181

Query: 189 VGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDME 248
            GV+A  +  G +H F A  VVLATGGYGR YFSATSAHTCTGDG G+V RAGLP+QDME
Sbjct: 182 RGVLALDMAEGSLHLFRAHGVVLATGGYGRTYFSATSAHTCTGDGGGLVMRAGLPMQDME 241

Query: 249 FVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEI 308
           FVQFHPTGIYGAGCLITEG RGEGG L NS GERFMERYAP  KDLASRDVVSR M++EI
Sbjct: 242 FVQFHPTGIYGAGCLITEGVRGEGGILRNSNGERFMERYAPHYKDLASRDVVSRSMIIEI 301

Query: 309 REGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMG 368
           REGRGVG+ KDHI L L HL P+++QE+LPGI+ESARIFAGVDV + PIPV+PTVHYNMG
Sbjct: 302 REGRGVGEHKDHILLDLTHLGPSMIQEKLPGIAESARIFAGVDVAKQPIPVLPTVHYNMG 361

Query: 369 GIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIR 428
           GIPTNY GEV+     +P+   PGL A+GEA C SVHGANRLGSNSL+DLVVFGRA   R
Sbjct: 362 GIPTNYHGEVVRKVGNDPDAVVPGLYAVGEAACVSVHGANRLGSNSLLDLVVFGRAVANR 421

Query: 429 ASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQD 488
            +E I +S P   L   SCD+ +   D+LRHADG  PTA +R++MQR MQ DA VFRT  
Sbjct: 422 CAETIKQSQPHKVLPSDSCDKALGLLDKLRHADGSTPTAVIRDRMQRTMQSDASVFRTSK 481

Query: 489 SLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRG 548
           +L +GC  ++ ++    D+KV DRSL+WNSDL+ET EL NL++NA+AT+ SAE RKESRG
Sbjct: 482 TLQEGCEKMNEIFALFDDIKVSDRSLVWNSDLIETYELHNLLLNALATINSAEQRKESRG 541

Query: 549 SHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPKA 608
           +HA ED+ D     RDD NW KH+L  VD   G    DYRPVH   L   VD   I PK 
Sbjct: 542 AHAHEDYPD-----RDDENWLKHTLVSVD-EKGTCSFDYRPVHMYTLSKDVDV--IPPKP 593

Query: 609 RVY 611
           RVY
Sbjct: 594 RVY 596


>gi|28198269|ref|NP_778583.1| succinate dehydrogenase flavoprotein subunit [Xylella fastidiosa
           Temecula1]
 gi|182680906|ref|YP_001829066.1| succinate dehydrogenase flavoprotein subunit [Xylella fastidiosa
           M23]
 gi|28056339|gb|AAO28232.1| succinate dehydrogenase flavoprotein subunit [Xylella fastidiosa
           Temecula1]
 gi|182631016|gb|ACB91792.1| succinate dehydrogenase, flavoprotein subunit [Xylella fastidiosa
           M23]
 gi|307579374|gb|ADN63343.1| succinate dehydrogenase flavoprotein subunit [Xylella fastidiosa
           subsp. fastidiosa GB514]
          Length = 596

 Score =  809 bits (2090), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/603 (66%), Positives = 463/603 (76%), Gaps = 8/603 (1%)

Query: 9   SSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLA 68
           S+YT  +H YD+VVVGAGGAGLRAT G+A KG +T C+TKVFPTRSHTVAAQGGI+A+L 
Sbjct: 2   SAYTITEHKYDMVVVGAGGAGLRATFGLAHKGLQTVCLTKVFPTRSHTVAAQGGISAALG 61

Query: 69  NMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRP 128
           NM  D W++H YDTIKGSDWLGD DAI+Y+  EA  +V ELEHYGVPFSR   GKIYQRP
Sbjct: 62  NMGEDDWRYHFYDTIKGSDWLGDQDAIEYMCREAIPAVIELEHYGVPFSRTAQGKIYQRP 121

Query: 129 FGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCC 188
           FGG    YGEGP  +RTCAAADRTGHA+LHTLY QAL ++A F IEYFALDLI +SEG C
Sbjct: 122 FGGMTTRYGEGPRAERTCAAADRTGHAMLHTLYQQALAHDARFMIEYFALDLIFDSEGLC 181

Query: 189 VGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDME 248
            GV+A  +  G +H F A  VVLATGGYGR YFSATSAHTCTGDG G+V RAGLP+QDME
Sbjct: 182 RGVLALDMAEGSLHLFRAHGVVLATGGYGRTYFSATSAHTCTGDGGGLVMRAGLPMQDME 241

Query: 249 FVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEI 308
           FVQFHPTGIYGAGCLITEG RGEGG L NS GERFMERYAP  KDLASRDVVSR M++EI
Sbjct: 242 FVQFHPTGIYGAGCLITEGVRGEGGILRNSNGERFMERYAPHYKDLASRDVVSRSMIIEI 301

Query: 309 REGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMG 368
           REGRGVG+ KDHI L L HL P+++QE+LPGI+ESARIFAGVDVT+ PIPV+PTVHYNMG
Sbjct: 302 REGRGVGEHKDHILLDLTHLGPSMIQEKLPGIAESARIFAGVDVTKQPIPVLPTVHYNMG 361

Query: 369 GIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIR 428
           GIPTNY GEV+     +P+   PGL A+GEA C SVHGANRLGSNSL+DLVVFGRA   R
Sbjct: 362 GIPTNYHGEVVRKVGNDPDAVVPGLYAVGEAACVSVHGANRLGSNSLLDLVVFGRAVANR 421

Query: 429 ASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQD 488
            SE I  + P   L   SCD+ +   D+LRHADG  PTA +R+ MQR MQ DA VFRT  
Sbjct: 422 CSETIKPNQPHKVLPSDSCDKALGLLDKLRHADGSTPTAVIRDTMQRTMQSDASVFRTSK 481

Query: 489 SLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRG 548
           +L +GC  ++ ++    D+KV DRSL+WNSDL+ET EL NL++NA+AT+ SAE RKESRG
Sbjct: 482 TLQEGCEKMNEIFALFDDVKVSDRSLVWNSDLIETYELHNLLLNALATINSAEQRKESRG 541

Query: 549 SHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPKA 608
           +HA ED+ D     RDD NW KH+L  VD   G    DYRPVH   L   VD   I PK 
Sbjct: 542 AHAHEDYPD-----RDDENWLKHTLVSVD-EKGSCSFDYRPVHMYTLSKDVDV--IPPKP 593

Query: 609 RVY 611
           RVY
Sbjct: 594 RVY 596


>gi|168056666|ref|XP_001780340.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162668288|gb|EDQ54899.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 631

 Score =  809 bits (2090), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/603 (65%), Positives = 476/603 (78%), Gaps = 9/603 (1%)

Query: 9   SSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLA 68
            SY  VDH+YD +VVGAGGAGLRA +G++E GF TACITK+FPTRSHTVAAQGGI A+L 
Sbjct: 38  KSYPIVDHTYDAIVVGAGGAGLRAAIGLSETGFTTACITKLFPTRSHTVAAQGGINAALG 97

Query: 69  NMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRP 128
           NMT D W+WH+YDT+KGSDWLGD DAIQY+  EAP++V ELE+YG+PFSR E GKIYQR 
Sbjct: 98  NMTEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFSRTEDGKIYQRA 157

Query: 129 FGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCC 188
           FGG   N+G+G    R  AAADRTGHA+LHTLYGQA+K+N +FF+EYFALDLI++ +G C
Sbjct: 158 FGGQSLNFGKGGQAYRCAAAADRTGHAMLHTLYGQAMKHNTQFFVEYFALDLIMDEQGAC 217

Query: 189 VGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDME 248
            GV+A  +E G +HRF A   +LATGGYGRAYFSATSAHTCTGDG  M ARAG+PLQD+E
Sbjct: 218 RGVIALNMEDGTLHRFRAMNTILATGGYGRAYFSATSAHTCTGDGNAMAARAGIPLQDLE 277

Query: 249 FVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEI 308
           FVQFHPTGIYGAGCLITEG+RGEGG L NS+GERFMERYAP+AKDLASRDVVSR M MEI
Sbjct: 278 FVQFHPTGIYGAGCLITEGSRGEGGILRNSEGERFMERYAPTAKDLASRDVVSRSMTMEI 337

Query: 309 REGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMG 368
           REGRGVG  KDHI+L+LNHL P VL+ERLPGISE+A IFAGVDVT++PIPV+PTVHYNMG
Sbjct: 338 REGRGVGPEKDHIYLHLNHLPPEVLKERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMG 397

Query: 369 GIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIR 428
           GIPTNY GEVL     +P+   PGLMA GEA CASVHGANRLG+NSL+D+V+FGRA   R
Sbjct: 398 GIPTNYHGEVLTKKGDDPDCMIPGLMAAGEAACASVHGANRLGANSLLDIVIFGRACANR 457

Query: 429 ASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQD 488
            +EM       P L   + ++ +   D+LR+A+G +PTA +R KMQR MQ +A VFRTQ+
Sbjct: 458 VAEMFKPGQKQPELPKDAGEKTIAWLDKLRYANGDIPTANIRNKMQRVMQNNAAVFRTQE 517

Query: 489 SLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRG 548
           +L +GC+ +    D ++ +K +DRSL WN+DL+ET+EL+NL+INA  T++SAEARKESRG
Sbjct: 518 TLEEGCKLIDETVDSLSRVKTNDRSLTWNTDLIETIELENLLINASVTMHSAEARKESRG 577

Query: 549 SHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPKA 608
           +HAREDF       RDD  W KH+L +  W   +++LDYRPVH   L   V+     PKA
Sbjct: 578 AHAREDFTT-----RDDEKWMKHTLGY--WENDRVRLDYRPVHMNTLDDEVE--TFPPKA 628

Query: 609 RVY 611
           RVY
Sbjct: 629 RVY 631


>gi|15837674|ref|NP_298362.1| succinate dehydrogenase flavoprotein subunit [Xylella fastidiosa
           9a5c]
 gi|9106019|gb|AAF83882.1|AE003943_13 succinate dehydrogenase, flavoprotein subunit [Xylella fastidiosa
           9a5c]
          Length = 596

 Score =  809 bits (2089), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/603 (66%), Positives = 465/603 (77%), Gaps = 8/603 (1%)

Query: 9   SSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLA 68
           S+YT  +H YD+VVVGAGGAGLRAT G+A+KG +T C+TKVFPTRSHTVAAQGGI+A+L 
Sbjct: 2   SAYTITEHKYDMVVVGAGGAGLRATFGLAQKGLQTVCLTKVFPTRSHTVAAQGGISAALG 61

Query: 69  NMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRP 128
           NM  D W++H YDTIKGSDWLGD DAI+Y+  EA  +V ELEHYGVPFSR   GKIYQRP
Sbjct: 62  NMGEDDWRYHFYDTIKGSDWLGDQDAIEYMCREAIPAVIELEHYGVPFSRTAQGKIYQRP 121

Query: 129 FGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCC 188
           FGG    YGEGP  +RTCAAADRTGHA+LHTLY QAL ++A F IEYFALDLI ++EG C
Sbjct: 122 FGGMTTRYGEGPRAERTCAAADRTGHAMLHTLYQQALAHDARFMIEYFALDLIFDNEGVC 181

Query: 189 VGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDME 248
            GV+A  +  G +H F A  VVLATGGYGR YFSATSAHTCTGDG G+V RAGLP+QDME
Sbjct: 182 CGVLALDMAEGSLHLFRAHGVVLATGGYGRTYFSATSAHTCTGDGGGLVMRAGLPMQDME 241

Query: 249 FVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEI 308
           FVQFHPTGIYGAGCLITEG RGEGG L NS GERFMERYAP  KDLASRDVVSR M++EI
Sbjct: 242 FVQFHPTGIYGAGCLITEGVRGEGGILRNSNGERFMERYAPHYKDLASRDVVSRSMIIEI 301

Query: 309 REGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMG 368
           REGRGVG+ KDHI L L HL P+++QE+LPGI+ESARIFAGVDVT+ PIPV+PTVHYNMG
Sbjct: 302 REGRGVGEHKDHILLDLTHLGPSMIQEKLPGIAESARIFAGVDVTKQPIPVLPTVHYNMG 361

Query: 369 GIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIR 428
           GIPTNY GEV+     +P+   PGL A+GEA C SVHGANRLGSNSL+DLVVFGRA   R
Sbjct: 362 GIPTNYHGEVVRKIGNDPDAVVPGLYAVGEAACVSVHGANRLGSNSLLDLVVFGRAVANR 421

Query: 429 ASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQD 488
            +E I  + P   L   SCD+ +   D+LRHADG  PTA +R++MQR MQ DA VFRT  
Sbjct: 422 CAETIKPNQPHKVLPSDSCDKALGLLDKLRHADGSTPTAVIRDRMQRTMQSDASVFRTSK 481

Query: 489 SLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRG 548
           +L +GC  ++ ++    D+KV DRSL+WNSDL+ET EL NL++NA+AT+ SAE RKESRG
Sbjct: 482 TLQEGCEKMNEIFALFDDVKVSDRSLVWNSDLIETYELHNLLLNALATINSAEQRKESRG 541

Query: 549 SHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPKA 608
           +HA ED+ D     RDD NW KH+L  VD   G    DYRPVH   L   VD   I PK 
Sbjct: 542 AHAHEDYPD-----RDDENWLKHTLVSVD-EKGTCSFDYRPVHMYTLSKDVDV--IPPKP 593

Query: 609 RVY 611
           RVY
Sbjct: 594 RVY 596


>gi|71899420|ref|ZP_00681579.1| Succinate dehydrogenase or fumarate reductase, flavoprotein
           subunit:Succinate dehydrogenase, flavoprotein subunit
           [Xylella fastidiosa Ann-1]
 gi|71730829|gb|EAO32901.1| Succinate dehydrogenase or fumarate reductase, flavoprotein
           subunit:Succinate dehydrogenase, flavoprotein subunit
           [Xylella fastidiosa Ann-1]
          Length = 596

 Score =  808 bits (2088), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/603 (66%), Positives = 465/603 (77%), Gaps = 8/603 (1%)

Query: 9   SSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLA 68
           S+YT  +H YD+VVVGAGGAGLRAT G+A+KG +T C+TKVFPTRSHTVAAQGGI+A+L 
Sbjct: 2   SAYTITEHKYDMVVVGAGGAGLRATFGLAQKGLQTVCLTKVFPTRSHTVAAQGGISAALG 61

Query: 69  NMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRP 128
           NM  D W++H YDTIKGSDWLGD DAI+Y+  EA  +V ELEHYGVPFSR   GKIYQRP
Sbjct: 62  NMGEDDWRYHFYDTIKGSDWLGDQDAIEYMCREAIPAVIELEHYGVPFSRTAQGKIYQRP 121

Query: 129 FGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCC 188
           FGG    YGEGP  +RTCAAADRTGHA+LHTLY QAL ++A F IEYFALDLI ++EG C
Sbjct: 122 FGGMTTRYGEGPRAERTCAAADRTGHAMLHTLYQQALAHDARFMIEYFALDLIFDNEGLC 181

Query: 189 VGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDME 248
            GV+A  +  G +H F A  VVLATGGYGR YFSATSAHTCTGDG G+V RAGLP+QDME
Sbjct: 182 RGVLALDMAEGSLHLFRAHGVVLATGGYGRTYFSATSAHTCTGDGGGLVMRAGLPMQDME 241

Query: 249 FVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEI 308
           FVQFHPTGIYGAGCLITEG RGEGG L NS GERFMERYAP  KDLASRDVVSR M++EI
Sbjct: 242 FVQFHPTGIYGAGCLITEGVRGEGGILRNSNGERFMERYAPHYKDLASRDVVSRSMIIEI 301

Query: 309 REGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMG 368
           REGRGVG+ KDHI L L HL P+++QE+LPGI+ESARIFAGVDVT+ PIPV+PTVHYNMG
Sbjct: 302 REGRGVGEHKDHILLDLTHLGPSMIQEKLPGIAESARIFAGVDVTKQPIPVLPTVHYNMG 361

Query: 369 GIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIR 428
           GIPTNY GEV+     +P+   PGL A+GEA C SVHGANRLGSNSL+DLVVFGRA   R
Sbjct: 362 GIPTNYHGEVVRKVGNDPDAVVPGLYAVGEAACVSVHGANRLGSNSLLDLVVFGRAVANR 421

Query: 429 ASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQD 488
            +E I  + P   L   SCD+ +   D+LRHADG  PTA +R++MQR MQ DA VFRT  
Sbjct: 422 CAETIKPNQPHKVLPSDSCDKALGLLDKLRHADGSTPTAVIRDRMQRTMQSDASVFRTSK 481

Query: 489 SLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRG 548
           +L +GC  ++ ++    D+KV DRSL+WNSDL+ET EL NL++NA+AT+ SAE RKESRG
Sbjct: 482 TLQEGCEKMNEIFALFDDVKVSDRSLVWNSDLIETYELHNLLLNALATINSAEQRKESRG 541

Query: 549 SHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPKA 608
           +HA ED+ D     RDD NW KH+L  VD   G    DYRPVH   L   VD   I PK 
Sbjct: 542 AHAHEDYPD-----RDDENWLKHTLVSVD-EKGTCSFDYRPVHMYTLSKDVDV--IPPKP 593

Query: 609 RVY 611
           RVY
Sbjct: 594 RVY 596


>gi|39933294|ref|NP_945570.1| succinate dehydrogenase flavoprotein subunit [Rhodopseudomonas
           palustris CGA009]
 gi|39652919|emb|CAE25661.1| succinate dehydrogenase flavoprotein subunit [Rhodopseudomonas
           palustris CGA009]
          Length = 607

 Score =  808 bits (2087), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/603 (66%), Positives = 475/603 (78%), Gaps = 9/603 (1%)

Query: 9   SSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLA 68
           ++Y   DH+YDVVVVGAGGAGLRA +G +E G +TACITKVFPTRSHTVAAQGGI+ASL 
Sbjct: 14  NAYPIEDHTYDVVVVGAGGAGLRAVVGCSEAGLRTACITKVFPTRSHTVAAQGGISASLG 73

Query: 69  NMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRP 128
           NM  D W+WH+YDT+KGSDWLGD D+I+Y+   AP++VYELEH+GVPFSR E GKIYQRP
Sbjct: 74  NMHKDDWRWHMYDTVKGSDWLGDQDSIEYMVRNAPEAVYELEHWGVPFSRTEDGKIYQRP 133

Query: 129 FGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCC 188
           FGG   ++G+G   QRTCAAADRTGHA+LHT+YGQAL+++AEF+IE+FA+DLI++ +GCC
Sbjct: 134 FGGMTMDFGKGQ-AQRTCAAADRTGHAMLHTMYGQALRHSAEFYIEFFAIDLIMDDQGCC 192

Query: 189 VGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDME 248
            GVVA +L+ G IHRF A+  +LATGGYGRAY S TSAHTCTGDG  M  RAGLPLQDME
Sbjct: 193 RGVVALKLDDGTIHRFKAQTTILATGGYGRAYASCTSAHTCTGDGGAMALRAGLPLQDME 252

Query: 249 FVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEI 308
           FVQFHPTGIYG+GCL+TEGARGEGGYLVNS+GERFMERYAPSAKDLASRDVVSR M +E+
Sbjct: 253 FVQFHPTGIYGSGCLVTEGARGEGGYLVNSEGERFMERYAPSAKDLASRDVVSRAMTIEM 312

Query: 309 REGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMG 368
           REGRGVGK KDHI L+L+HL P VL ERLPGISESARIFAGVDVTR+PIP++PTVHYNMG
Sbjct: 313 REGRGVGKKKDHIFLHLDHLAPEVLHERLPGISESARIFAGVDVTREPIPILPTVHYNMG 372

Query: 369 GIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIR 428
           GIPTN+ GEV+     +     PGLMAIGEA C SVHGANRLGSNSLIDLVVFGRAA +R
Sbjct: 373 GIPTNFHGEVVTKKDGDDNAVVPGLMAIGEAACVSVHGANRLGSNSLIDLVVFGRAAALR 432

Query: 429 ASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQD 488
            +E +  +   P L  SS D  + R D+ R+A G  PTA LRE+MQ  MQ +  VFRT +
Sbjct: 433 CAEKLVPNGKQPELPASSADMSLSRLDKYRYAKGGTPTAKLRERMQHVMQNNCAVFRTGE 492

Query: 489 SLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRG 548
            L++G   ++ +   + D+ V DR+L+WNSDLVETLE  NL++ A+ T+ SA  R ESRG
Sbjct: 493 VLAEGKELIANVHGSVGDVGVSDRTLVWNSDLVETLEFDNLIVQAVVTMNSAANRTESRG 552

Query: 549 SHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPKA 608
           +HAREDF D     RDD NW KH+L W+  + G + +DYRPVH   +   V Y  I PK 
Sbjct: 553 AHAREDFPD-----RDDANWMKHTLAWIG-DKGDVTIDYRPVHDYTMTNDVQY--IPPKP 604

Query: 609 RVY 611
           RVY
Sbjct: 605 RVY 607


>gi|115470493|ref|NP_001058845.1| Os07g0134800 [Oryza sativa Japonica Group]
 gi|75135397|sp|Q6ZDY8|DHSA_ORYSJ RecName: Full=Succinate dehydrogenase [ubiquinone] flavoprotein
           subunit, mitochondrial; AltName: Full=Flavoprotein
           subunit of complex II; Short=FP; Flags: Precursor
 gi|34394418|dbj|BAC83515.1| putative succinate dehydrogenase flavoprotein alpha subunit [Oryza
           sativa Japonica Group]
 gi|113610381|dbj|BAF20759.1| Os07g0134800 [Oryza sativa Japonica Group]
 gi|215686878|dbj|BAG89728.1| unnamed protein product [Oryza sativa Japonica Group]
 gi|218199047|gb|EEC81474.1| hypothetical protein OsI_24801 [Oryza sativa Indica Group]
          Length = 630

 Score =  808 bits (2087), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/607 (66%), Positives = 479/607 (78%), Gaps = 9/607 (1%)

Query: 5   SNLKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIA 64
           S   SSYT VDHSYD VVVGAGGAGLRA +G++E GF TACITK+FPTRSHTVAAQGGI 
Sbjct: 33  STASSSYTVVDHSYDAVVVGAGGAGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGIN 92

Query: 65  ASLANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKI 124
           A+L NMT D W+WH+YDT+KGSDWLGD D+IQY+  EAP++V ELE+YG+PFSR E GKI
Sbjct: 93  AALGNMTEDDWRWHMYDTVKGSDWLGDQDSIQYMCREAPKAVIELENYGLPFSRTEDGKI 152

Query: 125 YQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINS 184
           YQR FGG   ++G+G    R   AADRTGHA+LHTLYGQA+K+N +FF+EYFALDLI++S
Sbjct: 153 YQRAFGGQSLDFGKGGQAYRCACAADRTGHAMLHTLYGQAMKHNTQFFVEYFALDLIMDS 212

Query: 185 EGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPL 244
           EG C GV+A  +E G +HRF A   +LATGGYGRAYFSATSAHTCTGDG  MVARAGLPL
Sbjct: 213 EGTCQGVIALNMEDGTLHRFRATNTILATGGYGRAYFSATSAHTCTGDGNAMVARAGLPL 272

Query: 245 QDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCM 304
           QD+EFVQFHPTGIYGAGCLITEG+RGEGG L NS+GERFMERYAP+AKDLASRDVVSR M
Sbjct: 273 QDLEFVQFHPTGIYGAGCLITEGSRGEGGILRNSEGERFMERYAPTAKDLASRDVVSRSM 332

Query: 305 MMEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVH 364
            MEIREGRGVG  KDHI+L+LNHL P VL+ERLPGISE+A IFAGVDVT++PIPV+PTVH
Sbjct: 333 TMEIREGRGVGPLKDHIYLHLNHLPPEVLKERLPGISETAAIFAGVDVTKEPIPVLPTVH 392

Query: 365 YNMGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRA 424
           YNMGGIPTNY GEV+     NP+   PGLMA GEA CASVHGANRLG+NSL+D+VVFGRA
Sbjct: 393 YNMGGIPTNYHGEVVTMKGDNPDSVVPGLMAAGEAACASVHGANRLGANSLLDIVVFGRA 452

Query: 425 AVIRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVF 484
              R +E          L  S+ ++ +   D+LR+A+G +PT+ +R  MQR MQ +A VF
Sbjct: 453 CANRVAETAKPGEKQKPLQKSAGEKTIAWLDKLRNANGSLPTSKIRLNMQRVMQNNAAVF 512

Query: 485 RTQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARK 544
           RTQ++L +GC+ ++  W+   D+K+ DRSLIWNSDL+ET+EL+NL+INA  T++SAEARK
Sbjct: 513 RTQETLEEGCKLITKAWESYHDVKISDRSLIWNSDLIETIELENLLINACITMHSAEARK 572

Query: 545 ESRGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKI 604
           ESRG+HAREDF       RDD  W KHSL +  W   K++L YRPVH   L   V+    
Sbjct: 573 ESRGAHAREDFTK-----RDDEQWMKHSLGY--WENEKVRLAYRPVHMNTLDSEVE--SF 623

Query: 605 APKARVY 611
            PKARVY
Sbjct: 624 PPKARVY 630


>gi|192288647|ref|YP_001989252.1| succinate dehydrogenase flavoprotein subunit [Rhodopseudomonas
           palustris TIE-1]
 gi|192282396|gb|ACE98776.1| succinate dehydrogenase, flavoprotein subunit [Rhodopseudomonas
           palustris TIE-1]
          Length = 607

 Score =  807 bits (2085), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/602 (66%), Positives = 474/602 (78%), Gaps = 9/602 (1%)

Query: 10  SYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLAN 69
           +Y   DH+YDVVVVGAGGAGLRA +G +E G +TACITKVFPTRSHTVAAQGGI+ASL N
Sbjct: 15  AYPIEDHTYDVVVVGAGGAGLRAVVGCSEAGLRTACITKVFPTRSHTVAAQGGISASLGN 74

Query: 70  MTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRPF 129
           M  D W+WH+YDT+KGSDWLGD D+I+Y+   AP++VYELEH+GVPFSR E GKIYQRPF
Sbjct: 75  MHKDDWRWHMYDTVKGSDWLGDQDSIEYMVRNAPEAVYELEHWGVPFSRTEDGKIYQRPF 134

Query: 130 GGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCCV 189
           GG   ++G+G   QRTCAAADRTGHA+LHT+YGQAL+++AEF+IE+FA+DLI++ +GCC 
Sbjct: 135 GGMTMDFGKGQ-AQRTCAAADRTGHAMLHTMYGQALRHSAEFYIEFFAIDLIMDDQGCCR 193

Query: 190 GVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDMEF 249
           GVVA +L+ G IHRF A+  +LATGGYGRAY S TSAHTCTGDG  M  RAGLPLQDMEF
Sbjct: 194 GVVALKLDDGTIHRFKAQTTILATGGYGRAYASCTSAHTCTGDGGAMALRAGLPLQDMEF 253

Query: 250 VQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEIR 309
           VQFHPTGIYG+GCL+TEGARGEGGYLVNS+GERFMERYAPSAKDLASRDVVSR M +E+R
Sbjct: 254 VQFHPTGIYGSGCLVTEGARGEGGYLVNSEGERFMERYAPSAKDLASRDVVSRAMTIEMR 313

Query: 310 EGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMGG 369
           EGRGVGK KDHI L+L+HL P VL ERLPGISESARIFAGVDVTR+PIP++PTVHYNMGG
Sbjct: 314 EGRGVGKKKDHIFLHLDHLAPEVLHERLPGISESARIFAGVDVTREPIPILPTVHYNMGG 373

Query: 370 IPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIRA 429
           IPTN+ GEV+     +     PGLMAIGEA C SVHGANRLGSNSLIDLVVFGRAA +R 
Sbjct: 374 IPTNFHGEVVTKKDGDDNAVVPGLMAIGEAACVSVHGANRLGSNSLIDLVVFGRAAALRC 433

Query: 430 SEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQDS 489
           +E +  +   P L  SS D  + R D+ R+A G  PTA LRE+MQ  MQ +  VFRT + 
Sbjct: 434 AEKLVPNGKQPELPASSADMSLSRLDKYRYAKGGTPTAKLRERMQHVMQNNCAVFRTGEV 493

Query: 490 LSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRGS 549
           L++G   ++ +   + D+ V DR+L+WNSDLVETLE  NL++ A+ T+ SA  R ESRG+
Sbjct: 494 LAEGKELIANVHGSVGDVGVSDRTLVWNSDLVETLEFDNLIVQAVVTMNSAANRTESRGA 553

Query: 550 HAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPKAR 609
           HAREDF D     RDD NW KH+L W+  + G + +DYRPVH   +   V Y  I PK R
Sbjct: 554 HAREDFPD-----RDDANWMKHTLAWIG-DKGDVTIDYRPVHDYTMTNDVQY--IPPKPR 605

Query: 610 VY 611
           VY
Sbjct: 606 VY 607


>gi|51473328|ref|YP_067085.1| succinate dehydrogenase flavoprotein subunit [Rickettsia typhi str.
           Wilmington]
 gi|81826335|sp|Q68XN9|DHSA_RICTY RecName: Full=Succinate dehydrogenase flavoprotein subunit
 gi|51459640|gb|AAU03603.1| Fumarate dehydrogenase [Rickettsia typhi str. Wilmington]
          Length = 596

 Score =  807 bits (2084), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/605 (65%), Positives = 478/605 (79%), Gaps = 9/605 (1%)

Query: 7   LKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAAS 66
           +  +Y  + H +DVVVVGAGGAGLR+  GMA++G  TACITK+FPTRSHTVAAQGGI+A+
Sbjct: 1   MTKAYNIIHHKFDVVVVGAGGAGLRSAFGMAKEGLNTACITKIFPTRSHTVAAQGGISAA 60

Query: 67  LANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQ 126
           L NM  D W+WH+YDT+KGSDWLGD DAI+Y+   AP ++ ELEHYGVPFSR E GKIYQ
Sbjct: 61  LGNMGEDDWRWHMYDTVKGSDWLGDQDAIEYMCKNAPDAILELEHYGVPFSRTEDGKIYQ 120

Query: 127 RPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEG 186
           RPFGG    YG+G   QRTCAAADRTGHAILHTLY Q+LK+  +FFIEYFA+DL++  +G
Sbjct: 121 RPFGGMTTEYGKGKAAQRTCAAADRTGHAILHTLYQQSLKHKVQFFIEYFAIDLLM-EDG 179

Query: 187 CCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQD 246
            C GVVAW L+ G +H F A  VVLATGGYGRAYFSATSAHTCTGDG GMV RAGLPLQD
Sbjct: 180 ECRGVVAWNLDDGSLHCFRAHNVVLATGGYGRAYFSATSAHTCTGDGGGMVIRAGLPLQD 239

Query: 247 MEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMM 306
           MEFVQFHPTGIY AGCLITEGARGEGGYLVN+ GERFMERYAP+AKDLASRDVVSR M +
Sbjct: 240 MEFVQFHPTGIYSAGCLITEGARGEGGYLVNANGERFMERYAPAAKDLASRDVVSRAMTI 299

Query: 307 EIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYN 366
           EIREGRGVG+ KDH+ L+LNHL P +L  RLPGISE+A+IFAGVDVT+DPIPV+PTVHYN
Sbjct: 300 EIREGRGVGEYKDHVFLHLNHLSPEILHRRLPGISETAKIFAGVDVTKDPIPVLPTVHYN 359

Query: 367 MGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAV 426
           MGGIPTNY G+V+  + KN      G+MAIGEA C SVHGANRLGSNSL+DLVVFGR++ 
Sbjct: 360 MGGIPTNYHGQVIIKDGKNHNSIVNGIMAIGEAACVSVHGANRLGSNSLLDLVVFGRSSA 419

Query: 427 IRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRT 486
           ++A+E+I   SP   L     ++I++RFD++RHA+G+V  A LR +MQR MQ    VFRT
Sbjct: 420 LKAAELIKPVSPHKPLKKEILEKIINRFDKIRHANGNVLVADLRLQMQRTMQSHVSVFRT 479

Query: 487 QDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKES 546
           Q+ L +G R +S + +   D+K++D+SLIWNSDLVE LEL NL+  A+ TVYSA ARKES
Sbjct: 480 QELLDEGARMISEIRNRYKDIKINDKSLIWNSDLVEALELDNLLDQALVTVYSAAARKES 539

Query: 547 RGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAP 606
           RG+HARED+ D     R+D++W KH+L  +D ++G+I LDY+PV    L   +  S I P
Sbjct: 540 RGAHAREDYPD-----RNDIDWIKHTLSSID-DSGQIILDYKPVTLTTLTDEI--STIPP 591

Query: 607 KARVY 611
             R+Y
Sbjct: 592 VKRIY 596


>gi|296445359|ref|ZP_06887317.1| succinate dehydrogenase, flavoprotein subunit [Methylosinus
           trichosporium OB3b]
 gi|296257120|gb|EFH04189.1| succinate dehydrogenase, flavoprotein subunit [Methylosinus
           trichosporium OB3b]
          Length = 610

 Score =  806 bits (2083), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 404/602 (67%), Positives = 475/602 (78%), Gaps = 7/602 (1%)

Query: 10  SYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLAN 69
           +Y  +DH++DVVVVGAGGAGLRA +G  E G   AC+TKVFPTRSHTVAAQGG+AA+L N
Sbjct: 16  AYPIIDHTFDVVVVGAGGAGLRAVVGCVEAGLSVACVTKVFPTRSHTVAAQGGVAAALGN 75

Query: 70  MTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRPF 129
           M PD W+WH+YDT+KGSDWLGD DAI+YL   AP++VYELEH+GVPFSR + G+IYQRPF
Sbjct: 76  MGPDDWKWHMYDTVKGSDWLGDQDAIEYLCRNAPEAVYELEHWGVPFSRTQDGRIYQRPF 135

Query: 130 GGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCCV 189
           GG   ++G+GPP QRTCAAADRTGHA+LHTLYGQAL+++A FF+EYFA+DLI++  G   
Sbjct: 136 GGMTTDFGKGPPAQRTCAAADRTGHAMLHTLYGQALRHDARFFVEYFAIDLIMDQSGATR 195

Query: 190 GVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDMEF 249
           GV+  +L+ G IHRF A L VLATGGYGRA+ SATSAHTCTGDG GMV RAGLPLQDMEF
Sbjct: 196 GVMCLKLDDGTIHRFRAGLTVLATGGYGRAFLSATSAHTCTGDGGGMVLRAGLPLQDMEF 255

Query: 250 VQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEIR 309
           VQFHPTGIYGAGCLITEGARGEGGYL NS+GERFMERYAPS KDLA RD+VSR M +EIR
Sbjct: 256 VQFHPTGIYGAGCLITEGARGEGGYLTNSEGERFMERYAPSVKDLAPRDMVSRAMTVEIR 315

Query: 310 EGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMGG 369
           EGRGVGK +DHIHL+L HLDPA+L ERLPGISESA+IFAGVDVTR+PIPV+PTVHYNMGG
Sbjct: 316 EGRGVGKLQDHIHLHLEHLDPAILHERLPGISESAKIFAGVDVTREPIPVLPTVHYNMGG 375

Query: 370 IPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIRA 429
           IPTN+ GEVL     +P+   PGLMAIGEA C SVHGANRLGSNSL+DL+VFGRAA  RA
Sbjct: 376 IPTNFHGEVLRRVGDDPDVVVPGLMAIGEAACVSVHGANRLGSNSLVDLIVFGRAAGHRA 435

Query: 430 SEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQDS 489
           +E++      P L   S D  + R D+ RHA G  PTA LR KMQR MQ    V+R  + 
Sbjct: 436 AEVVKPGEAQPELPADSADLALSRLDKFRHAAGGTPTAELRLKMQRVMQSHCAVYRAGEV 495

Query: 490 LSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRGS 549
           L +G + +  +W E ADLK+ DRSLIWN+DLVETLEL NL++ A+ T+ SA+ R ESRG+
Sbjct: 496 LEEGSQAIHAVWRESADLKITDRSLIWNTDLVETLELDNLLVQAVVTMDSAKNRTESRGA 555

Query: 550 HAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPKAR 609
           HAREDF +     RDD +W KH+L  +D     + LDYRPVH+  L   V Y  I PKAR
Sbjct: 556 HAREDFPN-----RDDADWMKHTLASIDDAGKTVALDYRPVHSYTLSDEVAY--IEPKAR 608

Query: 610 VY 611
           VY
Sbjct: 609 VY 610


>gi|34580876|ref|ZP_00142356.1| succinate dehydrogenase flavoprotein subunit [Rickettsia sibirica
           246]
 gi|28262261|gb|EAA25765.1| succinate dehydrogenase flavoprotein subunit [Rickettsia sibirica
           246]
          Length = 596

 Score =  806 bits (2081), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/605 (65%), Positives = 476/605 (78%), Gaps = 9/605 (1%)

Query: 7   LKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAAS 66
           +  +Y  + H +DVVVVGAGGAGLR+  GMA++G  TACITK+FPTRSHTVAAQGGI+A+
Sbjct: 1   MTKAYNIIHHKFDVVVVGAGGAGLRSAFGMAKEGLNTACITKLFPTRSHTVAAQGGISAA 60

Query: 67  LANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQ 126
           L NM  D W+WH+YDT+KGSDWLGD DAI+Y+   AP ++ ELEHYGVPFSR E GKIYQ
Sbjct: 61  LGNMGEDDWRWHMYDTVKGSDWLGDQDAIEYMCKNAPDAILELEHYGVPFSRTEEGKIYQ 120

Query: 127 RPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEG 186
           RPFGG    YG+G   QRTCAAADRTGHAILHTLY Q+LK+  +FF+EYFA+DL++  +G
Sbjct: 121 RPFGGMTTEYGKGKAAQRTCAAADRTGHAILHTLYQQSLKHKVQFFVEYFAIDLLME-DG 179

Query: 187 CCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQD 246
            C GVVAW L+ G +H F A  VVLATGGYGRAYFSATSAHTCTGDG GM  RAGLPLQD
Sbjct: 180 ECRGVVAWNLDDGSLHCFRAHNVVLATGGYGRAYFSATSAHTCTGDGGGMAIRAGLPLQD 239

Query: 247 MEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMM 306
           MEFVQFHPTGIY AGCLITEGARGEGGYLVN+ GERFMERYAP+AKDLASRDVVSR M +
Sbjct: 240 MEFVQFHPTGIYSAGCLITEGARGEGGYLVNANGERFMERYAPAAKDLASRDVVSRAMTI 299

Query: 307 EIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYN 366
           EIREGRGVG+ KDH+ L+LNHL P +L  RLPGISE+A+IFAGVDVT++PIPV+PTVHYN
Sbjct: 300 EIREGRGVGEHKDHVFLHLNHLSPEILHSRLPGISETAKIFAGVDVTKEPIPVLPTVHYN 359

Query: 367 MGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAV 426
           MGGIPTNY G+V+  + KN      GLMAIGEA C SVHGANRLGSNSL+DLVVFGR++ 
Sbjct: 360 MGGIPTNYHGQVIIKDGKNHNSVVKGLMAIGEAACVSVHGANRLGSNSLLDLVVFGRSSA 419

Query: 427 IRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRT 486
           ++A+E+I  +SP  S+   S ++I++RFD++RHA+G++  A LR KMQR MQ  A VFRT
Sbjct: 420 LKAAELIKSASPHKSIKEESLEKIINRFDKVRHANGNILVAELRLKMQRTMQSHASVFRT 479

Query: 487 QDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKES 546
           Q+ L +G   +S +     D+K++D+SLIWNSDLVE LEL NL+  A+ TVYSA ARKES
Sbjct: 480 QEVLDEGAGMISEIRSGYKDIKINDKSLIWNSDLVEALELDNLLDQALVTVYSAAARKES 539

Query: 547 RGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAP 606
           RG+HARED+ D     R+D +W KH+L  +D   GK+ LDY+PV    L   V  + + P
Sbjct: 540 RGAHAREDYPD-----RNDEDWMKHTLSSID-EAGKVVLDYKPVTLTTLTDEV--TAVPP 591

Query: 607 KARVY 611
             RVY
Sbjct: 592 VKRVY 596


>gi|226499336|ref|NP_001146722.1| hypothetical protein LOC100280324 [Zea mays]
 gi|219888493|gb|ACL54621.1| unknown [Zea mays]
          Length = 619

 Score =  805 bits (2080), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/607 (65%), Positives = 481/607 (79%), Gaps = 9/607 (1%)

Query: 5   SNLKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIA 64
           S   SSYT VDH+YD VVVGAGGAGLRA +G++E GF TACITK+FPTRSHTVAAQGGI 
Sbjct: 22  STASSSYTVVDHTYDAVVVGAGGAGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGIN 81

Query: 65  ASLANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKI 124
           A+L NM+ D W+WH+YDT+KGSDWLGD D+IQY+  EAP++V ELE+YG+PFSR E GKI
Sbjct: 82  AALGNMSEDDWRWHMYDTVKGSDWLGDQDSIQYMCREAPKAVIELENYGLPFSRTEEGKI 141

Query: 125 YQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINS 184
           YQR FGG   ++G+G    R   AADRTGHA+LHTLYGQA+K+N +FF+EYFALDL++++
Sbjct: 142 YQRAFGGQSLDFGKGGQAYRCACAADRTGHAMLHTLYGQAMKHNTQFFVEYFALDLLMDN 201

Query: 185 EGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPL 244
           +G C GV+A  +E G +HRF A   +LATGGYGRAYFSATSAHTCTGDG  MVARAGLPL
Sbjct: 202 DGKCQGVIALNMEDGTLHRFRASNTILATGGYGRAYFSATSAHTCTGDGNAMVARAGLPL 261

Query: 245 QDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCM 304
           QD+EFVQFHPTGIYGAGCLITEG+RGEGG L NS+GERFMERYAP+AKDLASRDVVSR M
Sbjct: 262 QDLEFVQFHPTGIYGAGCLITEGSRGEGGILRNSEGERFMERYAPTAKDLASRDVVSRSM 321

Query: 305 MMEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVH 364
            MEIREGRGVG  KDHI+L+LNHL P VL+ERLPGISE+A IFAGVDVT++PIPV+PTVH
Sbjct: 322 TMEIREGRGVGPLKDHIYLHLNHLPPEVLKERLPGISETAAIFAGVDVTKEPIPVLPTVH 381

Query: 365 YNMGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRA 424
           YNMGGIPTNY GEV+D    NP+   PGLMA GEA CASVHGANRLG+NSL+D+VVFGRA
Sbjct: 382 YNMGGIPTNYHGEVVDIKGNNPDAVIPGLMAAGEAACASVHGANRLGANSLLDIVVFGRA 441

Query: 425 AVIRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVF 484
              R +++         L+  + ++ +   D+LR+A+G +PT+ +R  MQR MQ +A VF
Sbjct: 442 CANRVADISKPGEKQKPLEKDAGEKTIAWLDKLRNANGSLPTSKIRLNMQRVMQNNAAVF 501

Query: 485 RTQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARK 544
           RTQ++L +GC  +S  W+   D+K+ DRSLIWNSDL+ETLEL+NL+INA  T+YSAEARK
Sbjct: 502 RTQETLEEGCELISKTWESFHDVKLSDRSLIWNSDLIETLELENLLINACITMYSAEARK 561

Query: 545 ESRGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKI 604
           ESRG+HAREDF       RDD  W KHSL +  W   K++L YRPVH + L   V+    
Sbjct: 562 ESRGAHAREDFTT-----RDDEKWMKHSLGY--WENEKVRLAYRPVHMKTLDDEVE--SF 612

Query: 605 APKARVY 611
            PKARVY
Sbjct: 613 PPKARVY 619


>gi|114798098|ref|YP_761918.1| succinate dehydrogenase flavoprotein subunit [Hyphomonas neptunium
           ATCC 15444]
 gi|114738272|gb|ABI76397.1| succinate dehydrogenase, flavoprotein subunit [Hyphomonas neptunium
           ATCC 15444]
          Length = 595

 Score =  805 bits (2079), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/603 (66%), Positives = 474/603 (78%), Gaps = 9/603 (1%)

Query: 9   SSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLA 68
           SSY ++DH+YDVVVVGAGG+GLRA LG A+ G +TACITKVFPTRSHTVAAQGGIAASL 
Sbjct: 2   SSYNWIDHTYDVVVVGAGGSGLRAALGAAQAGLRTACITKVFPTRSHTVAAQGGIAASLG 61

Query: 69  NMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRP 128
           NM+ DSWQWH+YDT+KGSDWLGD DAI+YL   AP +VYELEH+G+PFSR E GKIYQR 
Sbjct: 62  NMSDDSWQWHMYDTVKGSDWLGDQDAIEYLVRNAPDAVYELEHWGMPFSRTEEGKIYQRA 121

Query: 129 FGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCC 188
           FGG  +N+GEGP VQRTCAAADRTGHA+LHTLYGQ ++   EFFIEYFALDLI++ +G C
Sbjct: 122 FGGMTRNFGEGP-VQRTCAAADRTGHAMLHTLYGQCVREETEFFIEYFALDLIMDDDGVC 180

Query: 189 VGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDME 248
            GV AW+L+ G +HRF A+  +LATGGYGRAYFS TSAHTCTGDG  MV RAGLPLQDME
Sbjct: 181 RGVTAWKLDDGTLHRFRAQKTILATGGYGRAYFSCTSAHTCTGDGNAMVLRAGLPLQDME 240

Query: 249 FVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEI 308
           FVQFHPTGIYG+GCLITEGARGEGGYL NS+GERFMERYAPSAKDLASRDVVSR M MEI
Sbjct: 241 FVQFHPTGIYGSGCLITEGARGEGGYLTNSEGERFMERYAPSAKDLASRDVVSRAMTMEI 300

Query: 309 REGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMG 368
           R+GRGVG  KDHI L+LNHL P  L ERLPGISE+A+IFAGVDVT++PIPV+PTVHYNMG
Sbjct: 301 RDGRGVGPEKDHIFLHLNHLAPETLHERLPGISETAKIFAGVDVTKEPIPVLPTVHYNMG 360

Query: 369 GIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIR 428
           GIPTN+ GEVL   + +P+   PGLMA+GEA C SVHGANRLGSNSLIDLVVFGRAA +R
Sbjct: 361 GIPTNFHGEVLTKKNGDPDAVVPGLMAVGEAACVSVHGANRLGSNSLIDLVVFGRAAGLR 420

Query: 429 ASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQD 488
                +  +  P L  ++ D  + R D++R+A G  P A LR +MQRAMQ +  VFRT  
Sbjct: 421 CGATTEAGARQPGLAKTATDSHIARLDKMRNATGDQPVAKLRLEMQRAMQSNCAVFRTGS 480

Query: 489 SLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRG 548
            L +G   +  ++ ++  + V DR ++WN+DLVE LE +NL+  A  TV SA  R+ESRG
Sbjct: 481 VLKEGVDAIEDVYKKLPGIDVKDRGMVWNTDLVEALEFENLICQAAVTVNSAANREESRG 540

Query: 549 SHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPKA 608
           +HAREDF D     R+D  W KH+L W D + GK+ LDYRPVH   L   ++Y  I PKA
Sbjct: 541 AHAREDFAD-----RNDETWMKHTLAWCD-DAGKVSLDYRPVHEYTLSNEIEY--IKPKA 592

Query: 609 RVY 611
           RVY
Sbjct: 593 RVY 595


>gi|254455518|ref|ZP_05068947.1| succinate dehydrogenase, flavoprotein subunit [Candidatus
           Pelagibacter sp. HTCC7211]
 gi|207082520|gb|EDZ59946.1| succinate dehydrogenase, flavoprotein subunit [Candidatus
           Pelagibacter sp. HTCC7211]
          Length = 591

 Score =  805 bits (2079), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/603 (64%), Positives = 464/603 (76%), Gaps = 13/603 (2%)

Query: 9   SSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLA 68
           S+Y  +DH YDVVV+GAGG+GLRA +G++E G KTACI+KVFPTRSHT AAQGGI+A+L 
Sbjct: 2   STYKIIDHEYDVVVLGAGGSGLRAAVGLSEAGLKTACISKVFPTRSHTSAAQGGISAALG 61

Query: 69  NMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRP 128
           NM  D W+WH+YDT+KG+DWLGD D+I+YL  EAPQ+V ELE YGVPFSR E GKIYQRP
Sbjct: 62  NMGEDDWRWHMYDTVKGADWLGDQDSIEYLCKEAPQAVIELEKYGVPFSRTEEGKIYQRP 121

Query: 129 FGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCC 188
           FGG  +NYG G  VQRTCAAADRTGHAILHTLYGQALK+N EFFIEYFALDL++  +G C
Sbjct: 122 FGGMTKNYGNGI-VQRTCAAADRTGHAILHTLYGQALKHNTEFFIEYFALDLLMK-DGEC 179

Query: 189 VGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDME 248
            G++AW L  G IHRF A  V++ATGGYG+ Y+SATSAHTCTGDG  MV RAGLPLQDME
Sbjct: 180 KGLIAWNLNDGTIHRFRAHTVIIATGGYGKVYYSATSAHTCTGDGNAMVLRAGLPLQDME 239

Query: 249 FVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEI 308
           FVQFHPTGIYG G LITEGARGEGGYL NSKGERFMERYAPSAKDLASRDVVSR M +EI
Sbjct: 240 FVQFHPTGIYGHGTLITEGARGEGGYLTNSKGERFMERYAPSAKDLASRDVVSRSMSIEI 299

Query: 309 REGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMG 368
            EGRGVGK +DH+HL L+HLD  +++ RLPGI+++AR+FA VDVT++PIPV+PTVHYNMG
Sbjct: 300 NEGRGVGKDQDHVHLNLSHLDKEIIESRLPGITDAARLFANVDVTKEPIPVVPTVHYNMG 359

Query: 369 GIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIR 428
           GIPTNY GEV+  N    E+  PGLMAIGEA C SVHGANRLGSNSLIDLVVFGRAA  R
Sbjct: 360 GIPTNYKGEVMTVNGS--EKTVPGLMAIGEAACVSVHGANRLGSNSLIDLVVFGRAAAKR 417

Query: 429 ASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQD 488
           A+E+I   +P   +  +   + +DRFD+LR+A+G   TA LR  MQ+ MQ    VFRT+ 
Sbjct: 418 AAELIKPGTPHEEIGETETQKCLDRFDKLRNANGENSTADLRLAMQKTMQSKCAVFRTEK 477

Query: 489 SLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRG 548
           +L +G   +   +D M  + V DRSL++N+DLVETLE  NL+  A+ATV SA  RKESRG
Sbjct: 478 NLKEGVDEIRKTYDGMDSISVKDRSLVFNTDLVETLEFDNLIRQAVATVDSAYHRKESRG 537

Query: 549 SHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPKA 608
           +HAR+D+       RDD  + +H+L W D    KI   YR VH   L   V Y    P+ 
Sbjct: 538 AHARDDYPK-----RDDEKFMQHTLAWCDGKNTKIS--YREVHKSTLTNEVQY--FPPQE 588

Query: 609 RVY 611
           RVY
Sbjct: 589 RVY 591


>gi|255579273|ref|XP_002530482.1| succinate dehydrogenase, putative [Ricinus communis]
 gi|223529979|gb|EEF31905.1| succinate dehydrogenase, putative [Ricinus communis]
          Length = 622

 Score =  805 bits (2079), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/609 (65%), Positives = 484/609 (79%), Gaps = 9/609 (1%)

Query: 3   NSSNLKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGG 62
           +SS  +SSYT VDH+YD VVVGAGGAGLRA +G++E GF TACITK+FPTRSHTVAAQGG
Sbjct: 23  DSSAGQSSYTIVDHTYDAVVVGAGGAGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGG 82

Query: 63  IAASLANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAG 122
           I A+L NMT D W+WH+YDT+KGSDWLGD DAIQY+  EAP++V ELE+YG+PFSR E G
Sbjct: 83  INAALGNMTEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFSRTEDG 142

Query: 123 KIYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLII 182
           +IYQR FGG   ++G+G    R   AADRTGHA+LHTLYGQA+K+N +FF+EYFALDL++
Sbjct: 143 RIYQRAFGGQSLDFGKGGQAYRCACAADRTGHALLHTLYGQAMKHNTQFFVEYFALDLLM 202

Query: 183 NSEGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGL 242
           NS+G C GV+A  +E G +HRF A   +LATGGYGRAYFSATSAHTCTGDG  MVARAGL
Sbjct: 203 NSDGSCQGVIAMNMEDGTLHRFRAASTILATGGYGRAYFSATSAHTCTGDGNAMVARAGL 262

Query: 243 PLQDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSR 302
           PLQD+EFVQFHPTGIYGAGCLITEG+RGEGG L NS+GERFMERYAP+AKDLASRDVVSR
Sbjct: 263 PLQDLEFVQFHPTGIYGAGCLITEGSRGEGGILRNSEGERFMERYAPTAKDLASRDVVSR 322

Query: 303 CMMMEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPT 362
            M MEIREGRGVG  KDHI+L+LNHL P VL+ERLPGISE+A IFAGVDVT++PIPV+PT
Sbjct: 323 SMTMEIREGRGVGPLKDHIYLHLNHLPPDVLKERLPGISETAAIFAGVDVTKEPIPVLPT 382

Query: 363 VHYNMGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFG 422
           VHYNMGGIPTNY GEV+     +P+   PGLMA GEA CASVHGANRLG+NSL+D+VVFG
Sbjct: 383 VHYNMGGIPTNYHGEVVTVKGNDPDSVVPGLMAAGEAACASVHGANRLGANSLLDIVVFG 442

Query: 423 RAAVIRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAG 482
           RA   R +E+         L+  + +R +   D+LR+++G +PT+ +R  MQR MQ +A 
Sbjct: 443 RACANRVAEIQRPGEKQKPLEKDAGERTIAWLDKLRNSNGSLPTSKIRLNMQRTMQNNAA 502

Query: 483 VFRTQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEA 542
           VFRTQ++L +GC+ +   W+   D+K+ DRSLIWNSDL+ET+EL+NL+INA  T++SAEA
Sbjct: 503 VFRTQETLEEGCQLIDKAWESFHDVKLKDRSLIWNSDLIETVELENLLINACITMHSAEA 562

Query: 543 RKESRGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYS 602
           RKESRG+HAREDF       RDD +W KH+L +  W   K++LDYRPVH   L    +  
Sbjct: 563 RKESRGAHAREDFTK-----RDDKDWMKHTLGY--WENEKVRLDYRPVHMNTL--DDEME 613

Query: 603 KIAPKARVY 611
            I PKARVY
Sbjct: 614 TIPPKARVY 622


>gi|229586368|ref|YP_002844869.1| succinate dehydrogenase flavoprotein subunit [Rickettsia africae
           ESF-5]
 gi|228021418|gb|ACP53126.1| Succinate dehydrogenase flavoprotein subunit [Rickettsia africae
           ESF-5]
          Length = 596

 Score =  805 bits (2078), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/605 (65%), Positives = 476/605 (78%), Gaps = 9/605 (1%)

Query: 7   LKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAAS 66
           +  +Y  + H +DVVVVGAGGAGLR+  GMA++G  TACITK+FPTRSHTVAAQGGI+A+
Sbjct: 1   MTKAYNIIHHKFDVVVVGAGGAGLRSAFGMAKEGLNTACITKLFPTRSHTVAAQGGISAA 60

Query: 67  LANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQ 126
           L NM  D W+WH+YDT+KGSDWLGD DAI+Y+   AP ++ ELEHYGVPFSR E GKIYQ
Sbjct: 61  LGNMGEDDWRWHMYDTVKGSDWLGDQDAIEYMCKNAPDAILELEHYGVPFSRTEEGKIYQ 120

Query: 127 RPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEG 186
           RPFGG    YG+G   QRTCAAADRTGHAILHTLY Q+LK+  +FF+EYFA+DL++  +G
Sbjct: 121 RPFGGMTTEYGKGKAAQRTCAAADRTGHAILHTLYQQSLKHKVQFFVEYFAIDLLM-EDG 179

Query: 187 CCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQD 246
            C GVVAW L+ G +H F A  VVLATGGYGRAYFSATSAHTCTGDG GM  RAGLPLQD
Sbjct: 180 ECRGVVAWNLDDGSLHCFRAHNVVLATGGYGRAYFSATSAHTCTGDGGGMAIRAGLPLQD 239

Query: 247 MEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMM 306
           MEFVQFHPTGIY AGCLITEGARGEGGYLVN+ GERFMERYAP+AKDLASRDVVSR M +
Sbjct: 240 MEFVQFHPTGIYSAGCLITEGARGEGGYLVNANGERFMERYAPAAKDLASRDVVSRAMTI 299

Query: 307 EIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYN 366
           EIREGRGVG+ KDH+ L+LNHL P +L  RLPGISE+A+IFAGVDVT++PIPV+PTVHYN
Sbjct: 300 EIREGRGVGEHKDHVFLHLNHLSPEILHSRLPGISETAKIFAGVDVTKEPIPVLPTVHYN 359

Query: 367 MGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAV 426
           MGGIPTNY G+V+  + KN      GLMAIGEA C SVHGANRLGSNSL+DLVVFGR++ 
Sbjct: 360 MGGIPTNYHGQVIIKDGKNHNSVVKGLMAIGEAACVSVHGANRLGSNSLLDLVVFGRSSA 419

Query: 427 IRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRT 486
           ++A+E+I  +SP  S+   S ++I++RFD++RHA+G++  A LR KMQR MQ  A VFRT
Sbjct: 420 LKAAELIKPASPHKSIKEESLEKIINRFDKVRHANGNILVAELRLKMQRTMQSHASVFRT 479

Query: 487 QDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKES 546
           Q+ L +G   +S +     D+K++D+SLIWNSDLVE LEL NL+  A+ TVYSA ARKES
Sbjct: 480 QEVLDEGAGMISEIRSGYKDIKINDKSLIWNSDLVEALELDNLLDQALVTVYSAAARKES 539

Query: 547 RGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAP 606
           RG+HARED+ D     R+D +W KH+L  +D   GK+ LDY+PV    L   V  + + P
Sbjct: 540 RGAHAREDYPD-----RNDEDWMKHTLSSID-EAGKVVLDYKPVTLTTLTDEV--TAVPP 591

Query: 607 KARVY 611
             RVY
Sbjct: 592 VKRVY 596


>gi|297797713|ref|XP_002866741.1| succinate dehydrogenase 1-1 [Arabidopsis lyrata subsp. lyrata]
 gi|297312576|gb|EFH43000.1| succinate dehydrogenase 1-1 [Arabidopsis lyrata subsp. lyrata]
          Length = 634

 Score =  804 bits (2077), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/608 (65%), Positives = 484/608 (79%), Gaps = 9/608 (1%)

Query: 4   SSNLKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGI 63
           S++ +SSYT VDH+YD VVVGAGGAGLRA +G++E GF TACITK+FPTRSHTVAAQGGI
Sbjct: 36  STDTRSSYTIVDHTYDAVVVGAGGAGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGI 95

Query: 64  AASLANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGK 123
            A+L NM+ D W+WH+YDT+KGSDWLGD DAIQY+  EAP++V ELE+YG+PFSR E GK
Sbjct: 96  NAALGNMSEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFSRTEEGK 155

Query: 124 IYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIIN 183
           IYQR FGG   ++G+G    R   AADRTGHA+LHTLYGQA+K+N +FF+EYFALDL++ 
Sbjct: 156 IYQRAFGGQSLDFGKGGQAYRCACAADRTGHALLHTLYGQAMKHNTQFFVEYFALDLLMA 215

Query: 184 SEGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLP 243
           S+G C GV+A  +E G +HRF +   +LATGGYGRAYFSATSAHTCTGDG  MVARAGLP
Sbjct: 216 SDGSCQGVIALNMEDGTLHRFRSSQTILATGGYGRAYFSATSAHTCTGDGNAMVARAGLP 275

Query: 244 LQDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRC 303
           LQD+EFVQFHPTGIYGAGCLITEG+RGEGG L NS+GERFMERYAP+AKDLASRDVVSR 
Sbjct: 276 LQDLEFVQFHPTGIYGAGCLITEGSRGEGGILRNSEGERFMERYAPTAKDLASRDVVSRS 335

Query: 304 MMMEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTV 363
           M MEIREGRGVG  KDHI+L+LNHL P VL+ERLPGISE+A IFAGVDVT++PIPV+PTV
Sbjct: 336 MTMEIREGRGVGPHKDHIYLHLNHLPPEVLKERLPGISETAAIFAGVDVTKEPIPVLPTV 395

Query: 364 HYNMGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGR 423
           HYNMGGIPTNY GEV+     NP+   PGLMA GEA CASVHGANRLG+NSL+D+VVFGR
Sbjct: 396 HYNMGGIPTNYHGEVVTIKGDNPDAVVPGLMAAGEAACASVHGANRLGANSLLDIVVFGR 455

Query: 424 AAVIRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGV 483
           A   R +E+         L+  + ++ +   DRLR+++G +PT+++R  MQR MQ +A V
Sbjct: 456 ACANRVAEISKPGEKQKPLEKDAGEKTIAWLDRLRNSNGSLPTSSIRLNMQRVMQNNAAV 515

Query: 484 FRTQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEAR 543
           FRTQ++L +GC+ +   W+   D++V DRS+IWNSDL+ETLEL+NL+INA  T++SAEAR
Sbjct: 516 FRTQETLEEGCQLIDKAWESFGDVQVKDRSMIWNSDLIETLELENLLINASITMHSAEAR 575

Query: 544 KESRGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSK 603
           KESRG+HAREDF       R+D  W KH+L +  W   K++L+YRPVH + L   +D   
Sbjct: 576 KESRGAHAREDFTK-----REDGEWMKHTLGY--WEDEKVRLEYRPVHMDTLDDEID--T 626

Query: 604 IAPKARVY 611
             PKARVY
Sbjct: 627 FPPKARVY 634


>gi|85374258|ref|YP_458320.1| succinate dehydrogenase flavoprotein subunit [Erythrobacter
           litoralis HTCC2594]
 gi|84787341|gb|ABC63523.1| succinate dehydrogenase flavoprotein subunit [Erythrobacter
           litoralis HTCC2594]
          Length = 610

 Score =  804 bits (2077), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 408/617 (66%), Positives = 472/617 (76%), Gaps = 13/617 (2%)

Query: 1   MKNSSNLKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQ 60
           M   +N   +Y  +DH++DVVVVGAGG+GLRAT+G AE G KTA I+KVFPTRSHTVAAQ
Sbjct: 1   MATDTNAAPAYQIIDHTFDVVVVGAGGSGLRATMGAAEAGLKTANISKVFPTRSHTVAAQ 60

Query: 61  GGIAASLANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNE 120
           GGIAASL N TPD W WH+YDT+KG+DWLGD DAI+YLA EAP +VYELEH GVPFSRNE
Sbjct: 61  GGIAASLGNNTPDHWSWHMYDTVKGADWLGDQDAIEYLAREAPAAVYELEHAGVPFSRNE 120

Query: 121 AGKIYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDL 180
            G IYQRPFGGHMQN GEGPPVQRTCAAADRTGHA+LH LY Q+LK +A+FFIEYFALDL
Sbjct: 121 DGTIYQRPFGGHMQNMGEGPPVQRTCAAADRTGHAMLHALYQQSLKYDADFFIEYFALDL 180

Query: 181 IINS--EGC-CVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMV 237
           I+    EG  C GV+A  L+ G IHRF A  VVLATGGYGR Y++ATSAHTCTGDG GMV
Sbjct: 181 IMEDTPEGKKCRGVIAMCLDDGTIHRFKAHAVVLATGGYGRCYYTATSAHTCTGDGGGMV 240

Query: 238 ARAGLPLQDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASR 297
            RAGLPLQDMEFVQFHPTGIYGAG LITEGARGEGGYL NS+GERFMERYAPSAKDLASR
Sbjct: 241 LRAGLPLQDMEFVQFHPTGIYGAGVLITEGARGEGGYLTNSEGERFMERYAPSAKDLASR 300

Query: 298 DVVSRCMMMEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPI 357
           DVVSR M +E+REGRGVG+  DHI+L+L+H+DP VL ERLPGI+ES +IFAGVD+TR P+
Sbjct: 301 DVVSRSMALEMREGRGVGEDGDHIYLHLDHIDPKVLAERLPGITESGKIFAGVDLTRQPL 360

Query: 358 PVIPTVHYNMGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLID 417
           PV PTVHYNMGGIP NY G+V+   + +P+   PGL A+GEA C SVHGANRLGSNSLID
Sbjct: 361 PVTPTVHYNMGGIPCNYHGQVVAGKAGDPDAVVPGLYAVGEAACVSVHGANRLGSNSLID 420

Query: 418 LVVFGRAAVIRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAM 477
           LVVFGRA  +   E +  ++   +L   S +  + R D  RHA G  PTA +RE MQ+ M
Sbjct: 421 LVVFGRATGLHLKENLKPNAAHDALPSDSAELALARVDHFRHAKGGTPTAKIRENMQKGM 480

Query: 478 QLDAGVFRTQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATV 537
           Q  A VFR    LS+G   L+ +   M D+ V DRSLIWNSDL+ETLEL NLM  A  T+
Sbjct: 481 QKHAAVFRDSKLLSEGVELLAEVNKSMEDIAVSDRSLIWNSDLIETLELDNLMAQANVTI 540

Query: 538 YSAEARKESRGSHAREDFKDGEFGGRDDVNWRKHSLCWVD-W--NTGKIKLDYRPVHTEL 594
            SAE RKESRG+HA EDF +     RDD  W KH++ W D W  + G +++DYRPVH   
Sbjct: 541 ASAENRKESRGAHAHEDFPE-----RDDKEWMKHTITWFDGWGGSGGAMRIDYRPVHEYT 595

Query: 595 LCGGVDYSKIAPKARVY 611
           L    +Y  I PK RVY
Sbjct: 596 LTDDAEY--IEPKKRVY 610


>gi|195647178|gb|ACG43057.1| succinate dehydrogenase flavoprotein subunit,mitochondrial
           precursor [Zea mays]
          Length = 619

 Score =  804 bits (2077), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/607 (65%), Positives = 480/607 (79%), Gaps = 9/607 (1%)

Query: 5   SNLKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIA 64
           S   SSYT VDH+YD VVVGAGGAGLRA +G++E GF TACITK+FPTRSHTVAAQGGI 
Sbjct: 22  STASSSYTVVDHTYDAVVVGAGGAGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGIN 81

Query: 65  ASLANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKI 124
           A+L NM+ D W+WH+YDT+KGSDWLGD D+IQY+  EAP++V ELE+YG+PFSR E GKI
Sbjct: 82  AALGNMSEDDWRWHMYDTVKGSDWLGDQDSIQYMCREAPKAVIELENYGLPFSRTEEGKI 141

Query: 125 YQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINS 184
           YQR FGG   ++G+G    R   AADRTGHA+LHTLYGQA+K+N +FF+EYFALDL++++
Sbjct: 142 YQRAFGGQSLDFGKGGQAYRCACAADRTGHAMLHTLYGQAMKHNTQFFVEYFALDLLMDN 201

Query: 185 EGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPL 244
           +G C GV+A  +E G +HRF A   +LATGGYGRAYFSATSAHTCTGDG  MVARAGLPL
Sbjct: 202 DGKCQGVIALNMEDGTLHRFRASNTILATGGYGRAYFSATSAHTCTGDGNAMVARAGLPL 261

Query: 245 QDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCM 304
           QD+EFVQFHPTGIYGAGCLITEG+RGEGG L NS+GERFMERYAP+AKDLASRDVVSR M
Sbjct: 262 QDLEFVQFHPTGIYGAGCLITEGSRGEGGILRNSEGERFMERYAPTAKDLASRDVVSRSM 321

Query: 305 MMEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVH 364
            MEIREGRGVG  KDHI+L+LNHL P VL+ERLPGISE+A IFAGVDVT++PIPV+PTVH
Sbjct: 322 TMEIREGRGVGPLKDHIYLHLNHLPPEVLKERLPGISETAAIFAGVDVTKEPIPVLPTVH 381

Query: 365 YNMGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRA 424
           YNMGGIPTNY GEV+D    NP+   PGLMA GEA CASVHGANRLG+NSL+D+VVFGRA
Sbjct: 382 YNMGGIPTNYHGEVVDIKGDNPDAVIPGLMAAGEAACASVHGANRLGANSLLDIVVFGRA 441

Query: 425 AVIRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVF 484
              R +++         L+  + ++ +   D+LR+A+G +PT+ +R  MQR MQ +A VF
Sbjct: 442 CANRVADISKPGEKQKPLEKDAGEKTIAWLDKLRNANGSLPTSKIRLNMQRVMQNNAAVF 501

Query: 485 RTQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARK 544
           RTQ++L +GC  +S  W+   D+K+ DRSLIWNSDL+ETLEL+NL+INA  T+YSAEARK
Sbjct: 502 RTQETLEEGCELISKTWESFHDVKLSDRSLIWNSDLIETLELENLLINACITMYSAEARK 561

Query: 545 ESRGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKI 604
           ESRG+HAREDF       RDD  W KHSL +  W   K++L YRPVH   L   V+    
Sbjct: 562 ESRGAHAREDFTT-----RDDEKWMKHSLGY--WENEKVRLAYRPVHMNTLDDEVE--SF 612

Query: 605 APKARVY 611
            PKARVY
Sbjct: 613 PPKARVY 619


>gi|226493856|ref|NP_001146352.1| hypothetical protein LOC100279930 [Zea mays]
 gi|219886761|gb|ACL53755.1| unknown [Zea mays]
 gi|224034159|gb|ACN36155.1| unknown [Zea mays]
 gi|224034161|gb|ACN36156.1| unknown [Zea mays]
          Length = 619

 Score =  804 bits (2077), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/607 (65%), Positives = 480/607 (79%), Gaps = 9/607 (1%)

Query: 5   SNLKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIA 64
           S   SSYT VDH+YD VVVGAGGAGLRA +G++E GF TACITK+FPTRSHTVAAQGGI 
Sbjct: 22  STASSSYTVVDHTYDAVVVGAGGAGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGIN 81

Query: 65  ASLANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKI 124
           A+L NM+ D W+WH+YDT+KGSDWLGD D+IQY+  EAP++V ELE+YG+PFSR E GKI
Sbjct: 82  AALGNMSEDDWRWHMYDTVKGSDWLGDQDSIQYMCREAPKAVIELENYGLPFSRTEEGKI 141

Query: 125 YQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINS 184
           YQR FGG   ++G+G    R   AADRTGHA+LHTLYGQA+K+N +FF+EYFALDL++++
Sbjct: 142 YQRAFGGQSLDFGKGGQAYRCACAADRTGHAMLHTLYGQAMKHNTQFFVEYFALDLLMDN 201

Query: 185 EGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPL 244
           EG C G++A  +E G +HRF A   +LATGGYGRAYFSATSAHTCTGDG  MVARAGLPL
Sbjct: 202 EGKCQGIIALNMEDGTLHRFRASNTILATGGYGRAYFSATSAHTCTGDGNAMVARAGLPL 261

Query: 245 QDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCM 304
           QD+EFVQFHPTGIYGAGCLITEG+RGEGG L NS+GERFMERYAP+AKDLASRDVVSR M
Sbjct: 262 QDLEFVQFHPTGIYGAGCLITEGSRGEGGILRNSEGERFMERYAPTAKDLASRDVVSRSM 321

Query: 305 MMEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVH 364
            MEIREGRGVG  KDHI+L+LNHL P VL+ERLPGISE+A IFAGVDVT++PIPV+PTVH
Sbjct: 322 TMEIREGRGVGPLKDHIYLHLNHLPPEVLKERLPGISETAAIFAGVDVTKEPIPVLPTVH 381

Query: 365 YNMGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRA 424
           YNMGGIPTNY GEV+D    NP+   PGLMA GEA CASVHGANRLG+NSL+D+VVFGRA
Sbjct: 382 YNMGGIPTNYHGEVVDIKGDNPDAVVPGLMAAGEAACASVHGANRLGANSLLDIVVFGRA 441

Query: 425 AVIRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVF 484
              R +++         L+  + ++ +   D+LR+A+G +PT+ +R  MQR MQ +A VF
Sbjct: 442 CANRVADISKPGEKQKPLEKDAGEKTIAWLDKLRNANGSLPTSKIRLNMQRVMQNNAAVF 501

Query: 485 RTQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARK 544
           RTQ++L +GC  +S  W+   D+K+ D+SLIWNSDL+ETLEL+NL+INA  T+YSAEARK
Sbjct: 502 RTQETLEEGCELISKTWESFHDVKLSDQSLIWNSDLIETLELENLLINACITMYSAEARK 561

Query: 545 ESRGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKI 604
           ESRG+HAREDF       RDD  W KHSL +  W   K++L YRPVH   L   V+    
Sbjct: 562 ESRGAHAREDFTT-----RDDEKWMKHSLGY--WENEKVRLAYRPVHMNTLDDEVE--SF 612

Query: 605 APKARVY 611
            PKARVY
Sbjct: 613 PPKARVY 619


>gi|326527549|dbj|BAK08049.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 619

 Score =  804 bits (2077), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/607 (65%), Positives = 482/607 (79%), Gaps = 9/607 (1%)

Query: 5   SNLKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIA 64
           S   SSYT VDHSYD VVVGAGGAGLRA +G++E GF TACITK+FPTRSHTVAAQGGI 
Sbjct: 22  STTSSSYTVVDHSYDAVVVGAGGAGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGIN 81

Query: 65  ASLANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKI 124
           A+L NM+ D W+WH+YDT+KGSDWLGD D+IQY+  EAP++V ELE+YG+PFSR E GKI
Sbjct: 82  AALGNMSEDDWRWHMYDTVKGSDWLGDQDSIQYMCREAPKAVIELENYGLPFSRTEDGKI 141

Query: 125 YQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINS 184
           YQR FGG   ++G+G    R   AADRTGHA+LHTLYGQA+K+N +FF+EYFALDL++++
Sbjct: 142 YQRAFGGQSLDFGKGGQAYRCACAADRTGHAMLHTLYGQAMKHNTQFFVEYFALDLLMDN 201

Query: 185 EGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPL 244
           EG C GV+A  +E G +HRF A   +LATGGYGRAYFSATSAHTCTGDG  MVARAGLPL
Sbjct: 202 EGNCQGVIALNMEDGTLHRFRATNTILATGGYGRAYFSATSAHTCTGDGNAMVARAGLPL 261

Query: 245 QDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCM 304
           QD+EFVQFHPTGIYGAGCLITEG+RGEGG L NS+GERFMERYAP+AKDLASRDVVSR M
Sbjct: 262 QDLEFVQFHPTGIYGAGCLITEGSRGEGGILRNSEGERFMERYAPTAKDLASRDVVSRSM 321

Query: 305 MMEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVH 364
            MEIREGRGVG  KDHI+L+LNHL P VL+ERLPGISE+A IFAGVDVT++PIPV+PTVH
Sbjct: 322 TMEIREGRGVGPLKDHIYLHLNHLPPEVLKERLPGISETAAIFAGVDVTKEPIPVLPTVH 381

Query: 365 YNMGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRA 424
           YNMGGIPTNY GEV+D    NP+   PGLMA GEA CASVHGANRLG+NSL+D+VVFGRA
Sbjct: 382 YNMGGIPTNYHGEVVDIKGDNPDTVIPGLMAAGEAACASVHGANRLGANSLLDIVVFGRA 441

Query: 425 AVIRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVF 484
              R +E+         L+  + ++ +   D+LR+A+G +PT+ +R   QR MQ +A VF
Sbjct: 442 CANRVAEISKPGDKQKPLEKGAGEKTIAWLDKLRNANGSLPTSKIRLNTQRIMQNNAAVF 501

Query: 485 RTQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARK 544
           RTQ++L +GC+ +S  W+   D+K++DRSLIWNSDL+ET+EL+NL+INA  T+YSAEARK
Sbjct: 502 RTQETLEEGCQLISKAWESYHDVKINDRSLIWNSDLIETIELENLLINACITMYSAEARK 561

Query: 545 ESRGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKI 604
           ESRG+HAREDF       RDD +W KHSL +  W   K++L YRPVH   L   ++    
Sbjct: 562 ESRGAHAREDFTT-----RDDEHWMKHSLGY--WENEKVRLAYRPVHMNTLDDEIE--SF 612

Query: 605 APKARVY 611
            PKARVY
Sbjct: 613 PPKARVY 619


>gi|157964195|ref|YP_001499019.1| succinate dehydrogenase flavoprotein subunit [Rickettsia massiliae
           MTU5]
 gi|157843971|gb|ABV84472.1| Succinate dehydrogenase flavoprotein subunit [Rickettsia massiliae
           MTU5]
          Length = 599

 Score =  804 bits (2077), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/605 (65%), Positives = 477/605 (78%), Gaps = 9/605 (1%)

Query: 7   LKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAAS 66
           +  +Y  + H +DVVVVGAGGAGLR+  GMA++G  TACITK+FPTRSHTVAAQGGI+A+
Sbjct: 4   MTKAYNIIHHQFDVVVVGAGGAGLRSAFGMAKEGLNTACITKLFPTRSHTVAAQGGISAA 63

Query: 67  LANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQ 126
           L NM  D W+WH+YDT+KGSDWLGD DAI+Y+   AP ++ ELEHYGVPFSR E GKIYQ
Sbjct: 64  LGNMGEDDWRWHMYDTVKGSDWLGDQDAIEYMCKNAPDAILELEHYGVPFSRTEEGKIYQ 123

Query: 127 RPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEG 186
           RPFGG    YG+G   QRTCAAADRTGHAILHTLY Q+LK+  +FF+EYFA+DL++  +G
Sbjct: 124 RPFGGMTTEYGKGKAAQRTCAAADRTGHAILHTLYQQSLKHKVQFFVEYFAIDLLM-EDG 182

Query: 187 CCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQD 246
            C GVVAW L+ G +H F A  VVLATGGYGRAYFSATSAHTCTGDG GM  RAGLP+QD
Sbjct: 183 ECRGVVAWNLDDGSLHCFRAHNVVLATGGYGRAYFSATSAHTCTGDGGGMAIRAGLPMQD 242

Query: 247 MEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMM 306
           MEFVQFHPTGIY AGCLITEGARGEGGYLVN+ GERFMERYAP+AKDLASRDVVSR M +
Sbjct: 243 MEFVQFHPTGIYSAGCLITEGARGEGGYLVNANGERFMERYAPAAKDLASRDVVSRAMTI 302

Query: 307 EIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYN 366
           EIREGRGVG+ KDH+ L+LNHL P +L  RLPGISE+A+IFAGVDVT++PIPV+PTVHYN
Sbjct: 303 EIREGRGVGEHKDHVFLHLNHLSPEILHSRLPGISETAKIFAGVDVTQEPIPVLPTVHYN 362

Query: 367 MGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAV 426
           MGGIPTNY G+V+  + KN      GLMAIGEA C SVHGANRLGSNSL+DLVVFGR++ 
Sbjct: 363 MGGIPTNYHGQVIIKDGKNHNSVVKGLMAIGEAACVSVHGANRLGSNSLLDLVVFGRSSA 422

Query: 427 IRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRT 486
           ++A+E+I  +SP  S++  S ++I++RFD++RHA+G++  A LR KMQR MQ  A VFRT
Sbjct: 423 LKAAELIKPASPHKSINEESLEKIINRFDKVRHANGNILVAELRLKMQRTMQSHAAVFRT 482

Query: 487 QDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKES 546
           Q+ L +G   +S +     D+K++D+SLIWNSDLVE LEL NL+  A+ TVYSA ARKES
Sbjct: 483 QEVLDEGVGMISEIRSGYKDIKINDKSLIWNSDLVEALELDNLLDQALVTVYSAAARKES 542

Query: 547 RGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAP 606
           RG+HARED+ D     R+D +W KH+L  +D   GK+ LDY+PV    L   V  + + P
Sbjct: 543 RGAHAREDYPD-----RNDGDWMKHTLSSID-EAGKVVLDYKPVTLTTLTDEV--TAVPP 594

Query: 607 KARVY 611
             RVY
Sbjct: 595 AKRVY 599


>gi|297836578|ref|XP_002886171.1| succinate dehydrogenase 1-2 [Arabidopsis lyrata subsp. lyrata]
 gi|297332011|gb|EFH62430.1| succinate dehydrogenase 1-2 [Arabidopsis lyrata subsp. lyrata]
          Length = 631

 Score =  803 bits (2075), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/609 (65%), Positives = 480/609 (78%), Gaps = 9/609 (1%)

Query: 3   NSSNLKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGG 62
           +S+  +SSYT VDH+YD VVVGAGGAGLRA +G++E GF TACITK+FPTRSHTVAAQGG
Sbjct: 32  SSTGDRSSYTIVDHTYDAVVVGAGGAGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGG 91

Query: 63  IAASLANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAG 122
           I A+L NM+ D W+WH+YDT+KGSDWLGD DAIQY+  EAP++V ELE+YG+PFSR E G
Sbjct: 92  INAALGNMSEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFSRTEEG 151

Query: 123 KIYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLII 182
           KIYQR FGG   ++G+G    R   AADRTGHA+LHTLYGQA+K+N +FF+EYFALDLI+
Sbjct: 152 KIYQRAFGGQSLDFGKGGQAYRCACAADRTGHALLHTLYGQAMKHNTQFFVEYFALDLIM 211

Query: 183 NSEGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGL 242
           NS+G C GV+A  +E G +HRF A   +LATGGYGRAYFSATSAHTCTGDG  MVARAGL
Sbjct: 212 NSDGTCQGVIALNMEDGTLHRFHAGSTILATGGYGRAYFSATSAHTCTGDGNAMVARAGL 271

Query: 243 PLQDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSR 302
           PLQD+EFVQFHPTGIYGAGCLITEGARGEGG L NS+GE+FM+RYAP+A+DLASRDVVSR
Sbjct: 272 PLQDLEFVQFHPTGIYGAGCLITEGARGEGGILRNSEGEKFMDRYAPTARDLASRDVVSR 331

Query: 303 CMMMEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPT 362
            M MEIREGRG G  KDHI+L+LNHL P VL+ERLPGISE+A IFAGVDVTR+PIPV+PT
Sbjct: 332 SMTMEIREGRGAGPMKDHIYLHLNHLPPEVLKERLPGISETAAIFAGVDVTREPIPVLPT 391

Query: 363 VHYNMGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFG 422
           VHYNMGGIPTNY GEV+     +P    PGLMA GEA CASVHGANRLG+NSL+D+VVFG
Sbjct: 392 VHYNMGGIPTNYHGEVITVRGDDPNAIVPGLMAAGEAACASVHGANRLGANSLLDIVVFG 451

Query: 423 RAAVIRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAG 482
           RA   R +E+      +  L+  +  + +   DR+R+++G +PT+ +R  MQR MQ +A 
Sbjct: 452 RACANRVAEIQKPGEKLKPLEKDAGAKSIKWLDRIRNSNGSLPTSKIRLNMQRVMQNNAA 511

Query: 483 VFRTQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEA 542
           VFRTQ++L +GC  +   WD   D+KV DRS+IWNSDL+ET+EL+NL++NA  T++SAEA
Sbjct: 512 VFRTQETLEEGCDLIDKTWDSFGDVKVTDRSMIWNSDLIETMELENLLVNACITMHSAEA 571

Query: 543 RKESRGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYS 602
           RKESRG+HAREDF       RDD NW KH+L +  W  G +KL+YRPVH   L   VD  
Sbjct: 572 RKESRGAHAREDFTK-----RDDANWMKHTLGY--WEEGNVKLEYRPVHMNTLDDEVD-- 622

Query: 603 KIAPKARVY 611
              PK RVY
Sbjct: 623 TFPPKPRVY 631


>gi|148251847|ref|YP_001236432.1| succinate dehydrogenase flavoprotein subunit [Bradyrhizobium sp.
           BTAi1]
 gi|146404020|gb|ABQ32526.1| succinate dehydrogenase subunit A [Bradyrhizobium sp. BTAi1]
          Length = 611

 Score =  803 bits (2075), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/602 (66%), Positives = 467/602 (77%), Gaps = 9/602 (1%)

Query: 10  SYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLAN 69
           +Y   DH+YDVVVVGAGGAGLRA +G +E G +TACITKVFPTRSHTVAAQGGI+ASL N
Sbjct: 19  AYPIEDHTYDVVVVGAGGAGLRAVVGCSEAGLRTACITKVFPTRSHTVAAQGGISASLGN 78

Query: 70  MTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRPF 129
           M  D W+WH+YDT+KGSDWLGD DAI+Y+   AP +VYELEH+GVPFSR E GKIYQRPF
Sbjct: 79  MHQDDWRWHMYDTVKGSDWLGDQDAIEYMVRNAPDAVYELEHWGVPFSRTEDGKIYQRPF 138

Query: 130 GGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCCV 189
           GG   ++G+    QRTCAAADRTGHA+LHT+YGQ+L++ AEFFIE+FA+DLI++ +G C 
Sbjct: 139 GGMTIDFGKSQ-AQRTCAAADRTGHAMLHTMYGQSLRHAAEFFIEFFAIDLIMDDQGVCR 197

Query: 190 GVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDMEF 249
           GV+A +L+ G +HRF A+  +LATGGYGRAY S TSAHTCTGDG GM  RAGLPLQDMEF
Sbjct: 198 GVIALKLDDGTLHRFRAQTTILATGGYGRAYASCTSAHTCTGDGGGMALRAGLPLQDMEF 257

Query: 250 VQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEIR 309
           VQFHPTGIYG+GCL+TEGARGEGGYLVN++GERFMERYAPSAKDLASRDVVSR M +EIR
Sbjct: 258 VQFHPTGIYGSGCLVTEGARGEGGYLVNAEGERFMERYAPSAKDLASRDVVSRAMTIEIR 317

Query: 310 EGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMGG 369
           EGRGVGK KDHI L+L+HLDP VL ERLPGISESA+IFA VDVTR+PIP++PTVHYNMGG
Sbjct: 318 EGRGVGKKKDHIFLHLDHLDPKVLAERLPGISESAKIFANVDVTREPIPIVPTVHYNMGG 377

Query: 370 IPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIRA 429
           IPTNY  EVL     +     PGLMA+GEA C SVHGANRLGSNSLIDLVVFGRAA +R 
Sbjct: 378 IPTNYHAEVLTKKDGDDNAIVPGLMAVGEAACVSVHGANRLGSNSLIDLVVFGRAAALRL 437

Query: 430 SEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQDS 489
           +E +  +   P L   S D  + R DR R+A G  PTA LRE MQ  MQ +  VFRT + 
Sbjct: 438 AEKLTPNGKQPDLPKDSADMALSRLDRYRYASGGTPTAKLRESMQHVMQTNCAVFRTGEV 497

Query: 490 LSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRGS 549
           L +G   +  +   + D+ V DRSL+WNSDL+ETLE  NL+  A+ T+ SA  R ESRG+
Sbjct: 498 LQEGHNLIHKVHGGIGDIAVSDRSLVWNSDLIETLEFDNLIAQAVVTMDSAANRTESRGA 557

Query: 550 HAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPKAR 609
           HAREDF D     RDD NW KH+L W+D N G+  +DYRPVH   +   V Y  I PKAR
Sbjct: 558 HAREDFPD-----RDDKNWMKHTLAWIDQN-GQTTIDYRPVHNYTMTNDVQY--IPPKAR 609

Query: 610 VY 611
           VY
Sbjct: 610 VY 611


>gi|15892093|ref|NP_359807.1| succinate dehydrogenase flavoprotein subunit [Rickettsia conorii
           str. Malish 7]
 gi|20137871|sp|Q92J97|DHSA_RICCN RecName: Full=Succinate dehydrogenase flavoprotein subunit
 gi|15619216|gb|AAL02708.1| succinate dehydrogenase flavoprotein subunit [Rickettsia conorii
           str. Malish 7]
          Length = 596

 Score =  803 bits (2074), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/605 (65%), Positives = 476/605 (78%), Gaps = 9/605 (1%)

Query: 7   LKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAAS 66
           +  +Y  + H +DVVVVGAGGAGLR+  GMA++G  TACITK+FPTRSHTVAAQGGI+A+
Sbjct: 1   MTKAYNIIHHKFDVVVVGAGGAGLRSAFGMAKEGLNTACITKLFPTRSHTVAAQGGISAA 60

Query: 67  LANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQ 126
           L NM  D W+WH+YDT+KGSDWLGD DAI+Y+   AP ++ ELEHYGVPFSR E GKIYQ
Sbjct: 61  LGNMGEDDWRWHMYDTVKGSDWLGDQDAIEYMCKNAPDAILELEHYGVPFSRTEEGKIYQ 120

Query: 127 RPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEG 186
           RPFGG    YG+G   QRTCAAADRTGHAILHTLY Q+LK+  +FF+EYFA+DL++  +G
Sbjct: 121 RPFGGMTTEYGKGKAAQRTCAAADRTGHAILHTLYQQSLKHKVQFFVEYFAIDLLM-EDG 179

Query: 187 CCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQD 246
            C GVVAW L+ G +H F A  VVLATGGYGRAYFSATSAHTCTGDG GM  RAGLPLQD
Sbjct: 180 ECRGVVAWNLDDGSLHCFRAHNVVLATGGYGRAYFSATSAHTCTGDGGGMAIRAGLPLQD 239

Query: 247 MEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMM 306
           MEFVQFHPTGIY AGCLITEGARGEGGYLVN+ GERFMERYAP+AKDLASRDVVSR M +
Sbjct: 240 MEFVQFHPTGIYSAGCLITEGARGEGGYLVNANGERFMERYAPAAKDLASRDVVSRAMTI 299

Query: 307 EIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYN 366
           EIREGRGVG+ KDH+ L+LNHL P +L  RLPGISE+A+IFAGVDVT++PIPV+PTVHYN
Sbjct: 300 EIREGRGVGEHKDHVFLHLNHLSPEILHSRLPGISETAKIFAGVDVTKEPIPVLPTVHYN 359

Query: 367 MGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAV 426
           MGGIPTNY G+V+  + KN      GLMAIGEA C SVHGANRLGSNSL+DLVVFGR++ 
Sbjct: 360 MGGIPTNYHGQVIIKDGKNHNSVVKGLMAIGEAACVSVHGANRLGSNSLLDLVVFGRSSA 419

Query: 427 IRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRT 486
           ++A+E+I  +SP  S+   S ++I++RFD++RHA+G++  A LR KMQR MQ  A VFRT
Sbjct: 420 LKAAELIKPASPHRSIKEESLEKIINRFDKVRHANGNILVAELRLKMQRTMQSHASVFRT 479

Query: 487 QDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKES 546
           Q+ L +G   +S +     D+K++D+SLIWNSDLVE LEL NL+  A+ TVYSA ARKES
Sbjct: 480 QEVLDEGAGMISEIRSGYKDIKINDKSLIWNSDLVEALELDNLLDQALVTVYSAAARKES 539

Query: 547 RGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAP 606
           RG+HARED+ D     R+D +W KH+L  +D   GK+ LDY+PV    L   V  + + P
Sbjct: 540 RGAHAREDYPD-----RNDEDWMKHTLSSID-EAGKVVLDYKPVTLTTLTDEV--TAVPP 591

Query: 607 KARVY 611
             RVY
Sbjct: 592 VKRVY 596


>gi|85714479|ref|ZP_01045467.1| succinate dehydrogenase [Nitrobacter sp. Nb-311A]
 gi|85698926|gb|EAQ36795.1| succinate dehydrogenase [Nitrobacter sp. Nb-311A]
          Length = 607

 Score =  803 bits (2074), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/602 (63%), Positives = 466/602 (77%), Gaps = 9/602 (1%)

Query: 10  SYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLAN 69
           +Y   DH+YDV+VVGAGGAGLRA +G  + G +TACITKVFPTRSHTVAAQGGI+ASL N
Sbjct: 15  AYPVEDHTYDVIVVGAGGAGLRAVVGCGQAGLRTACITKVFPTRSHTVAAQGGISASLGN 74

Query: 70  MTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRPF 129
           M  D W+WH+YDT+KGSDWLGD D I+Y+   AP++VYELEH+GVPFSR E GKIYQRPF
Sbjct: 75  MHKDDWRWHMYDTVKGSDWLGDQDCIEYMVRNAPEAVYELEHWGVPFSRTEEGKIYQRPF 134

Query: 130 GGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCCV 189
           GG   +YG+    QRTCAAADRTGHA+LHT+YGQAL+  AEFFIE+FA+DLI++ +G C 
Sbjct: 135 GGMTIDYGKSQ-AQRTCAAADRTGHAMLHTMYGQALRRAAEFFIEFFAIDLIMDDQGACR 193

Query: 190 GVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDMEF 249
           GV+A +L+ G +HRF A+  +LATGG+GR Y S TSAH CTGDG GM  RAGLPLQDMEF
Sbjct: 194 GVIALKLDDGTLHRFRAQTTILATGGFGRIYASCTSAHICTGDGGGMALRAGLPLQDMEF 253

Query: 250 VQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEIR 309
           VQFHPTGIYG+GCL+TEGARGEGGYLVN++GERFMERYAPSAKDLASRDVVSR M +EIR
Sbjct: 254 VQFHPTGIYGSGCLVTEGARGEGGYLVNAEGERFMERYAPSAKDLASRDVVSRAMTIEIR 313

Query: 310 EGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMGG 369
           EGRGVGK KDHI L+L+HLDP VL ERLPGISE+ +IFAGVDVTR+PIP++PT HYNMGG
Sbjct: 314 EGRGVGKKKDHIFLHLDHLDPKVLHERLPGISETVKIFAGVDVTREPIPIVPTAHYNMGG 373

Query: 370 IPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIRA 429
           IPTN+ GEV+   S +     PGLMA+GEA C SVHGANRLGSNSLIDLVVFGRAA  R 
Sbjct: 374 IPTNFHGEVVIKRSGDNNAVVPGLMAVGEAACVSVHGANRLGSNSLIDLVVFGRAAARRC 433

Query: 430 SEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQDS 489
           +E +  ++  P L  +S D  + R D+ R+A G  PTA LRE MQR MQ +  VFR +D+
Sbjct: 434 AEKLTPNAEQPDLPANSSDMALGRLDKFRYASGGTPTARLRENMQRVMQANCAVFRNRDT 493

Query: 490 LSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRGS 549
           L++G + +  +++  AD+ V DRSL+WN+DL+ET+E  NL+  A+ T+  A  R ESRG+
Sbjct: 494 LAEGQKLIHEVYEGSADIAVFDRSLVWNTDLMETMEYDNLISQAVVTMDCAANRTESRGA 553

Query: 550 HAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPKAR 609
           HARED+       RDD NW KH+L  +  + G   +DYRPVH   +   V Y  I PKAR
Sbjct: 554 HAREDYPQ-----RDDQNWMKHTLAGLS-DRGVTTIDYRPVHDYTMSNDVQY--IPPKAR 605

Query: 610 VY 611
           VY
Sbjct: 606 VY 607


>gi|85708847|ref|ZP_01039913.1| succinate dehydrogenase [Erythrobacter sp. NAP1]
 gi|85690381|gb|EAQ30384.1| succinate dehydrogenase [Erythrobacter sp. NAP1]
          Length = 614

 Score =  803 bits (2074), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 407/616 (66%), Positives = 470/616 (76%), Gaps = 13/616 (2%)

Query: 2   KNSSNLKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQG 61
           ++ ++LK  Y  +DH YDVVVVGAGG+GLRAT G AE G +TA I+KVFPTRSHTVAAQG
Sbjct: 6   ESGASLKGDYKIIDHMYDVVVVGAGGSGLRATTGAAEAGLRTANISKVFPTRSHTVAAQG 65

Query: 62  GIAASLANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEA 121
           GIAASL N +PD WQWH+YDT+KGSDWLGD DAI+YL  EAPQ+VYELEH GVPFSRNE 
Sbjct: 66  GIAASLGNNSPDHWQWHMYDTVKGSDWLGDQDAIEYLVREAPQAVYELEHAGVPFSRNED 125

Query: 122 GKIYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLI 181
           G IYQRPFGGHMQN GEGPPVQRTCAAADRTGHA+LH LY Q+LK +A+FFIEYFALDLI
Sbjct: 126 GTIYQRPFGGHMQNMGEGPPVQRTCAAADRTGHAMLHALYQQSLKYDADFFIEYFALDLI 185

Query: 182 ---INSEGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVA 238
              ++    CVGV+A  L+ G IHRF A+ VVLATGGYGR Y++ATSAHTCTGDG GMV 
Sbjct: 186 MAEVDGVKQCVGVMAMCLDDGTIHRFRAQSVVLATGGYGRCYYTATSAHTCTGDGGGMVL 245

Query: 239 RAGLPLQDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRD 298
           RAGLPLQDMEFVQFHPTGIYGAG LITEGARGEGGYL NS+GERFMERYAPSAKDLASRD
Sbjct: 246 RAGLPLQDMEFVQFHPTGIYGAGVLITEGARGEGGYLTNSEGERFMERYAPSAKDLASRD 305

Query: 299 VVSRCMMMEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIP 358
           VVSR M +E+REGRG G   DHIHL+L+H+DP VL ERLPGI+ES +IFAGVD+TR+ +P
Sbjct: 306 VVSRSMALEMREGRGHGADGDHIHLHLDHIDPKVLAERLPGITESGKIFAGVDLTREALP 365

Query: 359 VIPTVHYNMGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDL 418
           V PTVHYNMGGIP NY G+V+      P+   PGL A+GEA C SVHGANRLGSNSLIDL
Sbjct: 366 VTPTVHYNMGGIPCNYHGQVVTLGKDGPDTVVPGLYAVGEAACVSVHGANRLGSNSLIDL 425

Query: 419 VVFGRAAVIRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQ 478
           VVFGRA  +   E +      P L   S D  + R D  R+++G  PTAA+R  MQ+AMQ
Sbjct: 426 VVFGRATGLHLKETLKPGVSQPELAADSADFALSRVDHFRYSEGGSPTAAIRADMQKAMQ 485

Query: 479 LDAGVFRTQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVY 538
             A VFR    + +G + L+     M D+ V D+SLIWNSDL+ETLEL NLM  A  T+ 
Sbjct: 486 KHAAVFRDTALMDEGVKILAEQNKRMEDIHVTDKSLIWNSDLIETLELDNLMSQANVTIA 545

Query: 539 SAEARKESRGSHAREDFKDGEFGGRDDVNWRKHSLCWVD-W--NTGKIKLDYRPVHTELL 595
           SA  RKESRG+HA EDF D     R+D  W KH++ W + W  N G+IK+DYRPVH   L
Sbjct: 546 SAANRKESRGAHAHEDFPD-----RNDAEWMKHTIAWFEGWGGNGGEIKIDYRPVHEYTL 600

Query: 596 CGGVDYSKIAPKARVY 611
               +Y  I PKARVY
Sbjct: 601 TEDAEY--IKPKARVY 614


>gi|225430776|ref|XP_002269407.1| PREDICTED: hypothetical protein [Vitis vinifera]
 gi|297735168|emb|CBI17530.3| unnamed protein product [Vitis vinifera]
          Length = 670

 Score =  803 bits (2073), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/607 (65%), Positives = 481/607 (79%), Gaps = 9/607 (1%)

Query: 5   SNLKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIA 64
           S+  SSYT VDH+YD VVVGAGGAGLRA +G++E GF TACITK+FPTRSHTVAAQGGI 
Sbjct: 73  SSYTSSYTIVDHTYDAVVVGAGGAGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGIN 132

Query: 65  ASLANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKI 124
           A+L NMT D W+WH+YDT+KGSDWLGD DAIQY+  EAP++V ELE+YG+PFSR E G+I
Sbjct: 133 AALGNMTEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFSRTEDGRI 192

Query: 125 YQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINS 184
           YQR FGG   N+G+G    R   AADRTGHA+LHTLYGQA+K+N +FF+EYFALDL++++
Sbjct: 193 YQRAFGGQSLNFGKGGQAYRCACAADRTGHALLHTLYGQAMKHNTQFFVEYFALDLLMDN 252

Query: 185 EGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPL 244
           +G C GV+A  +E G +HRF A   +LATGGYGR YFSATSAHTCTGDG  MVARAGLPL
Sbjct: 253 DGACQGVIALNMEDGTLHRFQAASTILATGGYGRTYFSATSAHTCTGDGNAMVARAGLPL 312

Query: 245 QDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCM 304
           QD+EFVQFHPTGIYGAGCLITEG+RGEGG L NS+GERFMERYAP+AKDLASRDVVSR M
Sbjct: 313 QDLEFVQFHPTGIYGAGCLITEGSRGEGGILRNSEGERFMERYAPTAKDLASRDVVSRSM 372

Query: 305 MMEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVH 364
            MEIREGRGVG  KDHI+L+LNHL P VL+ERLPGISE+A IFAGVDVT++PIPV+PTVH
Sbjct: 373 TMEIREGRGVGPLKDHIYLHLNHLPPEVLKERLPGISETAAIFAGVDVTKEPIPVLPTVH 432

Query: 365 YNMGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRA 424
           YNMGGIPTNY GEVL     +P+   PGLMA GEA CASVHGANRLG+NSL+D+VVFGRA
Sbjct: 433 YNMGGIPTNYHGEVLTIKGNDPDAVVPGLMAAGEAACASVHGANRLGANSLLDIVVFGRA 492

Query: 425 AVIRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVF 484
              R +E+         L+  S ++ +   D+LR+++G +PT+ +R  MQR MQ +A VF
Sbjct: 493 CANRVAEIHKPGEKQKPLEKDSGEKTIAWLDKLRNSNGSIPTSKIRLNMQRVMQNNAAVF 552

Query: 485 RTQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARK 544
           RTQ++L +GC+ +   W+   D+++ DRSLIWNSDL ET+EL+NL+INA  T++SAEARK
Sbjct: 553 RTQETLEEGCKLIDKAWESFHDVQLKDRSLIWNSDLSETIELENLLINACITMHSAEARK 612

Query: 545 ESRGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKI 604
           ESRG+HAREDF       RDD NW +H+L +  W   K++LDYRPVH   L   ++   I
Sbjct: 613 ESRGAHAREDFTK-----RDDENWIRHTLGY--WENEKVRLDYRPVHMNPLDDEIE--SI 663

Query: 605 APKARVY 611
            PKARVY
Sbjct: 664 PPKARVY 670


>gi|168019279|ref|XP_001762172.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162686576|gb|EDQ72964.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 595

 Score =  803 bits (2073), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/603 (65%), Positives = 475/603 (78%), Gaps = 9/603 (1%)

Query: 9   SSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLA 68
            SY  VDH+YD +VVGAGGAGLRA +G++E GF TACITK+FPTRSHTVAAQGGI A+L 
Sbjct: 2   QSYPLVDHTYDAIVVGAGGAGLRAAIGLSESGFNTACITKLFPTRSHTVAAQGGINAALG 61

Query: 69  NMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRP 128
           NMT D W+WH+YDT+KGSDWLGD DAIQY+  EAP++V ELE+YG+PFSR E GKIYQR 
Sbjct: 62  NMTEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFSRTEEGKIYQRA 121

Query: 129 FGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCC 188
           FGG   N+G+G    R  AAADRTGHA+LHTLYGQA+K+N +FF+EYFALDLI++ EG C
Sbjct: 122 FGGQSLNFGKGGQAYRCAAAADRTGHAMLHTLYGQAMKHNTQFFVEYFALDLIMDDEGAC 181

Query: 189 VGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDME 248
            GV A  +E G +HRF A   +LATGGYGRAYFSATSAHTCTGDG  M ARAGLPLQD+E
Sbjct: 182 RGVTALNMEDGTLHRFRAANTILATGGYGRAYFSATSAHTCTGDGNAMAARAGLPLQDLE 241

Query: 249 FVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEI 308
           FVQFHPTGIYGAGCLITEG+RGEGG L NS+GERFMERYAP+AKDLASRDVVSR M MEI
Sbjct: 242 FVQFHPTGIYGAGCLITEGSRGEGGILRNSEGERFMERYAPTAKDLASRDVVSRSMTMEI 301

Query: 309 REGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMG 368
           REGRGVG  KDHI+L+LNHL P VL+ERLPGISE+A IFAGVDVT++PIPV+PTVHYNMG
Sbjct: 302 REGRGVGPEKDHIYLHLNHLPPEVLKERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMG 361

Query: 369 GIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIR 428
           GIPTN+ GEV+     +P+   PGLMA GEA CASVHGANRLG+NSL+D+VVFGRA   R
Sbjct: 362 GIPTNHHGEVVTKKGNDPDCMIPGLMAAGEAACASVHGANRLGANSLLDIVVFGRACANR 421

Query: 429 ASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQD 488
            +E        P L   + ++ +   D+LR+A+G +PT+ +R +MQR MQ +A VFRTQ+
Sbjct: 422 VAEKFKPGQSQPELPKDAGEKTIAWLDKLRYANGDLPTSEIRNRMQRTMQNNAAVFRTQE 481

Query: 489 SLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRG 548
           +L +GC+ +    D  + +K++DRSL WN+DL+ET+EL+NL+INA  T++SAEARKESRG
Sbjct: 482 TLEEGCKLIDETVDSFSRVKINDRSLTWNTDLIETIELENLLINASITMHSAEARKESRG 541

Query: 549 SHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPKA 608
           +HAREDF       RDD  W KH+L +  W+  ++KLDYRPVH   L   V+     PKA
Sbjct: 542 AHAREDFS-----VRDDEKWMKHTLGF--WDENRVKLDYRPVHMNTLDDEVE--TFPPKA 592

Query: 609 RVY 611
           RVY
Sbjct: 593 RVY 595


>gi|15240075|ref|NP_201477.1| SDH1-1; ATP binding / succinate dehydrogenase [Arabidopsis
           thaliana]
 gi|20454872|sp|O82663|DHSA1_ARATH RecName: Full=Succinate dehydrogenase [ubiquinone] flavoprotein
           subunit 1, mitochondrial; AltName: Full=Flavoprotein
           subunit 1 of complex II; Short=FP; Flags: Precursor
 gi|13605885|gb|AAK32928.1|AF367341_1 AT5g66760/MSN2_16 [Arabidopsis thaliana]
 gi|16930699|gb|AAL32015.1|AF436833_1 AT5g66760/MSN2_16 [Arabidopsis thaliana]
 gi|3660471|emb|CAA05025.1| succinate dehydrogenase flavoprotein alpha subunit [Arabidopsis
           thaliana]
 gi|8843734|dbj|BAA97282.1| succinate dehydrogenase flavoprotein alpha subunit [Arabidopsis
           thaliana]
 gi|15010746|gb|AAK74032.1| AT5g66760/MSN2_16 [Arabidopsis thaliana]
 gi|21700795|gb|AAM70521.1| AT5g66760/MSN2_16 [Arabidopsis thaliana]
 gi|332010877|gb|AED98260.1| succinate dehydrogenase [ubiquinone] flavoprotein subunit 1
           [Arabidopsis thaliana]
          Length = 634

 Score =  802 bits (2072), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/608 (65%), Positives = 483/608 (79%), Gaps = 9/608 (1%)

Query: 4   SSNLKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGI 63
           S++ +SSYT VDH+YD VVVGAGGAGLRA +G++E GF TACITK+FPTRSHTVAAQGGI
Sbjct: 36  STDTRSSYTIVDHTYDAVVVGAGGAGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGI 95

Query: 64  AASLANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGK 123
            A+L NM+ D W+WH+YDT+KGSDWLGD DAIQY+  EAP++V ELE+YG+PFSR E GK
Sbjct: 96  NAALGNMSEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFSRTEEGK 155

Query: 124 IYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIIN 183
           IYQR FGG   ++G+G    R   AADRTGHA+LHTLYGQA+K+N +FF+EYFALDL++ 
Sbjct: 156 IYQRAFGGQSLDFGKGGQAYRCACAADRTGHALLHTLYGQAMKHNTQFFVEYFALDLLMA 215

Query: 184 SEGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLP 243
           S+G C GV+A  +E G +HRF +   +LATGGYGRAYFSATSAHTCTGDG  MVARAGLP
Sbjct: 216 SDGSCQGVIALNMEDGTLHRFRSSQTILATGGYGRAYFSATSAHTCTGDGNAMVARAGLP 275

Query: 244 LQDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRC 303
           LQD+EFVQFHPTGIYGAGCLITEG+RGEGG L NS+GERFMERYAP+AKDLASRDVVSR 
Sbjct: 276 LQDLEFVQFHPTGIYGAGCLITEGSRGEGGILRNSEGERFMERYAPTAKDLASRDVVSRS 335

Query: 304 MMMEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTV 363
           M MEIREGRGVG  KDHI+L+LNHL P VL+ERLPGISE+A IFAGVDVT++PIPV+PTV
Sbjct: 336 MTMEIREGRGVGPHKDHIYLHLNHLPPEVLKERLPGISETAAIFAGVDVTKEPIPVLPTV 395

Query: 364 HYNMGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGR 423
           HYNMGGIPTNY GEV+     +P+   PGLMA GEA CASVHGANRLG+NSL+D+VVFGR
Sbjct: 396 HYNMGGIPTNYHGEVVTIKGDDPDAVIPGLMAAGEAACASVHGANRLGANSLLDIVVFGR 455

Query: 424 AAVIRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGV 483
           A   R +E+         L+  + ++ +   DRLR+++G +PT+ +R  MQR MQ +A V
Sbjct: 456 ACANRVAEISKPGEKQKPLEKDAGEKTIAWLDRLRNSNGSLPTSTIRLNMQRIMQNNAAV 515

Query: 484 FRTQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEAR 543
           FRTQ++L +GC+ +   W+   D++V DRS+IWNSDL+ETLEL+NL+INA  T++SAEAR
Sbjct: 516 FRTQETLEEGCQLIDKAWESFGDVQVKDRSMIWNSDLIETLELENLLINASITMHSAEAR 575

Query: 544 KESRGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSK 603
           KESRG+HAREDF       R+D  W KH+L +  W   K++LDYRPVH + L   +D   
Sbjct: 576 KESRGAHAREDFTK-----REDGEWMKHTLGY--WEDEKVRLDYRPVHMDTLDDEID--T 626

Query: 604 IAPKARVY 611
             PKARVY
Sbjct: 627 FPPKARVY 634


>gi|6649876|gb|AAF21611.1|AF018287_5 SdhA [papaya bunchy top disease rickettsia]
          Length = 596

 Score =  802 bits (2071), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/605 (65%), Positives = 473/605 (78%), Gaps = 9/605 (1%)

Query: 7   LKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAAS 66
           +  SY  + H +DV+VVGAGGAGLRA  GMA++G  TACI+K+FPTRSHTVAAQGGI+A+
Sbjct: 1   MTKSYNIIHHKFDVIVVGAGGAGLRAAFGMAKEGLNTACISKLFPTRSHTVAAQGGISAA 60

Query: 67  LANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQ 126
           L NM  D W+WH+YDT+KGSDWLGD DAI+Y+   AP ++ ELEHYGVPFSR E GKIYQ
Sbjct: 61  LGNMGADDWRWHMYDTVKGSDWLGDQDAIEYMCKNAPDAILELEHYGVPFSRTEEGKIYQ 120

Query: 127 RPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEG 186
           RPFGG    YG+G   QRTCAAADRTGHAILHTLY Q+LK+  +FFIEYFA+DL++  +G
Sbjct: 121 RPFGGMTTEYGKGKAAQRTCAAADRTGHAILHTLYQQSLKHKVQFFIEYFAIDLLME-DG 179

Query: 187 CCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQD 246
            C GVVAW L+ G +H F A  VVLATGGYGRAYFSATSAHTCTGDG GM  RAGLPLQD
Sbjct: 180 ECRGVVAWNLDDGSLHCFRAHNVVLATGGYGRAYFSATSAHTCTGDGGGMAIRAGLPLQD 239

Query: 247 MEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMM 306
           MEFVQFHPTGIY AGCLITEGARGEGGYLVN+ GERFMERYAP+AKDLASRDVVSR M +
Sbjct: 240 MEFVQFHPTGIYSAGCLITEGARGEGGYLVNANGERFMERYAPAAKDLASRDVVSRAMTI 299

Query: 307 EIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYN 366
           EIREGRGVG+ KDH+ L+LNHL P +L  RLPGISE+A+IFAGVDVT++PIPV+PTVHYN
Sbjct: 300 EIREGRGVGEHKDHVFLHLNHLSPEILHSRLPGISETAKIFAGVDVTKEPIPVLPTVHYN 359

Query: 367 MGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAV 426
           MGGIPTNY G+V+  + KN      GLM+IGEA C SVHGANRLGSNSL+DLVVFGR+A 
Sbjct: 360 MGGIPTNYHGQVIIKDGKNHNSVVKGLMSIGEAACVSVHGANRLGSNSLLDLVVFGRSAA 419

Query: 427 IRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRT 486
           ++A+E+I  +SP   +   + ++I+ RFD++RH+ G++  A LR KMQR MQ  A VFRT
Sbjct: 420 LKAAELIKPASPHKPVSEEALEKIVSRFDKIRHSSGNISVADLRLKMQRTMQSHASVFRT 479

Query: 487 QDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKES 546
           Q+ L++G + +S +     D+K++DRSLIWNSDLVE LEL NL+  A+ TVYSA ARKES
Sbjct: 480 QEVLNEGAKMISEIRSSYKDIKINDRSLIWNSDLVEALELDNLLDQALVTVYSAAARKES 539

Query: 547 RGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAP 606
           RG+HARED+ D     R+D  W +H+L  VD   GK+ LDY+PV    L   V    + P
Sbjct: 540 RGAHAREDYPD-----RNDKEWMQHTLSGVD-EAGKVVLDYKPVTLTTLSDEV--KAVPP 591

Query: 607 KARVY 611
             RVY
Sbjct: 592 AKRVY 596


>gi|15224174|ref|NP_179435.1| SDH1-2; succinate dehydrogenase [Arabidopsis thaliana]
 gi|75216119|sp|Q9ZPX5|DHSA2_ARATH RecName: Full=Succinate dehydrogenase [ubiquinone] flavoprotein
           subunit 2, mitochondrial; AltName: Full=Flavoprotein
           subunit 2 of complex II; Short=FP; Flags: Precursor
 gi|4309723|gb|AAD15493.1| putative succinate dehydrogenase flavoprotein subunit [Arabidopsis
           thaliana]
 gi|26453278|dbj|BAC43712.1| putative succinate dehydrogenase flavoprotein subunit [Arabidopsis
           thaliana]
 gi|29028988|gb|AAO64873.1| At2g18450 [Arabidopsis thaliana]
 gi|330251675|gb|AEC06769.1| succinate dehydrogenase [ubiquinone] flavoprotein subunit 2
           [Arabidopsis thaliana]
          Length = 632

 Score =  802 bits (2071), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/608 (65%), Positives = 481/608 (79%), Gaps = 9/608 (1%)

Query: 4   SSNLKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGI 63
           S+  KSSYT VDH+YD VVVGAGGAGLRA +G++E GF TACITK+FPTRSHTVAAQGGI
Sbjct: 34  SAGDKSSYTIVDHTYDAVVVGAGGAGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGI 93

Query: 64  AASLANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGK 123
            A+L NM+ D W+WH+YDT+KGSDWLGD DAIQY+  EAP++V ELE+YG+PFSR E GK
Sbjct: 94  NAALGNMSVDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFSRTEDGK 153

Query: 124 IYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIIN 183
           IYQR FGG    +G G    R   AADRTGHA+LHTLYGQA+K+N +FF+EYFALDLI+N
Sbjct: 154 IYQRAFGGQSLEFGIGGQAYRCACAADRTGHALLHTLYGQAMKHNTQFFVEYFALDLIMN 213

Query: 184 SEGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLP 243
           S+G C GV+A  +E G +HRF A   +LATGGYGRAYFSATSAHTCTGDG  MVARAGLP
Sbjct: 214 SDGTCQGVIALNMEDGTLHRFHAGSTILATGGYGRAYFSATSAHTCTGDGNAMVARAGLP 273

Query: 244 LQDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRC 303
           LQD+EFVQFHPTGIYGAGCLITEGARGEGG L NS+GE+FM+RYAP+A+DLASRDVVSR 
Sbjct: 274 LQDLEFVQFHPTGIYGAGCLITEGARGEGGILRNSEGEKFMDRYAPTARDLASRDVVSRS 333

Query: 304 MMMEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTV 363
           M MEIR+GRG G  KD+++LYLNHL P VL+ERLPGISE+A IFAGVDVTR+PIPV+PTV
Sbjct: 334 MTMEIRQGRGAGPMKDYLYLYLNHLPPEVLKERLPGISETAAIFAGVDVTREPIPVLPTV 393

Query: 364 HYNMGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGR 423
           HYNMGGIPTNY GEV+     +P+   PGLMA GEA CASVHGANRLG+NSL+D+VVFGR
Sbjct: 394 HYNMGGIPTNYHGEVITLRGDDPDAVVPGLMAAGEAACASVHGANRLGANSLLDIVVFGR 453

Query: 424 AAVIRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGV 483
           A   R +E+      +  L+  + ++ ++  DR+R+++G +PT+ +R  MQR MQ +A V
Sbjct: 454 ACANRVAEIQKPGEKLKPLEKDAGEKSIEWLDRIRNSNGSLPTSKIRLNMQRVMQNNAAV 513

Query: 484 FRTQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEAR 543
           FRTQ++L +GC  +   WD   D+KV DRS+IWNSDL+ET+EL+NL++NA  T++SAEAR
Sbjct: 514 FRTQETLEEGCDLIDKTWDSFGDVKVTDRSMIWNSDLIETMELENLLVNACITMHSAEAR 573

Query: 544 KESRGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSK 603
           KESRG+HAREDF       RDD NW KH+L +  W  G +KL+YRPVH + L   VD   
Sbjct: 574 KESRGAHAREDFTK-----RDDANWMKHTLGY--WEEGNVKLEYRPVHMKTLDDEVD--T 624

Query: 604 IAPKARVY 611
             PK RVY
Sbjct: 625 FPPKPRVY 632


>gi|209883446|ref|YP_002287303.1| succinate dehydrogenase flavoprotein subunit [Oligotropha
           carboxidovorans OM5]
 gi|209871642|gb|ACI91438.1| succinate dehydrogenase flavoprotein subunit [Oligotropha
           carboxidovorans OM5]
          Length = 604

 Score =  802 bits (2071), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/602 (65%), Positives = 474/602 (78%), Gaps = 9/602 (1%)

Query: 10  SYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLAN 69
           +Y   DH+YDVVVVGAGGAGLRA +G +E G +TACITKVFPTRSHTVAAQGGI+ASL N
Sbjct: 12  AYPIEDHTYDVVVVGAGGAGLRAVVGCSEAGLRTACITKVFPTRSHTVAAQGGISASLGN 71

Query: 70  MTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRPF 129
           M PD W+WH+YDT+KGSDWLGD D I+Y+   AP++VYELEH+GVPFSR E GKI+QRPF
Sbjct: 72  MHPDDWRWHMYDTVKGSDWLGDQDCIEYMVRNAPEAVYELEHWGVPFSRTEDGKIFQRPF 131

Query: 130 GGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCCV 189
           GG  ++YG+G   QRTCAAADRTGHA+LHT+YGQA++++AEFFIE+FA+DLI++ +G C 
Sbjct: 132 GGMTRDYGKGQ-AQRTCAAADRTGHAMLHTMYGQAVRHSAEFFIEFFAIDLIMDDQGVCR 190

Query: 190 GVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDMEF 249
           G +A +L+ G +HRF A+  +LATGGYGRAY S TSAHTCTGDG GMV RAGLPLQDMEF
Sbjct: 191 GAIALKLDDGTLHRFRAQTTILATGGYGRAYLSCTSAHTCTGDGGGMVLRAGLPLQDMEF 250

Query: 250 VQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEIR 309
           VQFHPTGI+ AGCLITEGARGEGGYLVN++GERFMERYAPSAKDLASRDVVSR M +EIR
Sbjct: 251 VQFHPTGIFPAGCLITEGARGEGGYLVNAEGERFMERYAPSAKDLASRDVVSRAMTIEIR 310

Query: 310 EGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMGG 369
           EGRGVGK KDH+ L+L+HLDPAVL +RLPGISESARIFAGVDVTR+PIPV+PTVHYNMGG
Sbjct: 311 EGRGVGKRKDHMFLHLDHLDPAVLHDRLPGISESARIFAGVDVTREPIPVLPTVHYNMGG 370

Query: 370 IPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIRA 429
           IPTN+ GEV+     + +   PGLMA+GEA C SVHGANRLGSNSLIDLVVFGR+A +R 
Sbjct: 371 IPTNFHGEVVVKKRGDDDAVVPGLMAVGEAACVSVHGANRLGSNSLIDLVVFGRSAALRC 430

Query: 430 SEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQDS 489
           +E +  +   P L   S ++ + R D  R+A G  PTA LR+ MQR MQ +  VFRT + 
Sbjct: 431 AEKLTPNGKQPELPADSAEKALARLDHFRYASGGTPTAKLRDSMQRVMQNNCAVFRTGEV 490

Query: 490 LSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRGS 549
           L +G   +  +   + D+ V DRSLIWN+DLVETLE  NL+I A+ T+ SA  R ESRG+
Sbjct: 491 LHEGKDLIHKVHSGLTDISVTDRSLIWNTDLVETLEFDNLIIQAVVTMESAVNRTESRGA 550

Query: 550 HAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPKAR 609
           HAREDF +     RDD NW KH+L W+D       +DYRPVH+  +   + Y  I PKAR
Sbjct: 551 HAREDFPE-----RDDKNWMKHTLAWID-PKANTTIDYRPVHSYTMTNDIQY--IPPKAR 602

Query: 610 VY 611
           VY
Sbjct: 603 VY 604


>gi|90421598|ref|YP_529968.1| succinate dehydrogenase flavoprotein subunit [Rhodopseudomonas
           palustris BisB18]
 gi|90103612|gb|ABD85649.1| succinate dehydrogenase subunit A [Rhodopseudomonas palustris
           BisB18]
          Length = 607

 Score =  801 bits (2070), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/602 (66%), Positives = 473/602 (78%), Gaps = 9/602 (1%)

Query: 10  SYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLAN 69
           +Y   DHSYDVVVVGAGGAGLRA +G +E G +TACITKVFPTRSHTVAAQGGI+A+L N
Sbjct: 15  AYPIEDHSYDVVVVGAGGAGLRAVVGCSEAGLRTACITKVFPTRSHTVAAQGGISAALGN 74

Query: 70  MTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRPF 129
           M  D W+WH+YDT+KGSDWLGD D+I+Y+   APQ+VYELEH+GVPFSR + GKIYQRPF
Sbjct: 75  MHKDDWRWHMYDTVKGSDWLGDQDSIEYMVRNAPQAVYELEHWGVPFSRTDDGKIYQRPF 134

Query: 130 GGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCCV 189
           GG   +YG+G   QRTCAAADRTGHA+LHT+YGQAL+++AEF+IE+FA+DLI++ +G C 
Sbjct: 135 GGMTLDYGKGQ-AQRTCAAADRTGHAMLHTMYGQALRHSAEFYIEFFAIDLIMDDQGVCR 193

Query: 190 GVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDMEF 249
           GV+A +L+ G +HRF A+  +LATGGYGRAY S TSAHTCTGDG  M  RAG+PLQDMEF
Sbjct: 194 GVIALKLDDGTLHRFKAQTTILATGGYGRAYASCTSAHTCTGDGGAMALRAGVPLQDMEF 253

Query: 250 VQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEIR 309
           VQFHPTGIYG+GCL+TEGARGEGGYLVNS+GERFMERYAPSAKDLASRDVVSR M +EIR
Sbjct: 254 VQFHPTGIYGSGCLVTEGARGEGGYLVNSEGERFMERYAPSAKDLASRDVVSRAMTIEIR 313

Query: 310 EGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMGG 369
           EGRGVGK KDHI L+L+HLDP VL ERLPGISESARIFAGVDVTR+PIP+IPTVHYNMGG
Sbjct: 314 EGRGVGKKKDHIFLHLDHLDPKVLHERLPGISESARIFAGVDVTREPIPMIPTVHYNMGG 373

Query: 370 IPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIRA 429
           IPTNY GEV+     +      GLMA+GEA C SVHGANRLGSNSLIDLVVFGRAA +R 
Sbjct: 374 IPTNYHGEVVTKKDGDDNAVVHGLMALGEAACVSVHGANRLGSNSLIDLVVFGRAAALRC 433

Query: 430 SEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQDS 489
           +E +  +   P L   S ++ + R DR R+A G  PTA LRE MQ  MQ +  VFRT + 
Sbjct: 434 AEKLTPNGKQPELPADSAEQSLTRLDRYRYASGGTPTARLRENMQHVMQNNCAVFRTGEV 493

Query: 490 LSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRGS 549
           L +G   +  +   ++D+ V DRSLIWNSDL+ETLE  NL++ A+ T+ SA  R ESRG+
Sbjct: 494 LQEGKGLIHNVHSGISDIHVTDRSLIWNSDLIETLEFDNLIVQAVVTMDSAANRTESRGA 553

Query: 550 HAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPKAR 609
           HAREDF       RDD NW KH+L W+D ++G+  +DYRPVH   +   V Y  I PKAR
Sbjct: 554 HAREDFS-----ARDDKNWMKHTLAWMD-HSGETTIDYRPVHDYTMTNDVQY--IPPKAR 605

Query: 610 VY 611
           VY
Sbjct: 606 VY 607


>gi|297183593|gb|ADI19720.1| hypothetical protein [uncultured bacterium EB000_36F02]
          Length = 591

 Score =  801 bits (2069), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/603 (63%), Positives = 465/603 (77%), Gaps = 13/603 (2%)

Query: 9   SSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLA 68
           SSY  +DH YDVVV+GAGG+GLRA +G++E G KTACI+KVFPTRSHT AAQGGI+A+L 
Sbjct: 2   SSYKIIDHEYDVVVLGAGGSGLRAAVGLSETGLKTACISKVFPTRSHTSAAQGGISAALG 61

Query: 69  NMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRP 128
           NM  D W+WH+YDT+KG+DWLGD D I+YL  EAP++V ELE YGVPFSR E GKIYQR 
Sbjct: 62  NMGEDDWRWHMYDTVKGADWLGDQDCIEYLCKEAPRAVIELERYGVPFSRTEDGKIYQRR 121

Query: 129 FGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCC 188
           FGG  +NYG+G   QRTCAAADRTGHAILHTLYGQALK+N EFFIEYFALDL++  +G C
Sbjct: 122 FGGMTKNYGKGT-AQRTCAAADRTGHAILHTLYGQALKHNTEFFIEYFALDLLMK-DGEC 179

Query: 189 VGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDME 248
            GV+AW L+ G IHRF + + ++ATGGYG+ Y+S+TSAHTCTGDG  M+ RAGLPLQDME
Sbjct: 180 KGVIAWNLDDGTIHRFRSHITIIATGGYGKIYYSSTSAHTCTGDGNAMILRAGLPLQDME 239

Query: 249 FVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEI 308
           FVQFHPTGIYG G LI+EG RGEGGYLVNSKGERFMERYAP  KDLASRDVVSR + +EI
Sbjct: 240 FVQFHPTGIYGHGTLISEGVRGEGGYLVNSKGERFMERYAPKTKDLASRDVVSRSIAIEI 299

Query: 309 REGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMG 368
            EGRGVGK +DH+HL+L+HLDP V++E+LPGISES+R+FA VDVT++PIPV+PTVHYNMG
Sbjct: 300 NEGRGVGKEQDHVHLHLSHLDPKVIEEKLPGISESSRLFANVDVTKEPIPVVPTVHYNMG 359

Query: 369 GIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIR 428
           GIPTNY  EV+  N    E+  PGLMAIGEA C SVHGANRLGSNSLIDLVVFGRAA  R
Sbjct: 360 GIPTNYKAEVMTVNGS--EKTVPGLMAIGEAACVSVHGANRLGSNSLIDLVVFGRAAAKR 417

Query: 429 ASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQD 488
           A+E++   +P   +  +  ++ ++RFD+LR+A+G   TA LR  MQ+ MQL   VFRT  
Sbjct: 418 AAELVKPGTPHEKISETETEKCLERFDKLRNANGENKTADLRLSMQKTMQLKCAVFRTDK 477

Query: 489 SLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRG 548
           +L +G   +   +D M  + V D+SLI+N+DLVETLE  NL+  AI T+ SA  RKESRG
Sbjct: 478 TLKEGVNEIRKPFDSMESISVKDKSLIYNTDLVETLEFDNLIRQAITTMDSAYQRKESRG 537

Query: 549 SHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPKA 608
           +HAR+DF       RDD  + KH+L W      + K++YRPVH   L   V Y    P+ 
Sbjct: 538 AHARDDFPK-----RDDEKFMKHTLSWCYGK--ETKIEYRPVHKTTLTSDVQY--FPPQE 588

Query: 609 RVY 611
           RVY
Sbjct: 589 RVY 591


>gi|165932741|ref|YP_001649530.1| succinate dehydrogenase flavoprotein subunit [Rickettsia rickettsii
           str. Iowa]
 gi|165907828|gb|ABY72124.1| succinate dehydrogenase flavoprotein subunit [Rickettsia rickettsii
           str. Iowa]
          Length = 596

 Score =  801 bits (2069), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/605 (65%), Positives = 474/605 (78%), Gaps = 9/605 (1%)

Query: 7   LKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAAS 66
           +  +Y  V H +DVVVVGAGGAGLR+  GMA+ G  TACITK+FPTRSHTVAAQGGI+A+
Sbjct: 1   MTKAYNIVHHKFDVVVVGAGGAGLRSAFGMAKAGLNTACITKLFPTRSHTVAAQGGISAA 60

Query: 67  LANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQ 126
           L NM  D W+WH+YDT+KGSDWLGD DAI+Y+   AP ++ ELEHYGVPFSR E GKIYQ
Sbjct: 61  LGNMGEDDWRWHMYDTVKGSDWLGDQDAIEYMCKNAPDAILELEHYGVPFSRTEEGKIYQ 120

Query: 127 RPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEG 186
           RPFGG    YG+G   QRTCAAADRTGHAILHTLY Q+LK+  +FF+EYFA+DL++  +G
Sbjct: 121 RPFGGMTTEYGKGKAAQRTCAAADRTGHAILHTLYQQSLKHKVQFFVEYFAIDLLME-DG 179

Query: 187 CCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQD 246
            C GVVAW L+ G +H F A  VVLATGGYGRAYFSATSAHTCTGDG GM  RA LPLQD
Sbjct: 180 ECRGVVAWNLDDGSLHCFRAHNVVLATGGYGRAYFSATSAHTCTGDGGGMAIRAALPLQD 239

Query: 247 MEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMM 306
           MEFVQFHPTGIY AGCLITEGARGEGGYLVN+ GERFMERYAP+AKDLASRDVVSR M +
Sbjct: 240 MEFVQFHPTGIYSAGCLITEGARGEGGYLVNANGERFMERYAPAAKDLASRDVVSRAMTI 299

Query: 307 EIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYN 366
           EIREGRGVG+ KDH+ L+LNHL   +L  RLPGISE+A+IFAGVDVT++PIPV+PTVHYN
Sbjct: 300 EIREGRGVGEHKDHVFLHLNHLSSEILHSRLPGISETAKIFAGVDVTKEPIPVLPTVHYN 359

Query: 367 MGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAV 426
           MGGIPTNY+G+V+  + KN      GLMAIGEA C SVHGANRLGSNSL+DLVVFGR++ 
Sbjct: 360 MGGIPTNYYGQVIIKDGKNHNSVVKGLMAIGEAACVSVHGANRLGSNSLLDLVVFGRSSA 419

Query: 427 IRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRT 486
           ++A+E+I  +SP  S+   S ++I++RFD++RHA+G++  A LR KMQR MQ  A VFRT
Sbjct: 420 LKAAELIKPASPHKSIKEESLEKIINRFDKVRHANGNILVAELRLKMQRTMQSHASVFRT 479

Query: 487 QDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKES 546
           Q+ L +G   +S +     D+K++D+SLIWNSDLVE LEL NL+  A+ TVYSA ARKES
Sbjct: 480 QELLDEGAGMISEIRSGYKDIKINDKSLIWNSDLVEALELDNLLDQALVTVYSAAARKES 539

Query: 547 RGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAP 606
           RG+HARED+ D     R+D +W KH+L  +D   GK+ LDY+PV    L   V  + + P
Sbjct: 540 RGAHAREDYPD-----RNDEDWMKHTLSSID-EAGKVVLDYKPVTLTTLTDEV--TAVPP 591

Query: 607 KARVY 611
             RVY
Sbjct: 592 VKRVY 596


>gi|224094759|ref|XP_002310225.1| predicted protein [Populus trichocarpa]
 gi|222853128|gb|EEE90675.1| predicted protein [Populus trichocarpa]
          Length = 633

 Score =  801 bits (2069), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/604 (65%), Positives = 479/604 (79%), Gaps = 9/604 (1%)

Query: 8   KSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASL 67
           +SSYT VDH+YD VVVGAGGAGLRA +G++E GF TACITK+FPTRSHTVAAQGGI A+L
Sbjct: 39  RSSYTVVDHTYDAVVVGAGGAGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAAL 98

Query: 68  ANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQR 127
            NMT D W+WH+YDT+KGSDWLGD DAIQY+  EAP++V ELE+YG+PFSR E GKIYQR
Sbjct: 99  GNMTEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFSRTEDGKIYQR 158

Query: 128 PFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGC 187
            FGG   ++G+G    R   AADRTGHA+LHTLYGQA+K+N +FF+EYFALDLI+N++G 
Sbjct: 159 AFGGQSLDFGKGGQAYRCACAADRTGHALLHTLYGQAMKHNTQFFVEYFALDLIMNNDGI 218

Query: 188 CVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDM 247
           C GV+A  +E G +HRF A   +LATGGYGR YFSATSAHTCTGDG  MVARAG+PL+D+
Sbjct: 219 CQGVIALNMEDGTLHRFRAASTILATGGYGRTYFSATSAHTCTGDGNAMVARAGIPLEDL 278

Query: 248 EFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMME 307
           EFVQFHPTGIYGAGCLITEG+RGEGG L NS+GERFMERYAP+AKDLASRDVVSR M ME
Sbjct: 279 EFVQFHPTGIYGAGCLITEGSRGEGGILRNSEGERFMERYAPTAKDLASRDVVSRSMTME 338

Query: 308 IREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNM 367
           IREGRGVG  KDHI+L+LNHL P VL+ERLPGISE+A IFAGVDVT++PIPV+PTVHYNM
Sbjct: 339 IREGRGVGPLKDHIYLHLNHLPPDVLKERLPGISETAAIFAGVDVTKEPIPVLPTVHYNM 398

Query: 368 GGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVI 427
           GGIPTNY GEV+     +P+   PGLMA GEA CASVHGANRLG+NSL+D+VVFGRA   
Sbjct: 399 GGIPTNYHGEVVTIKGDDPDAVIPGLMAAGEAACASVHGANRLGANSLLDIVVFGRACAN 458

Query: 428 RASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQ 487
           R +E+         L+  + +R + R D+LR+++G +PT+ +R  MQR MQ +A VFRTQ
Sbjct: 459 RVAEIHRPGKLNKPLEKDAGERTIARLDKLRNSNGSIPTSQIRLNMQRIMQSNAAVFRTQ 518

Query: 488 DSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESR 547
           ++L +GC  +   W+   D+KV DRSLIWNSDL+ET+EL+NL+INA  T++SAEARKESR
Sbjct: 519 ETLEEGCHLIDKAWESFHDVKVKDRSLIWNSDLIETVELENLLINACITMHSAEARKESR 578

Query: 548 GSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPK 607
           G+HAREDF       RDD  W KH+L +  W   K++LDYRPVH   L   V+     PK
Sbjct: 579 GAHAREDFTK-----RDDEKWMKHTLGY--WEKEKVRLDYRPVHMNTLDDEVE--TFPPK 629

Query: 608 ARVY 611
           ARVY
Sbjct: 630 ARVY 633


>gi|316931811|ref|YP_004106793.1| succinate dehydrogenase, flavoprotein subunit [Rhodopseudomonas
           palustris DX-1]
 gi|315599525|gb|ADU42060.1| succinate dehydrogenase, flavoprotein subunit [Rhodopseudomonas
           palustris DX-1]
          Length = 607

 Score =  801 bits (2068), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/601 (65%), Positives = 471/601 (78%), Gaps = 9/601 (1%)

Query: 11  YTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLANM 70
           Y   DH+YDVVVVGAGGAGLRA +G +E G +TACITKVFPTRSHTVAAQGGI+ASL NM
Sbjct: 16  YPIEDHTYDVVVVGAGGAGLRAVVGCSEAGLRTACITKVFPTRSHTVAAQGGISASLGNM 75

Query: 71  TPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRPFG 130
             D W+WH+YDT+KGSDWLGD D+I+Y+   AP++VYELEH+GVPFSR E GKIYQRPFG
Sbjct: 76  HKDDWRWHMYDTVKGSDWLGDQDSIEYMVRNAPEAVYELEHWGVPFSRTEDGKIYQRPFG 135

Query: 131 GHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCCVG 190
           G    +G+G   QRTCAAADRTGHA+LHT+YGQAL+++AEF+IE+FA+DLI++ +GCC G
Sbjct: 136 GMTMEFGKGQ-AQRTCAAADRTGHAMLHTMYGQALRHSAEFYIEFFAIDLIMDDQGCCRG 194

Query: 191 VVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDMEFV 250
           VVA +L+ G IHRF A+  +LATGGYGRAY S TSAHTCTGDG  M  RAGLPLQDMEFV
Sbjct: 195 VVALKLDDGTIHRFKAQTTILATGGYGRAYASCTSAHTCTGDGGAMALRAGLPLQDMEFV 254

Query: 251 QFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEIRE 310
           QFHPTGIYG+GCL+TEGARGEGGYLVNS+GERFMERYAPSAKDLASRDVVSR M +E+RE
Sbjct: 255 QFHPTGIYGSGCLVTEGARGEGGYLVNSEGERFMERYAPSAKDLASRDVVSRAMTIEMRE 314

Query: 311 GRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMGGI 370
           GRGVGK KDHI L+L+HL P VL ERLPGISESARIFAGVDVTR+PIP++PTVHYNMGGI
Sbjct: 315 GRGVGKKKDHIFLHLDHLAPEVLHERLPGISESARIFAGVDVTREPIPILPTVHYNMGGI 374

Query: 371 PTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIRAS 430
           PTN+ GEV+     +     PGLMAIGEA C SVHGANRLGSNSLIDLVVFGRAA +R +
Sbjct: 375 PTNFHGEVVTKKDGDDNAVVPGLMAIGEAACVSVHGANRLGSNSLIDLVVFGRAAALRCA 434

Query: 431 EMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQDSL 490
           E +  +   P L   S +  + R D+ R+A G  PTA LRE+MQ  MQ +  VFRT + L
Sbjct: 435 EKLVPNGKQPELPADSAEMSLGRLDKYRYAKGGTPTAKLRERMQHVMQNNCAVFRTGEVL 494

Query: 491 SDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRGSH 550
           ++G   ++ ++  + D+ V DRSL+WNSDLVETLE  NL++ A+ T+ SA  R ESRG+H
Sbjct: 495 AEGKELIANVYGSVGDVGVSDRSLVWNSDLVETLEFDNLIVQAVVTMNSAANRTESRGAH 554

Query: 551 AREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPKARV 610
           AREDF D     RDD  W KH+L W+  + G + +DYRPVH   +   V Y  I PK RV
Sbjct: 555 AREDFPD-----RDDAAWMKHTLAWIG-DKGDVTIDYRPVHDYTMTNDVQY--IPPKPRV 606

Query: 611 Y 611
           Y
Sbjct: 607 Y 607


>gi|114328742|ref|YP_745899.1| succinate dehydrogenase flavoprotein subunit [Granulibacter
           bethesdensis CGDNIH1]
 gi|114316916|gb|ABI62976.1| succinate dehydrogenase flavoprotein subunit [Granulibacter
           bethesdensis CGDNIH1]
          Length = 603

 Score =  800 bits (2067), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/608 (65%), Positives = 474/608 (77%), Gaps = 9/608 (1%)

Query: 4   SSNLKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGI 63
           +S    +Y  VDH+YDVVVVGAGGAGLRATLGM   G KTAC+TKVFPTRSHTVAAQGGI
Sbjct: 5   TSPSTGAYRIVDHTYDVVVVGAGGAGLRATLGMGAAGLKTACVTKVFPTRSHTVAAQGGI 64

Query: 64  AASLANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGK 123
           +A+L N+TPD W+WH+YDT+KGSDWLGD DAI+Y+  EA  ++YELEH+GVPFSR E G+
Sbjct: 65  SAALGNITPDDWRWHMYDTVKGSDWLGDQDAIEYMCREAIPAIYELEHFGVPFSRTEDGR 124

Query: 124 IYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIIN 183
           IYQRPFGGHM++YG+  PVQR CAAADRTGHA+LHTLY Q+LK++ EFF+EYFALDLI++
Sbjct: 125 IYQRPFGGHMRDYGK-EPVQRACAAADRTGHAMLHTLYQQSLKHHCEFFVEYFALDLIMD 183

Query: 184 SEGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLP 243
            EG C GV+AW LE G +HRF A +VVLATGGYGRAY S TSAHTCTGDG GMV RAGLP
Sbjct: 184 EEGACRGVIAWNLEDGTMHRFRAHMVVLATGGYGRAYQSCTSAHTCTGDGGGMVLRAGLP 243

Query: 244 LQDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRC 303
            QDMEFVQFHPTGI+ AGCLITEGARGEGGYL N+ GERFMERYAP+AKDLASRDVVSR 
Sbjct: 244 TQDMEFVQFHPTGIFPAGCLITEGARGEGGYLTNAAGERFMERYAPTAKDLASRDVVSRS 303

Query: 304 MMMEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTV 363
           M +EI EGRGVG +KDHI L+L HL   +L ERLPGISE+A++FAGVDVT++PIPV+PTV
Sbjct: 304 MTIEINEGRGVGPNKDHILLHLEHLGAEILAERLPGISETAKVFAGVDVTKEPIPVLPTV 363

Query: 364 HYNMGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGR 423
           HYNMGGIPTNY  EVL   + +P+   PGLMA+GEA C SVHGANRLG+NSL+DLVVFGR
Sbjct: 364 HYNMGGIPTNYRAEVLRPTADDPDAVVPGLMAVGEAACVSVHGANRLGTNSLLDLVVFGR 423

Query: 424 AAVIRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGV 483
           AA  RA+E++   +    L   + +  +DR D  RHA G    A LR ++QR MQ  A V
Sbjct: 424 AAAHRAAEIVKPGAQHAPLPARAGEAALDRLDSRRHASGGSRVADLRAELQRTMQRHAAV 483

Query: 484 FRTQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEAR 543
           FR   SL++G + +  +W  ++D+ V DRSLIWN+DLVE LEL NLM NA AT+ SAEAR
Sbjct: 484 FRNSASLTEGVKKMKTVWGGLSDVSVTDRSLIWNTDLVEALELDNLMGNAAATMVSAEAR 543

Query: 544 KESRGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSK 603
            ESRG+HA +D+ D     R+D +W KH+L WVD  +G + L YRPV  + L   V  S 
Sbjct: 544 PESRGAHAHDDYPD-----RNDQDWMKHTLSWVD-ASGDVHLGYRPVKMQTLTNEV--SV 595

Query: 604 IAPKARVY 611
             PK RVY
Sbjct: 596 FPPKKRVY 603


>gi|67459551|ref|YP_247175.1| succinate dehydrogenase flavoprotein subunit [Rickettsia felis
           URRWXCal2]
 gi|75535803|sp|Q4UJM1|DHSA_RICFE RecName: Full=Succinate dehydrogenase flavoprotein subunit
 gi|67005084|gb|AAY62010.1| Succinate dehydrogenase flavoprotein subunit [Rickettsia felis
           URRWXCal2]
          Length = 596

 Score =  800 bits (2066), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/605 (64%), Positives = 475/605 (78%), Gaps = 9/605 (1%)

Query: 7   LKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAAS 66
           +  +Y  + H +DVVVVGAGGAGLR+  GMA++G  TACITK+FPTRSHTVAAQGGI+A+
Sbjct: 1   MTKAYNIIHHKFDVVVVGAGGAGLRSAFGMAKEGLNTACITKLFPTRSHTVAAQGGISAA 60

Query: 67  LANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQ 126
           L NM  D W+WH+YDT+KGSDWLGD DAI+Y+   AP ++ ELEHYGVPFSR E GKIYQ
Sbjct: 61  LGNMGEDDWRWHMYDTVKGSDWLGDQDAIEYMCKNAPDAILELEHYGVPFSRTEEGKIYQ 120

Query: 127 RPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEG 186
           RPFGG    YG+G   QRTCAAADRTGHAILHTLY Q+LK+  +FF+EYFA+DL++  +G
Sbjct: 121 RPFGGMTTEYGKGKAAQRTCAAADRTGHAILHTLYQQSLKHKVQFFVEYFAIDLLM-EDG 179

Query: 187 CCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQD 246
            C GVV W L+ G +H F A  VVLATGGYGRAYFSATSAHTCTGDG GM  RAGLPLQD
Sbjct: 180 ECRGVVVWNLDDGTLHCFRAHNVVLATGGYGRAYFSATSAHTCTGDGGGMAIRAGLPLQD 239

Query: 247 MEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMM 306
           MEFVQFHPTGIY AGCLITEGARGEGGYLVN+ GERFMERYAP+AKDLASRDVVSR M +
Sbjct: 240 MEFVQFHPTGIYSAGCLITEGARGEGGYLVNANGERFMERYAPAAKDLASRDVVSRAMTI 299

Query: 307 EIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYN 366
           EIREGRGVG+ KDH+ L+LNHL P +L  RLPGISE+A+IFAGVDVT++PIPV+PTVHYN
Sbjct: 300 EIREGRGVGEHKDHVFLHLNHLSPEILHSRLPGISETAKIFAGVDVTKEPIPVLPTVHYN 359

Query: 367 MGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAV 426
           MGGIPTNY G+V+  +  N      GLMAIGEA C SVHGANRLGSNSL+DLVVFGR++ 
Sbjct: 360 MGGIPTNYHGQVIIKDGTNHNSVVKGLMAIGEAACVSVHGANRLGSNSLLDLVVFGRSSA 419

Query: 427 IRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRT 486
           ++A+E+I  +SP   +  +S ++I++RFD++RHA+G++  A LR KMQR MQ  A VFRT
Sbjct: 420 LKAAELISPASPHKPIKEASLEKIINRFDKVRHANGNILVADLRLKMQRTMQSHASVFRT 479

Query: 487 QDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKES 546
           Q+ L +G   +S + +   D+K++D+SLIWNSDLVE LEL NL+  A+ TVYSA ARKES
Sbjct: 480 QEVLDEGAGMISEIRNGYKDIKINDKSLIWNSDLVEALELDNLLDQALVTVYSAAARKES 539

Query: 547 RGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAP 606
           RG+HARED+ D     R+D +W KH+L  +D   GKI +DY+PV    L   +  S I P
Sbjct: 540 RGAHAREDYPD-----RNDGDWMKHTLSSID-EAGKIVIDYKPVTLTTLTDEI--SAIPP 591

Query: 607 KARVY 611
             RVY
Sbjct: 592 AKRVY 596


>gi|238650696|ref|YP_002916549.1| succinate dehydrogenase flavoprotein subunit [Rickettsia peacockii
           str. Rustic]
 gi|238624794|gb|ACR47500.1| succinate dehydrogenase flavoprotein subunit [Rickettsia peacockii
           str. Rustic]
          Length = 596

 Score =  800 bits (2065), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/605 (65%), Positives = 475/605 (78%), Gaps = 9/605 (1%)

Query: 7   LKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAAS 66
           +  +Y  + H +DVVVVGAGGAGLR+  GMA++G  TACITK+FPTRSHTVAAQGGI+A+
Sbjct: 1   MTKAYNIIHHKFDVVVVGAGGAGLRSAFGMAKEGLNTACITKLFPTRSHTVAAQGGISAA 60

Query: 67  LANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQ 126
           L NM  D W+WH+YDT+KGSDWLGD DAI+Y+   AP ++ ELEHYGVPFSR E GKIYQ
Sbjct: 61  LGNMGEDDWRWHMYDTVKGSDWLGDQDAIEYMCKNAPDAILELEHYGVPFSRTEEGKIYQ 120

Query: 127 RPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEG 186
           RPFGG    YG+G   QRTCAAADRTGHAILHTLY Q+LK+  +FF+EYFA+DL++  +G
Sbjct: 121 RPFGGMTTEYGKGKAAQRTCAAADRTGHAILHTLYQQSLKHKVQFFVEYFAIDLLM-EDG 179

Query: 187 CCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQD 246
            C GVVAW L+ G +H F A  VVLATGGYGRAYFSATSAHTCTGDG GM  RAGLPLQD
Sbjct: 180 ECRGVVAWNLDDGSLHCFRAHNVVLATGGYGRAYFSATSAHTCTGDGGGMAIRAGLPLQD 239

Query: 247 MEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMM 306
           MEFVQFHPTGIY AGCLITEGARGEGGYLVN+ GERFMERYAP+AKDLASRDVVSR M +
Sbjct: 240 MEFVQFHPTGIYSAGCLITEGARGEGGYLVNANGERFMERYAPAAKDLASRDVVSRAMTI 299

Query: 307 EIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYN 366
           EIREGRGVG+ KDH+ L+LNHL P +L   LPGISE+A+IFAGVDVT++PIPV+PTVHYN
Sbjct: 300 EIREGRGVGEHKDHVFLHLNHLSPEILHSCLPGISETAKIFAGVDVTKEPIPVLPTVHYN 359

Query: 367 MGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAV 426
           MGGIPTNY G+V+  + KN      GLMAIGEA C SVHGANRLGSNSL+DLVVFG+++ 
Sbjct: 360 MGGIPTNYHGQVIIKDGKNHNSVVKGLMAIGEAACVSVHGANRLGSNSLLDLVVFGKSSA 419

Query: 427 IRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRT 486
           ++A+E+I  +SP  S+   S ++I++RFD++RHA+G++  A LR KMQR MQ  A VFRT
Sbjct: 420 LKAAELIKPASPHKSIKEESLEKIINRFDKVRHANGNILVAELRLKMQRTMQSHASVFRT 479

Query: 487 QDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKES 546
           Q+ L +G   +S +     D+K++D+SLIWNSDLVE LEL NL+  A+ TVYSA ARKES
Sbjct: 480 QEVLDEGAGMISEIRSGYKDIKINDKSLIWNSDLVEALELDNLLDQALVTVYSAAARKES 539

Query: 547 RGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAP 606
           RG+HARED+ D     R+D +W KH+L  +D   GK+ LDY+PV    L   V  + I P
Sbjct: 540 RGAHAREDYPD-----RNDEDWMKHTLSSID-EAGKVVLDYKPVTLTTLTDEV--TAIPP 591

Query: 607 KARVY 611
             RVY
Sbjct: 592 VKRVY 596


>gi|157828044|ref|YP_001494286.1| succinate dehydrogenase flavoprotein subunit [Rickettsia rickettsii
           str. 'Sheila Smith']
 gi|157800525|gb|ABV75778.1| succinate dehydrogenase flavoprotein subunit [Rickettsia rickettsii
           str. 'Sheila Smith']
          Length = 596

 Score =  800 bits (2065), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/605 (65%), Positives = 473/605 (78%), Gaps = 9/605 (1%)

Query: 7   LKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAAS 66
           +  +Y  V H +DVVVVGAGGAGLR+  GMA+ G  TACITK+FPTRSHTVAAQGGI+A+
Sbjct: 1   MTKAYNIVHHKFDVVVVGAGGAGLRSAFGMAKAGLNTACITKLFPTRSHTVAAQGGISAA 60

Query: 67  LANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQ 126
           L NM  D W+WH+YDT+KGSDWLGD DAI+Y+   AP ++ ELEHYGVPFSR E GKIYQ
Sbjct: 61  LGNMGEDDWRWHMYDTVKGSDWLGDQDAIEYMCKNAPDAILELEHYGVPFSRTEEGKIYQ 120

Query: 127 RPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEG 186
           RPFGG    YG+G   QRTCAAADRTGHAILHTLY Q+LK+  +FF+EYFA+DL++  +G
Sbjct: 121 RPFGGMTTEYGKGKAAQRTCAAADRTGHAILHTLYQQSLKHKVQFFVEYFAIDLLME-DG 179

Query: 187 CCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQD 246
            C GVVAW L+ G +H F A  VVLATGGYGRAYFSATSAHTCTGDG GM  RA LPLQD
Sbjct: 180 ECRGVVAWNLDDGSLHCFRAHNVVLATGGYGRAYFSATSAHTCTGDGGGMAIRAALPLQD 239

Query: 247 MEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMM 306
           MEFVQFHPTGIY AGCLITEGARGEGGYLVN+ GERFMERYAP+AKDLASRDVVSR M +
Sbjct: 240 MEFVQFHPTGIYSAGCLITEGARGEGGYLVNANGERFMERYAPAAKDLASRDVVSRAMTI 299

Query: 307 EIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYN 366
           EIREGRGVG+ KDH+ L+LNHL   +L  RLPGISE+A+IFAGVDVT++PIPV+PTVHYN
Sbjct: 300 EIREGRGVGEHKDHVFLHLNHLSSEILHSRLPGISETAKIFAGVDVTKEPIPVLPTVHYN 359

Query: 367 MGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAV 426
           MGGIPTNY G+V+  + KN      GLMAIGEA C SVHGANRLGSNSL+DLVVFGR++ 
Sbjct: 360 MGGIPTNYHGQVIIKDGKNHNSVVKGLMAIGEAACVSVHGANRLGSNSLLDLVVFGRSSA 419

Query: 427 IRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRT 486
           ++A+E+I  +SP  S+   S ++I++RFD++RHA+G++  A LR KMQR MQ  A VFRT
Sbjct: 420 LKAAELIKPASPHKSIKEESLEKIINRFDKVRHANGNILVAELRLKMQRTMQSHASVFRT 479

Query: 487 QDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKES 546
           Q+ L +G   +S +     D+K++D+SLIWNSDLVE LEL NL+  A+ TVYSA ARKES
Sbjct: 480 QELLDEGAGMISEIRSGYKDIKINDKSLIWNSDLVEALELDNLLDQALVTVYSAAARKES 539

Query: 547 RGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAP 606
           RG+HARED+ D     R+D +W KH+L  +D   GK+ LDY+PV    L   V  + + P
Sbjct: 540 RGAHAREDYPD-----RNDEDWMKHTLSSID-EAGKVVLDYKPVTLTTLTDEV--TAVPP 591

Query: 607 KARVY 611
             RVY
Sbjct: 592 VKRVY 596


>gi|254448789|ref|ZP_05062246.1| succinate dehydrogenase, flavoprotein subunit [gamma
           proteobacterium HTCC5015]
 gi|198261630|gb|EDY85918.1| succinate dehydrogenase, flavoprotein subunit [gamma
           proteobacterium HTCC5015]
          Length = 595

 Score =  800 bits (2065), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/604 (66%), Positives = 467/604 (77%), Gaps = 13/604 (2%)

Query: 10  SYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLAN 69
           +Y  V+H YDVVVVGAGGAGLRAT GMA+KG  TACITKVFPTRSHTVAAQGGI+A+L N
Sbjct: 3   NYEIVNHEYDVVVVGAGGAGLRATFGMAQKGLNTACITKVFPTRSHTVAAQGGISAALGN 62

Query: 70  MTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRPF 129
           M  D W+WH+YDT+KGSDWLGD DAI+Y+  EA  ++ ELEHYGVPFSR EAGKIYQRPF
Sbjct: 63  MGQDDWRWHMYDTVKGSDWLGDQDAIEYMCREAIPAIIELEHYGVPFSRTEAGKIYQRPF 122

Query: 130 GGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCCV 189
           GG   N+GEG   QRTCAAADRTGHAILHTLY Q+L+++AEFF+E+FALDLI++ EG C 
Sbjct: 123 GGMTTNFGEGT-AQRTCAAADRTGHAILHTLYSQSLRHDAEFFVEFFALDLIMDDEGACK 181

Query: 190 GVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDMEF 249
           GV+A ++ TG+IH F A +VVLATGGYGRAYFSATSAHTCTGDG GMV RAGL +QDMEF
Sbjct: 182 GVIALEMATGKIHVFRAHMVVLATGGYGRAYFSATSAHTCTGDGGGMVVRAGLGMQDMEF 241

Query: 250 VQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEIR 309
           VQFHPTGIYGAGCLITEG RGEGGYL NSKGERFMERYAP+AKDLASRDVVSR M MEIR
Sbjct: 242 VQFHPTGIYGAGCLITEGVRGEGGYLTNSKGERFMERYAPNAKDLASRDVVSRSMTMEIR 301

Query: 310 EGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMGG 369
           +G GVG  KDHI+L L HL P V+ +RLPGI+ESARIFAGVDV ++PIPVIPTVHYNMGG
Sbjct: 302 DGNGVGDEKDHIYLNLMHLGPEVINQRLPGIAESARIFAGVDVAKEPIPVIPTVHYNMGG 361

Query: 370 IPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIRA 429
           IPTNY GEV+     +P+   PGLMAIGEA C SVHGANRLGSNSL+DLVVFGRAA  RA
Sbjct: 362 IPTNYHGEVVTIKDGDPDAVVPGLMAIGEAACVSVHGANRLGSNSLLDLVVFGRAAANRA 421

Query: 430 SEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQDS 489
           +E++       SL     D+ ++R +  R ADG  PTA +R  MQ+ MQ  A VFRT +S
Sbjct: 422 AEVVTAGETHKSLTSEPVDKCLNRLESFRTADGSKPTADVRLNMQKTMQTHAAVFRTDES 481

Query: 490 LSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRGS 549
           L +G   +  +  ++AD+KV DRSLIWN+DL+ETLEL NLM  A+ T+  A  RKESRG+
Sbjct: 482 LKEGIEKIDAIAQDLADIKVTDRSLIWNTDLIETLELDNLMSQAMLTIKGAYNRKESRGA 541

Query: 550 HAREDFKDGEFGGRDDVNWRKHSLCWVD--WNTGKIKLDYRPVHTELLCGGVDYSKIAPK 607
           HA ED+ D     R D  W KH+   +D  WN   ++ +YRPVH   L    D   I PK
Sbjct: 542 HAHEDYPD-----RLDEEWHKHTYAVIDDQWN---VEFEYRPVHMYTLTDECDV--IPPK 591

Query: 608 ARVY 611
            RVY
Sbjct: 592 KRVY 595


>gi|91205979|ref|YP_538334.1| succinate dehydrogenase flavoprotein subunit [Rickettsia bellii
           RML369-C]
 gi|122425298|sp|Q1RHB9|DHSA_RICBR RecName: Full=Succinate dehydrogenase flavoprotein subunit
 gi|91069523|gb|ABE05245.1| Succinate dehydrogenase flavoprotein subunit [Rickettsia bellii
           RML369-C]
          Length = 596

 Score =  799 bits (2064), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/605 (65%), Positives = 471/605 (77%), Gaps = 9/605 (1%)

Query: 7   LKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAAS 66
           +  SY  + H +DV+VVGAGGAGLRA  GMAE+G  TACI+K+FPTRSHTVAAQGGI+A+
Sbjct: 1   MTKSYNIIHHKFDVIVVGAGGAGLRAAFGMAEEGLNTACISKLFPTRSHTVAAQGGISAA 60

Query: 67  LANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQ 126
           L NM  D W+WH+YDT+KGSDWLGD DAI+Y+   AP ++ ELEHYGVPFSR E GKIYQ
Sbjct: 61  LGNMGADDWRWHMYDTVKGSDWLGDQDAIEYMCKNAPDAILELEHYGVPFSRTEEGKIYQ 120

Query: 127 RPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEG 186
           RPFGG    YG+G   QRTCAAADRTGHAILHTLY Q+LK+  +FFIEYFA+DL++ + G
Sbjct: 121 RPFGGMTTEYGKGKAAQRTCAAADRTGHAILHTLYQQSLKHKVQFFIEYFAIDLLMEN-G 179

Query: 187 CCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQD 246
            C GVVAW L+ G +H F A  VVLATGGYGRAYFSATSAHTCTGDG GM  RAGLPLQD
Sbjct: 180 ECRGVVAWNLDDGSLHCFRAHNVVLATGGYGRAYFSATSAHTCTGDGGGMAIRAGLPLQD 239

Query: 247 MEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMM 306
           MEFVQFHPTGIY AGCLITEGARGEGGYLVN+ GERFMERYAP+AKDLASRDVVSR M +
Sbjct: 240 MEFVQFHPTGIYSAGCLITEGARGEGGYLVNANGERFMERYAPAAKDLASRDVVSRAMTI 299

Query: 307 EIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYN 366
           EIREGRGVG+ KDH+ L+LNHL P ++  RLPGISE+A+IFAGVDVT++PIPV+PTVHYN
Sbjct: 300 EIREGRGVGEHKDHVFLHLNHLSPEIVHSRLPGISETAKIFAGVDVTKEPIPVLPTVHYN 359

Query: 367 MGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAV 426
           MGGIPTNY G+V+  + KN      GLM+IGEA C SVHGANRLGSNSL+DLVVFGR+A 
Sbjct: 360 MGGIPTNYHGQVIIKDGKNHNSVVKGLMSIGEAACVSVHGANRLGSNSLLDLVVFGRSAA 419

Query: 427 IRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRT 486
           ++A+E+I  +SP   +   + ++I+ RFD++RH+ G++  A LR KMQR MQ  A VFRT
Sbjct: 420 LKAAELIKPASPHKPVSEEALEKIISRFDKIRHSSGNISVADLRLKMQRTMQSHASVFRT 479

Query: 487 QDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKES 546
           Q+ L +G   +S +     D+KV+D+SLIWNSDLVE LEL NL+  A+ TVYSA ARKES
Sbjct: 480 QEVLDEGAEMISEIRSGYKDIKVNDKSLIWNSDLVEALELDNLLDQALVTVYSAAARKES 539

Query: 547 RGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAP 606
           RG+HARED+ D     R+D  W +H+L  VD   GK+ LDY+PV    L   V    I P
Sbjct: 540 RGAHAREDYPD-----RNDKEWMQHTLSGVD-EAGKVVLDYKPVTLTTLSDEV--KAIPP 591

Query: 607 KARVY 611
             RVY
Sbjct: 592 AKRVY 596


>gi|299133112|ref|ZP_07026307.1| succinate dehydrogenase, flavoprotein subunit [Afipia sp. 1NLS2]
 gi|298593249|gb|EFI53449.1| succinate dehydrogenase, flavoprotein subunit [Afipia sp. 1NLS2]
          Length = 606

 Score =  799 bits (2063), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/602 (65%), Positives = 475/602 (78%), Gaps = 9/602 (1%)

Query: 10  SYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLAN 69
           +Y   DH+YDVVVVGAGGAGLRA +G +E G +TACITKVFPTRSHTVAAQGGI+ASL N
Sbjct: 14  AYPIEDHTYDVVVVGAGGAGLRAVVGCSEAGLRTACITKVFPTRSHTVAAQGGISASLGN 73

Query: 70  MTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRPF 129
           M PD W+WH+YDT+KGSDWLGD D+I+Y+   AP +VYELEH+GVPFSR E GKI+QRPF
Sbjct: 74  MHPDDWRWHMYDTVKGSDWLGDQDSIEYMVRNAPAAVYELEHWGVPFSRTEDGKIFQRPF 133

Query: 130 GGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCCV 189
           GG  ++YG+G   QRTCAAADRTGHA+LHT+YGQA++++AEFFIE+FA+DLI++ +G C 
Sbjct: 134 GGMTRDYGKGQ-AQRTCAAADRTGHAMLHTMYGQAVRHSAEFFIEFFAIDLIMDDQGVCR 192

Query: 190 GVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDMEF 249
           GVVA +L+ G +HRF A+  +LATGGYGRAY S TSAHTCTGDG GM  RAGLPLQDMEF
Sbjct: 193 GVVALKLDDGTLHRFRAQTTILATGGYGRAYQSCTSAHTCTGDGGGMALRAGLPLQDMEF 252

Query: 250 VQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEIR 309
           VQFHPTGI+ AGCLITEGARGEGGYLVN++GERFMERYAPSAKDLASRDVVSR M +EIR
Sbjct: 253 VQFHPTGIFPAGCLITEGARGEGGYLVNAEGERFMERYAPSAKDLASRDVVSRAMTIEIR 312

Query: 310 EGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMGG 369
           EGRGVGK KDHI L+L+HLDPAVL +RLPGISESA+IFAGVDVTR+PIPV+PTVHYNMGG
Sbjct: 313 EGRGVGKKKDHIFLHLDHLDPAVLHQRLPGISESAKIFAGVDVTREPIPVLPTVHYNMGG 372

Query: 370 IPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIRA 429
           IPTN+ GEV+     + +    GLMA+GEA C SVHGANRLGSNSLIDLVVFGRAA +R 
Sbjct: 373 IPTNFHGEVVVKKHGDDDAVVQGLMAVGEAACVSVHGANRLGSNSLIDLVVFGRAAALRC 432

Query: 430 SEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQDS 489
           +E +      P L   S D+ + R D  R+A G  PTA LR+ MQR MQ +  VFRT + 
Sbjct: 433 AEKLTPDGKQPELPADSADKAIARLDHFRNASGGTPTAKLRDSMQRVMQNNCAVFRTGEV 492

Query: 490 LSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRGS 549
           L++G   +  +   +AD+ V DRSLIWN+DL+ETLEL NL++ A+ T+ SA  R ESRG+
Sbjct: 493 LAEGKDLIHKVHGGLADIGVTDRSLIWNTDLIETLELDNLIVQAVVTMDSAVNRTESRGA 552

Query: 550 HAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPKAR 609
           HARED+ +     RDD NW KH+L W+D       +DYRPVH+  +   + Y  I PKAR
Sbjct: 553 HAREDYSE-----RDDKNWMKHTLAWID-PKANTTIDYRPVHSYTMTNDIQY--IPPKAR 604

Query: 610 VY 611
           VY
Sbjct: 605 VY 606


>gi|326503994|dbj|BAK02783.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 621

 Score =  798 bits (2061), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/603 (65%), Positives = 480/603 (79%), Gaps = 9/603 (1%)

Query: 9   SSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLA 68
           SSYT VDH+YD VVVGAGGAGLRA +G++E GF TACITK+FPTRSHTVAAQGGI A+L 
Sbjct: 28  SSYTVVDHTYDAVVVGAGGAGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALG 87

Query: 69  NMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRP 128
           NM+ D W+WH+YDT+KGSDWLGD DAIQY+  EAP++V ELE+YG+PFSR E GKIYQR 
Sbjct: 88  NMSEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFSRTEDGKIYQRA 147

Query: 129 FGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCC 188
           FGG   ++G+G    R   AADRTGHA+LHTLYGQA+K+N +FF+EYFALDLI++ EG C
Sbjct: 148 FGGQSLDFGKGGQAYRCACAADRTGHAMLHTLYGQAMKHNTQFFVEYFALDLIMDKEGTC 207

Query: 189 VGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDME 248
            GV+A  +E G +HRF +   +LATGGYGRAYFSATSAHTCTGDG  MVARAGLPLQD+E
Sbjct: 208 QGVIALNMEDGTLHRFRSTNTILATGGYGRAYFSATSAHTCTGDGNAMVARAGLPLQDLE 267

Query: 249 FVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEI 308
           FVQFHPTGIYGAGCLITEG+RGEGG L NS+GERFMERYAP+AKDLASRDVVSR M MEI
Sbjct: 268 FVQFHPTGIYGAGCLITEGSRGEGGILRNSEGERFMERYAPTAKDLASRDVVSRSMTMEI 327

Query: 309 REGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMG 368
           REGRGVG  KDH++L+LNHL P VL+ERLPGISE+A IFAGVDVT++PIPV+PTVHYNMG
Sbjct: 328 REGRGVGPLKDHLYLHLNHLPPEVLKERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMG 387

Query: 369 GIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIR 428
           GIPTNY G+V+D    NP+   PGLMA GEA CASVHGANRLG+NSL+D+VVFGRA   R
Sbjct: 388 GIPTNYHGQVVDIKGDNPDTIIPGLMAAGEAACASVHGANRLGANSLLDIVVFGRACANR 447

Query: 429 ASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQD 488
            +E+         L+  + ++ +   D+LR+A+G +PT+ +R  MQR MQ +A VFRTQ+
Sbjct: 448 VAEISKPGETQKPLEKDAGEKTIAWLDKLRNANGSLPTSNIRLNMQRIMQNNAAVFRTQE 507

Query: 489 SLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRG 548
           +L++GC+ +S       D+K+ DRSLIWNSDL+ET+EL+NL+INA  T++SAEAR+ESRG
Sbjct: 508 TLTEGCKLISEAQKSFNDVKLSDRSLIWNSDLIETIELENLLINACITMHSAEARQESRG 567

Query: 549 SHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPKA 608
           +HAREDFK      RDD  W KHSL +  W   K++L+YRPVH   L   V+     PKA
Sbjct: 568 AHAREDFKT-----RDDDKWMKHSLGY--WEDEKVRLEYRPVHMNTLDDEVE--TFPPKA 618

Query: 609 RVY 611
           RVY
Sbjct: 619 RVY 621


>gi|302806996|ref|XP_002985229.1| hypothetical protein SELMODRAFT_446158 [Selaginella moellendorffii]
 gi|300147057|gb|EFJ13723.1| hypothetical protein SELMODRAFT_446158 [Selaginella moellendorffii]
          Length = 628

 Score =  798 bits (2060), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/610 (65%), Positives = 482/610 (79%), Gaps = 15/610 (2%)

Query: 5   SNLKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIA 64
           S   ++Y  VDH+YD VVVGAGGAGLRA +G++E GF TACITK+FPTRSHTVAAQGGI 
Sbjct: 31  STTGAAYPIVDHTYDAVVVGAGGAGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGIN 90

Query: 65  ASLANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKI 124
           A+L NMT D W+WH+YDT+KGSDWLGD DAIQY+  EAP +V ELE+YG+PFSR E GKI
Sbjct: 91  AALGNMTEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPAAVIELENYGLPFSRTEEGKI 150

Query: 125 YQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINS 184
           YQR FGG   N+G+G    R   AADRTGHA+LHTLYGQA+K+N +FF+EYFALDLI++ 
Sbjct: 151 YQRAFGGQSLNFGKGGQAYRCACAADRTGHALLHTLYGQAMKHNTQFFVEYFALDLIMDD 210

Query: 185 EGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPL 244
           EG C GV+A  +E G +HRF A   +LATGGYGRAYFSATSAHTCTGDG  MVARAGLPL
Sbjct: 211 EGACRGVMALNMEDGTLHRFRALSTILATGGYGRAYFSATSAHTCTGDGNAMVARAGLPL 270

Query: 245 QDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCM 304
           +D+EFVQFHPTGIYGAGCLITEG+RGEGG L NS+GERFMERYAP+AKDLASRDVVSR M
Sbjct: 271 EDLEFVQFHPTGIYGAGCLITEGSRGEGGILRNSEGERFMERYAPTAKDLASRDVVSRSM 330

Query: 305 MMEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVH 364
            MEIREGRGVG  KDHI+L+LNHL P VL+ERLPGISE+A IFAGVDVT++PIPV+PTVH
Sbjct: 331 TMEIREGRGVGPLKDHIYLHLNHLPPEVLKERLPGISETAAIFAGVDVTKEPIPVLPTVH 390

Query: 365 YNMGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRA 424
           YNMGGIPTNY GE +     +P+   PGLMA GEA CASVHGANRLG+NSL+D+VVFGRA
Sbjct: 391 YNMGGIPTNYRGEGVTTKDGDPDCLIPGLMAAGEAACASVHGANRLGANSLLDIVVFGRA 450

Query: 425 AVIRASEMI---DKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDA 481
                +E+    DK  P+P    ++ +  +   ++LR+A+G +PTA++R  MQR MQ +A
Sbjct: 451 CANTMAEIYKPGDKQKPLPK---NAGEGTIAWLNKLRYANGDIPTASIRLSMQRVMQNNA 507

Query: 482 GVFRTQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAE 541
            VFRTQ++L +GC+ ++ +WD  + +K  DRSLIWNSDL+ET+EL+NL+INA+ T+ SAE
Sbjct: 508 AVFRTQETLEEGCKLINEIWDSFSRVKTSDRSLIWNSDLIETIELENLLINAVITMQSAE 567

Query: 542 ARKESRGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDY 601
           ARKESRG+HAREDF       RDD NW KH+L +  W  GK++LDYRPVH   L   V+ 
Sbjct: 568 ARKESRGAHAREDFAK-----RDDENWMKHTLGF--WEDGKVRLDYRPVHMNTLDKEVE- 619

Query: 602 SKIAPKARVY 611
               PKARVY
Sbjct: 620 -PFPPKARVY 628


>gi|15604005|ref|NP_220520.1| succinate dehydrogenase flavoprotein subunit [Rickettsia prowazekii
           str. Madrid E]
 gi|399372|sp|P31038|DHSA_RICPR RecName: Full=Succinate dehydrogenase flavoprotein subunit
 gi|152492|gb|AAA16097.1| succinate dehydrogenase [Rickettsia prowazekii]
 gi|409936|gb|AAA18327.1| SdhA [Rickettsia prowazekii]
 gi|3860696|emb|CAA14597.1| SUCCINATE DEHYDROGENASE FLAVOPROTEIN SUBUNIT (sdhA) [Rickettsia
           prowazekii]
 gi|292571722|gb|ADE29637.1| Succinate dehydrogenase flavoprotein subunit [Rickettsia prowazekii
           Rp22]
          Length = 596

 Score =  797 bits (2059), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/605 (64%), Positives = 475/605 (78%), Gaps = 9/605 (1%)

Query: 7   LKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAAS 66
           +  +Y  + H +DVVVVGAGGAGLR+  GMA++G  TACITK+FPTRSHTVAAQGGI+A+
Sbjct: 1   MTKAYNIIHHKFDVVVVGAGGAGLRSAFGMAKEGLNTACITKIFPTRSHTVAAQGGISAA 60

Query: 67  LANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQ 126
           L NM  D W+WH+YDT+KGSDWLGD DAI+Y+   AP ++ ELEHYGVPFSR   GKIYQ
Sbjct: 61  LGNMGEDDWRWHMYDTVKGSDWLGDQDAIEYMCKNAPDAILELEHYGVPFSRTVDGKIYQ 120

Query: 127 RPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEG 186
           RPFGG    YG+G   QRTCAAADRTGHAILHTLY Q+LK+  +FFIEYFA+DL++  +G
Sbjct: 121 RPFGGMTTEYGKGKAAQRTCAAADRTGHAILHTLYQQSLKHKVQFFIEYFAIDLLM-EDG 179

Query: 187 CCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQD 246
            C GVVAW L+ G +H F A  VVLATGGYGRAYFSATSAHTCTGDG GMV RAGLPLQD
Sbjct: 180 ECRGVVAWNLDDGSLHCFRAHNVVLATGGYGRAYFSATSAHTCTGDGGGMVIRAGLPLQD 239

Query: 247 MEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMM 306
           MEFVQFHPTGIY AGCLITEGARGEGGYLVN+ GERFMERYAP+AKDLASRDVVSR M +
Sbjct: 240 MEFVQFHPTGIYSAGCLITEGARGEGGYLVNANGERFMERYAPAAKDLASRDVVSRAMTI 299

Query: 307 EIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYN 366
           EIREGRGVG+ KDH+ L+LNHL P +L  RLPGISE+A+IFAGVDVT+DPIPV+PTVHYN
Sbjct: 300 EIREGRGVGEHKDHVFLHLNHLSPEILHRRLPGISETAKIFAGVDVTKDPIPVLPTVHYN 359

Query: 367 MGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAV 426
           MGGIPTNY G+V+  + KN      G+MAIGEA C SVHGANRLGSNSL+DLVVFGR++ 
Sbjct: 360 MGGIPTNYQGQVIIKDGKNHNSIVNGIMAIGEAACVSVHGANRLGSNSLLDLVVFGRSSA 419

Query: 427 IRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRT 486
           ++A+E+I  +SP   L   + ++I++RFD++R+A+G++  A LR KMQR MQ    VFRT
Sbjct: 420 LKAAELIKPASPHKPLQKETLEKIINRFDKVRYANGNILVADLRLKMQRTMQSHVSVFRT 479

Query: 487 QDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKES 546
           Q  L +G   +S + +   D+K++D+SLIWNSDLVE LEL NL+  A+ TV SA ARKES
Sbjct: 480 QKLLDEGVGMISEIRNRYKDIKINDKSLIWNSDLVEALELDNLLDQALVTVCSAAARKES 539

Query: 547 RGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAP 606
           RG+HARED+ D     R+D +W KH+L  +D ++GK+ LDY+PV    L   +  S I P
Sbjct: 540 RGAHAREDYPD-----RNDRDWIKHTLSSID-DSGKVVLDYKPVTLTTLTDAI--SAIPP 591

Query: 607 KARVY 611
             RVY
Sbjct: 592 VKRVY 596


>gi|157825309|ref|YP_001493029.1| succinate dehydrogenase flavoprotein subunit [Rickettsia akari str.
           Hartford]
 gi|157799267|gb|ABV74521.1| succinate dehydrogenase flavoprotein subunit [Rickettsia akari str.
           Hartford]
          Length = 596

 Score =  797 bits (2058), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/605 (64%), Positives = 473/605 (78%), Gaps = 9/605 (1%)

Query: 7   LKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAAS 66
           +  +Y  + H +DVVVVGAGGAGLR+  GMA++G  TACITK+FPTRSHTVAAQGGI+A+
Sbjct: 1   MNKAYNIIHHKFDVVVVGAGGAGLRSAFGMAQEGLDTACITKLFPTRSHTVAAQGGISAA 60

Query: 67  LANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQ 126
           L NM  D W+WH+YDT+KGSDWLGD DAI+Y+   AP ++ ELEHYGVPFSR + GKIYQ
Sbjct: 61  LGNMGEDDWRWHMYDTVKGSDWLGDQDAIEYMCKNAPDAILELEHYGVPFSRTKEGKIYQ 120

Query: 127 RPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEG 186
           RPFGG    YG+G   QRTCAAADRTGHAILHTLY Q+LK+  +FF+EYFA+DL++  +G
Sbjct: 121 RPFGGMTTEYGKGKAAQRTCAAADRTGHAILHTLYQQSLKHKVQFFVEYFAIDLLM-EDG 179

Query: 187 CCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQD 246
            C GVVAW L+ G +H F A  VVLATGGYGRAYFSATSAHTCTGDG GM  RAGLPLQD
Sbjct: 180 ECRGVVAWNLDDGRLHCFRAHNVVLATGGYGRAYFSATSAHTCTGDGGGMAIRAGLPLQD 239

Query: 247 MEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMM 306
           MEFVQFHPTGIY AGCLITEGARGEGGYLVN  GERFMERYAP+AKDLASRDVVSR M +
Sbjct: 240 MEFVQFHPTGIYSAGCLITEGARGEGGYLVNVNGERFMERYAPAAKDLASRDVVSRAMTI 299

Query: 307 EIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYN 366
           EIREGRGVG+ KDH+ L+LNHL P +L  RLPGI E+A+IFAGVDVT++PIPV+PTVHYN
Sbjct: 300 EIREGRGVGEHKDHVFLHLNHLSPEILHSRLPGIVETAKIFAGVDVTKEPIPVLPTVHYN 359

Query: 367 MGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAV 426
           MGGIPTNY G+V+  + KN      GLMAIGEA C SVHGANRLGSNSL+DLVVFGR++ 
Sbjct: 360 MGGIPTNYHGQVIIKDGKNHNSVVKGLMAIGEAACVSVHGANRLGSNSLLDLVVFGRSSA 419

Query: 427 IRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRT 486
           ++A+E+I  +SP   L   S ++I++RFD++R+ +G++ TA LR KMQR MQ  A VFRT
Sbjct: 420 LKAAELIKPASPHKPLKEESLEKIINRFDKIRYNNGNILTADLRLKMQRTMQSHASVFRT 479

Query: 487 QDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKES 546
           Q+ L +G   +S +     D+K++D+SLIWNSDLVE LEL NL+  A+ TVYSA ARKES
Sbjct: 480 QEVLDEGAGMISEIRSGYKDIKINDKSLIWNSDLVEALELDNLLDQALVTVYSAAARKES 539

Query: 547 RGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAP 606
           RG+HARED+      GR+D +W KH+L  +D   GK+ LDY+PV    L   +  S I P
Sbjct: 540 RGAHAREDYP-----GRNDEDWMKHTLSSID-AAGKVVLDYKPVTLTTLTDEI--STIPP 591

Query: 607 KARVY 611
             RVY
Sbjct: 592 AKRVY 596


>gi|242032823|ref|XP_002463806.1| hypothetical protein SORBIDRAFT_01g006490 [Sorghum bicolor]
 gi|241917660|gb|EER90804.1| hypothetical protein SORBIDRAFT_01g006490 [Sorghum bicolor]
          Length = 620

 Score =  797 bits (2058), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/603 (66%), Positives = 475/603 (78%), Gaps = 9/603 (1%)

Query: 9   SSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLA 68
           SSYT VDH+YD VVVGAGGAGLRA +G++E GF TACITK+FPTRSHTVAAQGGI A+L 
Sbjct: 27  SSYTVVDHTYDAVVVGAGGAGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALG 86

Query: 69  NMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRP 128
           NM+ D W+WH+YDT+KGSDWLGD D+IQY+  EAP++V ELE+YG+PFSR E GKIYQR 
Sbjct: 87  NMSEDDWRWHMYDTVKGSDWLGDQDSIQYMCREAPKAVIELENYGLPFSRTEDGKIYQRA 146

Query: 129 FGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCC 188
           FGG   ++G+G    R   AADRTGHA+LHTLYGQA+K+N +FF+EYFALDL++++EG C
Sbjct: 147 FGGQSLDFGKGGQAYRCACAADRTGHAMLHTLYGQAMKHNTQFFVEYFALDLLMDNEGIC 206

Query: 189 VGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDME 248
            GV+A  +E G +HRF A   +LATGGYGRAYFSATSAHTCTGDG  MVARAGLPLQD+E
Sbjct: 207 QGVIALNMEDGTLHRFRAANTILATGGYGRAYFSATSAHTCTGDGNAMVARAGLPLQDLE 266

Query: 249 FVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEI 308
           FVQFHPTGIYGAGCLITEG+RGEGG L NS+GERFMERYAP+AKDLASRDVVSR M MEI
Sbjct: 267 FVQFHPTGIYGAGCLITEGSRGEGGILRNSEGERFMERYAPTAKDLASRDVVSRSMTMEI 326

Query: 309 REGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMG 368
           REGRGVG  KDHI+L+LNHL P VL+ERLPGISE+A IFAGVDVT++PIPV+PTVHYNMG
Sbjct: 327 REGRGVGPLKDHIYLHLNHLPPEVLKERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMG 386

Query: 369 GIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIR 428
           GIPTNY GEVL     +P+   PGLMA GEA CASVHGANRLG+NSL+D+VVFGRA   R
Sbjct: 387 GIPTNYHGEVLHIKGDDPDAVVPGLMAAGEAACASVHGANRLGANSLLDIVVFGRACANR 446

Query: 429 ASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQD 488
            +E+         L     +  +   D+LR+A+G +PT+ +R  MQR MQ +A VFRTQ+
Sbjct: 447 VAEISKPGEKQKPLGKGVGENTIAWLDKLRNANGSLPTSKIRLNMQRVMQNNAAVFRTQE 506

Query: 489 SLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRG 548
           +L +GC  +S  W+   D+K+ DRSLIWNSDL+ET+EL+NL+INA  T+YSAEARKESRG
Sbjct: 507 TLEEGCELISKAWESFHDVKISDRSLIWNSDLIETIELENLLINACITMYSAEARKESRG 566

Query: 549 SHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPKA 608
           +HAREDF       RDD +W KH+L +  W   K++L YRPVH   L   V      PKA
Sbjct: 567 AHAREDFST-----RDDESWMKHTLGY--WENEKVRLAYRPVHMNTLDDEV--QSFPPKA 617

Query: 609 RVY 611
           RVY
Sbjct: 618 RVY 620


>gi|302773241|ref|XP_002970038.1| hypothetical protein SELMODRAFT_440964 [Selaginella moellendorffii]
 gi|300162549|gb|EFJ29162.1| hypothetical protein SELMODRAFT_440964 [Selaginella moellendorffii]
          Length = 628

 Score =  796 bits (2057), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/606 (65%), Positives = 481/606 (79%), Gaps = 15/606 (2%)

Query: 9   SSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLA 68
           ++Y  VDH+YD VVVGAGGAGLRA +G++E GF TACITK+FPTRSHTVAAQGGI A+L 
Sbjct: 35  AAYPIVDHTYDAVVVGAGGAGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALG 94

Query: 69  NMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRP 128
           NMT D W+WH+YDT+KGSDWLGD DAIQY+  EAP +V ELE+YG+PFSR E GKIYQR 
Sbjct: 95  NMTEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPAAVIELENYGLPFSRTEEGKIYQRA 154

Query: 129 FGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCC 188
           FGG   N+G+G    R   AADRTGHA+LHTLYGQA+K+N +FF+EYFALDLI++ EG C
Sbjct: 155 FGGQSLNFGKGGQAYRCACAADRTGHALLHTLYGQAMKHNTQFFVEYFALDLIMDDEGAC 214

Query: 189 VGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDME 248
            GV+A  +E G +HRF A   +LATGGYGRAYFSATSAHTCTGDG  MVARAGLPL+D+E
Sbjct: 215 RGVMALNMEDGTLHRFRALSTILATGGYGRAYFSATSAHTCTGDGNAMVARAGLPLEDLE 274

Query: 249 FVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEI 308
           FVQFHPTGIYGAGCLITEG+RGEGG L NS+GERFMERYAP+AKDLASRDVVSR M MEI
Sbjct: 275 FVQFHPTGIYGAGCLITEGSRGEGGILRNSEGERFMERYAPTAKDLASRDVVSRSMTMEI 334

Query: 309 REGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMG 368
           REGRGVG  KDHI+L+LNHL P VL+ERLPGISE+A IFAGVDVT++PIPV+PTVHYNMG
Sbjct: 335 REGRGVGPLKDHIYLHLNHLPPEVLKERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMG 394

Query: 369 GIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIR 428
           GIPTNY GE +     +P+   PGLMA GEA CASVHGANRLG+NSL+D+VVFGRA    
Sbjct: 395 GIPTNYRGEGVTTKDGDPDCLIPGLMAAGEAACASVHGANRLGANSLLDIVVFGRACANT 454

Query: 429 ASEMI---DKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFR 485
            +E+    DK  P+P    ++ +  +   ++LR+A+G +PTA++R  MQR MQ +A VFR
Sbjct: 455 MAEIYKPGDKQKPLPK---NAGEGTIAWLNKLRYANGDLPTASIRLSMQRVMQNNAAVFR 511

Query: 486 TQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKE 545
           TQ++L +GC+ ++ +WD  + +K  DRSLIWNSDL+ET+EL+NL+INA+ T+ SAEARKE
Sbjct: 512 TQETLEEGCKLINEIWDSFSRVKTSDRSLIWNSDLIETIELENLLINAVITMQSAEARKE 571

Query: 546 SRGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIA 605
           SRG+HAREDF       RDD NW KH+L +  W  GK++LDYRPVH   L   V+     
Sbjct: 572 SRGAHAREDFAK-----RDDENWMKHTLGF--WEDGKVRLDYRPVHMNTLDKEVE--PFP 622

Query: 606 PKARVY 611
           PKARVY
Sbjct: 623 PKARVY 628


>gi|91974959|ref|YP_567618.1| succinate dehydrogenase flavoprotein subunit [Rhodopseudomonas
           palustris BisB5]
 gi|91681415|gb|ABE37717.1| succinate dehydrogenase subunit A [Rhodopseudomonas palustris
           BisB5]
          Length = 607

 Score =  796 bits (2056), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/602 (65%), Positives = 467/602 (77%), Gaps = 9/602 (1%)

Query: 10  SYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLAN 69
           +Y   DH YDVVVVGAGGAGLRA +G +E G +TACITKVFPTRSHTVAAQGGI+A+L N
Sbjct: 15  AYPIEDHVYDVVVVGAGGAGLRAVVGCSEAGLRTACITKVFPTRSHTVAAQGGISAALGN 74

Query: 70  MTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRPF 129
           M  D W+WH+YDT+KGSDWLGD D+I+Y+   AP++VYELEH+GVPFSR E GKIYQRPF
Sbjct: 75  MHKDDWRWHMYDTVKGSDWLGDQDSIEYMVRNAPEAVYELEHWGVPFSRTEEGKIYQRPF 134

Query: 130 GGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCCV 189
           GG    +G+G   QRTCAAADRTGHA+LHT+YGQAL++ AEF+IE+FA+DLI++ +GCC 
Sbjct: 135 GGMTMEFGKGQ-AQRTCAAADRTGHAMLHTMYGQALRHAAEFYIEFFAIDLIMDDQGCCR 193

Query: 190 GVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDMEF 249
           GV+A +L+ G +HRF A+  +LATGGYGRAY S TSAHTCTGDG  M  RAGLPLQDMEF
Sbjct: 194 GVIALKLDDGTLHRFRAQTTILATGGYGRAYASCTSAHTCTGDGGAMALRAGLPLQDMEF 253

Query: 250 VQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEIR 309
           VQFHPTGIYG+GCL+TEGARGEGGYLVNS+GERFMERYAPSAKDLASRDVVSR M +E+R
Sbjct: 254 VQFHPTGIYGSGCLVTEGARGEGGYLVNSEGERFMERYAPSAKDLASRDVVSRAMTIEMR 313

Query: 310 EGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMGG 369
           EGRGVGK KDHI L+L+HL P VL ERLPGISESARIFAGVDVTR+PIP++PTVHYNMGG
Sbjct: 314 EGRGVGKKKDHIFLHLDHLAPEVLAERLPGISESARIFAGVDVTREPIPILPTVHYNMGG 373

Query: 370 IPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIRA 429
           IPTN+ GEV+     +     PGLMAIGEA C SVHGANRLGSNSLIDLVVFGRAA +R 
Sbjct: 374 IPTNFRGEVVTKKEGDDNAVVPGLMAIGEAACVSVHGANRLGSNSLIDLVVFGRAAALRC 433

Query: 430 SEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQDS 489
           +E +  +   P L   S D  + R D+ R+A G  PTA LRE MQ+ MQ +  VFRT + 
Sbjct: 434 AEKLTINGKQPELPADSADGTLSRLDKYRYASGGTPTAKLRESMQQVMQNNCAVFRTGEV 493

Query: 490 LSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRGS 549
           LS+G   +  +   + D+ V DRSL+WNSDLVETLE  NL+I A+ T+ SA  R ESRG+
Sbjct: 494 LSEGKDLIRKVHGGVGDIGVSDRSLVWNSDLVETLEFDNLIIQAVVTMNSAANRTESRGA 553

Query: 550 HAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPKAR 609
           HAREDF D     RDD  W KH+L W+  + G   +DYRPVH   +   V Y  I PK R
Sbjct: 554 HAREDFPD-----RDDKQWMKHTLAWIG-DDGDTTIDYRPVHDYTMTNDVQY--IPPKPR 605

Query: 610 VY 611
           VY
Sbjct: 606 VY 607


>gi|157826657|ref|YP_001495721.1| succinate dehydrogenase flavoprotein subunit [Rickettsia bellii OSU
           85-389]
 gi|157801961|gb|ABV78684.1| succinate dehydrogenase flavoprotein subunit [Rickettsia bellii OSU
           85-389]
          Length = 596

 Score =  795 bits (2053), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/605 (65%), Positives = 470/605 (77%), Gaps = 9/605 (1%)

Query: 7   LKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAAS 66
           +  SY  + H +DV+VVGAGGAGLRA  GMA++G  TACI+K+FPTRSHTVAAQGGI+A+
Sbjct: 1   MTKSYNIIHHKFDVIVVGAGGAGLRAAFGMAKEGLNTACISKLFPTRSHTVAAQGGISAA 60

Query: 67  LANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQ 126
           L NM  D W+WH+YDT+KGSDWLGD DAI+Y+   AP ++ ELEHYGVPFSR E GKIYQ
Sbjct: 61  LGNMGADDWRWHMYDTVKGSDWLGDQDAIEYMCKNAPDAILELEHYGVPFSRTEEGKIYQ 120

Query: 127 RPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEG 186
           RPFGG    YG+G   QRTCAAADRTGHAILHTLY Q+LK+  +FFIEYFA+DL++ + G
Sbjct: 121 RPFGGMTTEYGKGKAAQRTCAAADRTGHAILHTLYQQSLKHKVQFFIEYFAIDLLMEN-G 179

Query: 187 CCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQD 246
            C GVVAW L+ G +H F A  VVLATGGYGRAYFSATSAHTCTGDG GM  RAGLPLQD
Sbjct: 180 ECRGVVAWNLDDGSLHCFRAHNVVLATGGYGRAYFSATSAHTCTGDGGGMAIRAGLPLQD 239

Query: 247 MEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMM 306
           MEFVQFHPTGIY AGCLITEGARGEGGYLVN+ GERFMERYAP+AKDLASRDVVSR M +
Sbjct: 240 MEFVQFHPTGIYSAGCLITEGARGEGGYLVNANGERFMERYAPAAKDLASRDVVSRAMTI 299

Query: 307 EIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYN 366
           EIREGRGVG+ KDH+ L+LNHL P +L  RLPGISE+A+IFAGVDVT++PIPV+PTVHYN
Sbjct: 300 EIREGRGVGEHKDHVFLHLNHLSPEILHSRLPGISETAKIFAGVDVTKEPIPVLPTVHYN 359

Query: 367 MGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAV 426
           MGGIPTNY G+V+  + KN      GLM+IGEA C SVHGANRLGSNSL+DLVVFGR+A 
Sbjct: 360 MGGIPTNYHGQVIIKDGKNHNSVVKGLMSIGEAACVSVHGANRLGSNSLLDLVVFGRSAA 419

Query: 427 IRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRT 486
           ++A+E+I  +S    +   + ++I+ RFD++RH+ G++  A LR KMQR MQ  A VFRT
Sbjct: 420 LKAAELIKPASLHKPVSEEALEKIISRFDKIRHSSGNISVADLRLKMQRTMQSHASVFRT 479

Query: 487 QDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKES 546
           Q+ L +G   +S +     D+KV+D+SLIWNSDLVE LEL NL+  A+ TVYSA ARKES
Sbjct: 480 QEVLDEGAEMISEIRSGYKDIKVNDKSLIWNSDLVEALELDNLLDQALVTVYSAAARKES 539

Query: 547 RGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAP 606
           RG+HARED+ D     R+D  W +H+L  VD   GK+ LDY+PV    L   V    I P
Sbjct: 540 RGAHAREDYPD-----RNDKEWMQHTLSGVD-EAGKVVLDYKPVTLTTLSDEV--KAIPP 591

Query: 607 KARVY 611
             RVY
Sbjct: 592 AKRVY 596


>gi|239947120|ref|ZP_04698873.1| succinate dehydrogenase, flavoprotein subunit [Rickettsia
           endosymbiont of Ixodes scapularis]
 gi|241068575|ref|XP_002408474.1| succinate dehydrogenase, putative [Ixodes scapularis]
 gi|215492462|gb|EEC02103.1| succinate dehydrogenase, putative [Ixodes scapularis]
 gi|239921396|gb|EER21420.1| succinate dehydrogenase, flavoprotein subunit [Rickettsia
           endosymbiont of Ixodes scapularis]
          Length = 596

 Score =  794 bits (2051), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/605 (64%), Positives = 473/605 (78%), Gaps = 9/605 (1%)

Query: 7   LKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAAS 66
           +  +Y  + H +DVVVVGAGGAGLR+  GMA++G  TACITK+FPTRSHTVAAQGGI+A+
Sbjct: 1   MTKAYNIIHHKFDVVVVGAGGAGLRSAFGMAKEGLNTACITKLFPTRSHTVAAQGGISAA 60

Query: 67  LANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQ 126
           L NM  D W+WH+YDT+KGSDWLGD DAI+Y+   AP ++ ELEH GVPFSR E GKIYQ
Sbjct: 61  LGNMGEDDWRWHMYDTVKGSDWLGDQDAIEYMCKNAPDAILELEHCGVPFSRTEEGKIYQ 120

Query: 127 RPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEG 186
           RPFGG    YG+G   QRTCAAADRTGHAILHTLY Q+LK+  +FF+EYFA+DL++  +G
Sbjct: 121 RPFGGMTTEYGKGKAAQRTCAAADRTGHAILHTLYQQSLKHKVQFFVEYFAIDLLM-EDG 179

Query: 187 CCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQD 246
            C GVVAW L+ G ++ F A  VVLATGGYGRAYFSATSAHTCTGDG GM  RAGLPLQD
Sbjct: 180 ECRGVVAWNLDDGSLYCFRAHNVVLATGGYGRAYFSATSAHTCTGDGGGMAIRAGLPLQD 239

Query: 247 MEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMM 306
           MEFVQFHPTGIY AGCLITEGARGEGGYLVN+ GERFMERYAP+AKDLASRDVVSR M +
Sbjct: 240 MEFVQFHPTGIYSAGCLITEGARGEGGYLVNANGERFMERYAPAAKDLASRDVVSRAMTI 299

Query: 307 EIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYN 366
           EIREGRGVGK KDH+ L+LNHL P +L  RLPGISE+A+IFAGVDVT++PIPV+PTVHYN
Sbjct: 300 EIREGRGVGKHKDHVFLHLNHLSPEILHSRLPGISETAKIFAGVDVTKEPIPVLPTVHYN 359

Query: 367 MGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAV 426
           MGGIPTNY G+V+  +  N      GLMAIGEA C SVHGANRLGSNSL+DLVVFGR++ 
Sbjct: 360 MGGIPTNYHGQVIIKDGTNHNNVVKGLMAIGEAACVSVHGANRLGSNSLLDLVVFGRSSA 419

Query: 427 IRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRT 486
           ++A+++I  +SP   L   S +++++RFD++RHA+G++  A LR KMQR MQ  A VFRT
Sbjct: 420 LKAADLIKPASPHRPLKEESLEKVINRFDKIRHANGNILVADLRLKMQRTMQSHASVFRT 479

Query: 487 QDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKES 546
           Q+ L +G   +S +     D+K++D+SLIWNSDLVE LEL NL+  A+ TVYSA ARKES
Sbjct: 480 QEVLDEGAGMISEIRSGYKDIKINDKSLIWNSDLVEALELDNLLDQALVTVYSAAARKES 539

Query: 547 RGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAP 606
           RG+HARED+ D     R+D +W KH+L  +D   GK+ LDY+PV    L   +  S I P
Sbjct: 540 RGAHAREDYPD-----RNDGDWMKHTLSSID-EAGKVVLDYKPVTLTTLTDEI--SAIPP 591

Query: 607 KARVY 611
             RVY
Sbjct: 592 AKRVY 596


>gi|326467055|gb|ADZ75464.1| succinate dehydrogenase [Litchi chinensis]
          Length = 628

 Score =  794 bits (2050), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/608 (65%), Positives = 480/608 (78%), Gaps = 9/608 (1%)

Query: 4   SSNLKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGI 63
           S++    YT VDH+YD VVVGAGGAGLRA +G++E GF TACITK+FPTRSHTVAAQGGI
Sbjct: 30  STDSTGGYTVVDHTYDAVVVGAGGAGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGI 89

Query: 64  AASLANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGK 123
            A+L NMT D  +WH+YDT+KGSDWLGD DAIQY+  EAP++V ELE+YG+PFSR E GK
Sbjct: 90  NAALGNMTEDDRRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFSRTEDGK 149

Query: 124 IYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIIN 183
           IYQR FGG   ++G+G    R   AADRTGHA+LHTLYGQA+K+N +FF+EYFALDLI+N
Sbjct: 150 IYQRAFGGQSLDFGKGGQAYRRACAADRTGHALLHTLYGQAMKHNTQFFVEYFALDLIMN 209

Query: 184 SEGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLP 243
           S+G C GV+A  LE G +HRF A   +LATGGYGRAYFSATSAHTCTGDG  MVARAGLP
Sbjct: 210 SDGSCQGVIALNLEDGTLHRFQAASTILATGGYGRAYFSATSAHTCTGDGNAMVARAGLP 269

Query: 244 LQDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRC 303
           LQD+EFVQFHPTGIYGAGCLITEG+RGEGG L NS+GERFMERYAP+AKDLASRDVVSR 
Sbjct: 270 LQDLEFVQFHPTGIYGAGCLITEGSRGEGGILRNSEGERFMERYAPTAKDLASRDVVSRS 329

Query: 304 MMMEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTV 363
           M MEIREGRGVG  KDHI+L+LNHL P VL+ERLPGISE+A IFAGVDVT++PIPV+PTV
Sbjct: 330 MTMEIREGRGVGPLKDHIYLHLNHLPPDVLKERLPGISETAAIFAGVDVTKEPIPVLPTV 389

Query: 364 HYNMGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGR 423
           HYNMGGIPTN+ GEV+    K+P+   PGLMA GEA CASVHG+NRLG+NSL+D+VVFGR
Sbjct: 390 HYNMGGIPTNHHGEVVTIKGKDPDAVIPGLMAAGEAACASVHGSNRLGANSLLDIVVFGR 449

Query: 424 AAVIRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGV 483
           A   R +E+         L   +  R +   D++R+++G +PT+ +R  MQR MQ +A V
Sbjct: 450 ACANRVAEIQRPGEKQKPLVKDAGQRTIAWLDKIRNSNGSIPTSKIRLNMQRIMQNNAAV 509

Query: 484 FRTQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEAR 543
           FRTQ++L++GC+ +   WD   ++K+ DRSLIWNSDL+ET+EL+NL+INA  T++SAEAR
Sbjct: 510 FRTQETLAEGCQLIDKAWDSFHNVKLADRSLIWNSDLIETIELENLLINARITMHSAEAR 569

Query: 544 KESRGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSK 603
           KESRG+HAREDF       RDD NW KH+L +  W   K++LDYRPVH   L   V+   
Sbjct: 570 KESRGAHAREDFTI-----RDDQNWMKHTLGY--WENEKVRLDYRPVHMNTLDDEVE--S 620

Query: 604 IAPKARVY 611
             PKARVY
Sbjct: 621 FPPKARVY 628


>gi|92119077|ref|YP_578806.1| succinate dehydrogenase flavoprotein subunit [Nitrobacter
           hamburgensis X14]
 gi|91801971|gb|ABE64346.1| succinate dehydrogenase subunit A [Nitrobacter hamburgensis X14]
          Length = 607

 Score =  794 bits (2050), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/601 (65%), Positives = 469/601 (78%), Gaps = 9/601 (1%)

Query: 11  YTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLANM 70
           Y   DH+YDVVVVGAGGAGLRAT+G  + G +TACITKVFPTRSHTVAAQGGI+ASL NM
Sbjct: 16  YPIEDHTYDVVVVGAGGAGLRATVGCGKAGLRTACITKVFPTRSHTVAAQGGISASLGNM 75

Query: 71  TPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRPFG 130
             D W+WH+YDT+KGSDWLGD D I+Y+   AP++VYELEH+GVPFSR E GKIYQRPFG
Sbjct: 76  HKDDWRWHMYDTVKGSDWLGDQDCIEYMVRNAPEAVYELEHWGVPFSRTEEGKIYQRPFG 135

Query: 131 GHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCCVG 190
           G   +YG+    QRTCAAADRTGHA+LHT+YGQAL++ AEFFIE+FA+DLI++ +G C G
Sbjct: 136 GMTIDYGKSQ-AQRTCAAADRTGHAMLHTMYGQALRHAAEFFIEFFAIDLIMDDQGVCRG 194

Query: 191 VVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDMEFV 250
           V+A +L+ G +HRF A+  +LATGGYGRAY S TSAH CTGDG GM  RAGLPLQDMEFV
Sbjct: 195 VIALKLDDGTLHRFRAQTTILATGGYGRAYASCTSAHICTGDGGGMALRAGLPLQDMEFV 254

Query: 251 QFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEIRE 310
           QFHPTGIYG+GCL+TEGARGEGGYLVN++GERFMERYAPSAKDLASRDVVSR M +EIRE
Sbjct: 255 QFHPTGIYGSGCLVTEGARGEGGYLVNAEGERFMERYAPSAKDLASRDVVSRAMTIEIRE 314

Query: 311 GRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMGGI 370
           GRGVGK KDHI L+L+HLDP VL ERLPGISES +IFAGVDVTR+PIP++PTVHYNMGGI
Sbjct: 315 GRGVGKKKDHIFLHLDHLDPKVLHERLPGISESVKIFAGVDVTREPIPILPTVHYNMGGI 374

Query: 371 PTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIRAS 430
           PTNY GEV+   + +     PGLMA+GEA C SVHGANRLGSNSLIDLVVFGRAA +  +
Sbjct: 375 PTNYHGEVVTKKTGDDNALVPGLMAVGEAACVSVHGANRLGSNSLIDLVVFGRAAALHCA 434

Query: 431 EMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQDSL 490
           E +  ++  P L  +S +  + R DR R+A G  PTA LRE MQR MQ +  VFRT D L
Sbjct: 435 EKLTANARQPDLPANSGEMALSRLDRFRYASGGTPTARLRESMQRVMQANCAVFRTHDIL 494

Query: 491 SDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRGSH 550
           ++G + +  + D +AD+ V DRSL+WN+DL+ET+E  NL+  A+ T+ SA  R ESRG+H
Sbjct: 495 TEGQKLIHEVHDGIADVAVFDRSLVWNTDLMETMEYDNLISQAVVTMDSAANRTESRGAH 554

Query: 551 AREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPKARV 610
           ARED+ D     RDD NW KHSL  +  + G   +DYRPVH   +    D   I PKARV
Sbjct: 555 AREDYPD-----RDDQNWMKHSLARLS-DRGVTTIDYRPVHDYTMTN--DVQSIPPKARV 606

Query: 611 Y 611
           Y
Sbjct: 607 Y 607


>gi|71082948|ref|YP_265667.1| succinate dehydrogenase flavoprotein subunit [Candidatus
           Pelagibacter ubique HTCC1062]
 gi|71062061|gb|AAZ21064.1| succinate dehydrogenase [Candidatus Pelagibacter ubique HTCC1062]
          Length = 590

 Score =  793 bits (2049), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/603 (63%), Positives = 461/603 (76%), Gaps = 14/603 (2%)

Query: 9   SSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLA 68
           SSY  +DH YDV+V+GAGG+GLRA +G++E G KTACI+KVFPTRSHT AAQGGI+ASL 
Sbjct: 2   SSYKIIDHEYDVIVLGAGGSGLRAAVGLSEAGLKTACISKVFPTRSHTSAAQGGISASLG 61

Query: 69  NMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRP 128
           NM  D W+WH+YDT+KG+DWLGD D+I+YL  EAP +V ELE YGVPFSR + GKIYQRP
Sbjct: 62  NMGEDDWRWHMYDTVKGADWLGDQDSIEYLCKEAPAAVIELEKYGVPFSRTDDGKIYQRP 121

Query: 129 FGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCC 188
           FGG  +NYG G  VQRTCAAADRTGHAILHTLYGQALK+N EFFIEYFALDL++  +G C
Sbjct: 122 FGGMTKNYGNGI-VQRTCAAADRTGHAILHTLYGQALKHNTEFFIEYFALDLLMK-DGEC 179

Query: 189 VGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDME 248
            G++AW L  G IHRF A   ++ATGGYG+AY+SATSAHTCTGDG  MV RAGLPLQDME
Sbjct: 180 KGLIAWNLNDGTIHRFRAHSTIIATGGYGKAYYSATSAHTCTGDGNAMVLRAGLPLQDME 239

Query: 249 FVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEI 308
           FVQFHPTGIYG G LI+EG RGEGGYLVNSKGERFMERYAP AKDLASRDVVSR M +EI
Sbjct: 240 FVQFHPTGIYGHGTLISEGVRGEGGYLVNSKGERFMERYAPKAKDLASRDVVSRSMSIEI 299

Query: 309 REGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMG 368
            EGRGVGK +DH+HL+L+HLD  +++ RLPGI+E+AR+FA VDVT++PIPV+PTVHYNMG
Sbjct: 300 NEGRGVGKEQDHVHLHLSHLDKNIIESRLPGITEAARLFANVDVTKEPIPVVPTVHYNMG 359

Query: 369 GIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIR 428
           GIPTNY  EVL  N        PGLMAIGEA C SVHGANRLGSNSLIDLVVFGRAA  R
Sbjct: 360 GIPTNYKAEVLTGNDSET---VPGLMAIGEAACVSVHGANRLGSNSLIDLVVFGRAAAKR 416

Query: 429 ASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQD 488
           A+E++   +P   +  +  ++ ++RFD+LR+++G   TA LR  MQ+ MQ    VFRT+ 
Sbjct: 417 AAELVKPGTPHEDIGEAETEKCLERFDKLRNSNGENSTAELRLSMQKTMQSKCAVFRTEK 476

Query: 489 SLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRG 548
           +L +G  N+   +D M  + V D+SL++N+DLVETLE  NL+  AI TV SA  R+ESRG
Sbjct: 477 TLKEGVDNIRKAYDGMESISVKDKSLVFNTDLVETLEFDNLIRQAITTVDSAYNRQESRG 536

Query: 549 SHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPKA 608
           +HAREDF       RDD  + +H++ W +    KI   YRPV    L   V Y    P+ 
Sbjct: 537 AHAREDFPK-----RDDEKFMQHTIAWCNGKDSKI--GYRPVTKTTLTNEVQY--FPPQE 587

Query: 609 RVY 611
           RVY
Sbjct: 588 RVY 590


>gi|91762628|ref|ZP_01264593.1| succinate dehydrogenase [Candidatus Pelagibacter ubique HTCC1002]
 gi|91718430|gb|EAS85080.1| succinate dehydrogenase [Candidatus Pelagibacter ubique HTCC1002]
          Length = 590

 Score =  793 bits (2048), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/603 (63%), Positives = 464/603 (76%), Gaps = 14/603 (2%)

Query: 9   SSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLA 68
           SSY  +DH YDV+V+GAGG+GLRA +G++E G KTACI+KVFPTRSHT AAQGGI+ASL 
Sbjct: 2   SSYKIIDHEYDVIVLGAGGSGLRAAVGLSEAGLKTACISKVFPTRSHTSAAQGGISASLG 61

Query: 69  NMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRP 128
           NM  D W+WH+YDT+KG+DWLGD D+I+YL  EAP +V ELE YGVPFSR + GKIYQRP
Sbjct: 62  NMGEDDWRWHMYDTVKGADWLGDQDSIEYLCKEAPAAVIELEKYGVPFSRTDDGKIYQRP 121

Query: 129 FGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCC 188
           FGG  +NYG G  VQRTCAAADRTGHAILHTLYGQALK+N EFFIEYFALDL++  +G C
Sbjct: 122 FGGMTKNYGNGI-VQRTCAAADRTGHAILHTLYGQALKHNTEFFIEYFALDLLMK-DGEC 179

Query: 189 VGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDME 248
            G++AW L  G IHRF A   ++ATGGYG+AY+SATSAHTCTGDG  MV RAGLPLQDME
Sbjct: 180 KGLIAWNLNDGTIHRFRAHSTIIATGGYGKAYYSATSAHTCTGDGNAMVLRAGLPLQDME 239

Query: 249 FVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEI 308
           FVQFHPTGIYG G LI+EG RGEGGYLVNSKGERFMERYAP AKDLASRDVVSR M +EI
Sbjct: 240 FVQFHPTGIYGHGTLISEGVRGEGGYLVNSKGERFMERYAPKAKDLASRDVVSRSMSIEI 299

Query: 309 REGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMG 368
            EGRGVGK +DH+HL+L+HLD ++++ RLPGI+E+AR+FA VDVT++PIPV+PTVHYNMG
Sbjct: 300 NEGRGVGKEQDHVHLHLSHLDKSIIESRLPGITEAARLFANVDVTKEPIPVVPTVHYNMG 359

Query: 369 GIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIR 428
           GIPTNY  EVL    K+ E   PGLMAIGEA C SVHGANRLGSNSLIDLVVFGRAA  R
Sbjct: 360 GIPTNYKAEVL--TGKDSET-VPGLMAIGEAACVSVHGANRLGSNSLIDLVVFGRAAAKR 416

Query: 429 ASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQD 488
           A+E++   +P   +  +  ++ ++RFD+LR+++G   TA LR  MQ+ MQ    VFRT+ 
Sbjct: 417 AAELVKPGTPHEDIGETETEKCLERFDKLRNSNGENSTAELRLSMQKTMQSKCAVFRTEK 476

Query: 489 SLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRG 548
           +L +G  N+   +D M  + V D+SL++N+DLVETLE  NL+  AI TV SA  R+ESRG
Sbjct: 477 TLKEGVDNIRKAYDGMESISVKDKSLVFNTDLVETLEFDNLIRQAITTVDSAYNRQESRG 536

Query: 549 SHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPKA 608
           +HAREDF       RDD  + +H++ W +    KI   YRPV    L   V Y    P+ 
Sbjct: 537 AHAREDFPK-----RDDEKFMQHTIAWCNGKDSKI--GYRPVTKTTLTNEVQY--FPPQE 587

Query: 609 RVY 611
           RVY
Sbjct: 588 RVY 590


>gi|224134312|ref|XP_002327807.1| predicted protein [Populus trichocarpa]
 gi|222836892|gb|EEE75285.1| predicted protein [Populus trichocarpa]
          Length = 638

 Score =  793 bits (2048), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/608 (65%), Positives = 482/608 (79%), Gaps = 17/608 (2%)

Query: 9   SSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLA 68
           SSYT VDH+YD VVVGAGGAGLRA +G++E GF TACITK+FPTRSHTVAAQGGI A+L 
Sbjct: 43  SSYTVVDHTYDAVVVGAGGAGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALG 102

Query: 69  NMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRP 128
           NMT D W+WH+YDT+KGSDWLGD DAIQY+  EAP++V ELE+YG+PFSR E GKIYQR 
Sbjct: 103 NMTEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFSRTEDGKIYQRA 162

Query: 129 FGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCC 188
           FGG   ++G+G    R   AADRTGHA+LHTLYGQA+++N +FF+EYFALDL++N++G C
Sbjct: 163 FGGQSLDFGKGGQAYRCACAADRTGHALLHTLYGQAMRHNTQFFVEYFALDLLMNNDGSC 222

Query: 189 VGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDME 248
            GV+A  +E G +HRF A   +LATGGYGRAYFSATSAHTCTGDG  MVARAG+PL+D+E
Sbjct: 223 QGVIALNMEDGTLHRFCAASTILATGGYGRAYFSATSAHTCTGDGNAMVARAGVPLEDLE 282

Query: 249 FVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEI 308
           FVQFHPTGIYGAGCLITEG+RGEGG L NS+GERFMERYAP+AKDLASRDVVSR M MEI
Sbjct: 283 FVQFHPTGIYGAGCLITEGSRGEGGILRNSEGERFMERYAPTAKDLASRDVVSRSMTMEI 342

Query: 309 REGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMG 368
           REGRGVG  KDHI+L+LNHL P VL+ERLPGISE+A IFAGVDVT++PIPV+PTVHYNMG
Sbjct: 343 REGRGVGPLKDHIYLHLNHLPPDVLKERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMG 402

Query: 369 GIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIR 428
           GIPTNY GEV+     +P+   PGLMA GEA CASVHGANRLG+NSL+D+VVFGRA   R
Sbjct: 403 GIPTNYHGEVVTLKGDDPDAVVPGLMAAGEAACASVHGANRLGANSLLDIVVFGRACANR 462

Query: 429 ASEM-----IDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGV 483
            +++     ++K  P   L+  + +R +   D+LR+++G + T+ +R  MQR MQ +A V
Sbjct: 463 VAKIHRPGKLNKQKP---LEKDAGERTIAWLDKLRNSNGSLSTSHIRLNMQRTMQNNAAV 519

Query: 484 FRTQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEAR 543
           FRTQ++L +GC  +   W+   D+KV DRSLIWNSDL+ETLEL+NL+INA  T++SAEAR
Sbjct: 520 FRTQETLEEGCHLIDKAWESFHDVKVKDRSLIWNSDLIETLELENLLINACVTMHSAEAR 579

Query: 544 KESRGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSK 603
           KESRG+HAREDF       RDD NW KH+L +  W   K++LDYRPVH   L   ++   
Sbjct: 580 KESRGAHAREDFTK-----RDDENWMKHTLGY--WENEKVRLDYRPVHMNTLDDEIE--P 630

Query: 604 IAPKARVY 611
             PKARVY
Sbjct: 631 FPPKARVY 638


>gi|254292679|ref|YP_003058702.1| succinate dehydrogenase flavoprotein subunit [Hirschia baltica ATCC
           49814]
 gi|254041210|gb|ACT58005.1| succinate dehydrogenase or fumarate reductase, flavoprotein subunit
           [Hirschia baltica ATCC 49814]
          Length = 596

 Score =  792 bits (2046), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/604 (66%), Positives = 474/604 (78%), Gaps = 10/604 (1%)

Query: 9   SSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLA 68
           S Y +VDH++DVVVVGAGG+GLRA LG A+ G KTACI+KVFPTRSHTVAAQGGIAASL 
Sbjct: 2   SEYEWVDHTFDVVVVGAGGSGLRAALGAAQAGLKTACISKVFPTRSHTVAAQGGIAASLG 61

Query: 69  NMTP-DSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQR 127
           NM   D W+WH+YDT+KGSDWLGD D+I+YL   AP +VYELEH+G+PFSR + G+IYQR
Sbjct: 62  NMEGGDDWRWHMYDTVKGSDWLGDQDSIEYLVRHAPDAVYELEHWGMPFSRTDKGEIYQR 121

Query: 128 PFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGC 187
            FGG  + YG GP  QRTCAAADRTGHA+LHTLYGQ+LK + EFFIE+F +DLI++ EG 
Sbjct: 122 AFGGMTREYGNGP-AQRTCAAADRTGHAMLHTLYGQSLKYDVEFFIEHFGMDLIMDDEGA 180

Query: 188 CVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDM 247
           C GV  WQL+ G +HRF A+ V+LATGGYGR++FS TSAHTCTGDG  MV RAGLPLQDM
Sbjct: 181 CRGVTTWQLDDGTMHRFRAQRVILATGGYGRSFFSCTSAHTCTGDGNAMVLRAGLPLQDM 240

Query: 248 EFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMME 307
           EFVQFHPTGIYG+GCLITEGARGEGGYL NS+GERFMERYAPSAKDLASRDVVSR M ME
Sbjct: 241 EFVQFHPTGIYGSGCLITEGARGEGGYLTNSQGERFMERYAPSAKDLASRDVVSRSMTME 300

Query: 308 IREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNM 367
           IREGRGVG  KDHI L+L+HLDP +L  RLPGISESAR+FAGVDVT++PIPVIPTVHYNM
Sbjct: 301 IREGRGVGPEKDHIFLHLDHLDPDILAARLPGISESARVFAGVDVTKEPIPVIPTVHYNM 360

Query: 368 GGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVI 427
           GGIPTNY GEVL     +P+   PGLMA+GEA C SVHGANRLGSNSLIDLVVFGRAA +
Sbjct: 361 GGIPTNYHGEVLTKKGDDPDAVVPGLMAVGEAACVSVHGANRLGSNSLIDLVVFGRAAGL 420

Query: 428 RASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQ 487
           R  E ++ +   P L  ++ +  ++R D+ R+A G  PTA LR +MQ+ MQ +  V+RT 
Sbjct: 421 RCGEKLEVNGRQPELPKNAGNNAIERLDKYRNAKGGTPTAKLRLQMQKVMQSNCAVYRTG 480

Query: 488 DSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESR 547
           ++L +G   ++  ++ M DL V D SLIWN+DLVETLE+ NL+  A  TV  A  RKESR
Sbjct: 481 ETLEEGVTKIAECYESMPDLAVTDTSLIWNTDLVETLEMDNLIAQAAVTVNGAANRKESR 540

Query: 548 GSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPK 607
           G+HAREDF D     R+D  W KH+L W D + G +K+DYRPVH   +   ++Y  I PK
Sbjct: 541 GAHAREDFSD-----RNDPEWMKHTLAWCD-DKGNVKIDYRPVHEYTMSDDIEY--IVPK 592

Query: 608 ARVY 611
           ARVY
Sbjct: 593 ARVY 596


>gi|222636391|gb|EEE66523.1| hypothetical protein OsJ_23002 [Oryza sativa Japonica Group]
          Length = 661

 Score =  792 bits (2045), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/638 (63%), Positives = 479/638 (75%), Gaps = 40/638 (6%)

Query: 5   SNLKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIA 64
           S   SSYT VDHSYD VVVGAGGAGLRA +G++E GF TACITK+FPTRSHTVAAQGGI 
Sbjct: 33  STASSSYTVVDHSYDAVVVGAGGAGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGIN 92

Query: 65  ASLANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKI 124
           A+L NMT D W+WH+YDT+KGSDWLGD D+IQY+  EAP++V ELE+YG+PFSR E GKI
Sbjct: 93  AALGNMTEDDWRWHMYDTVKGSDWLGDQDSIQYMCREAPKAVIELENYGLPFSRTEDGKI 152

Query: 125 YQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINS 184
           YQR FGG   ++G+G    R   AADRTGHA+LHTLYGQA+K+N +FF+EYFALDLI++S
Sbjct: 153 YQRAFGGQSLDFGKGGQAYRCACAADRTGHAMLHTLYGQAMKHNTQFFVEYFALDLIMDS 212

Query: 185 EGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPL 244
           EG C GV+A  +E G +HRF A   +LATGGYGRAYFSATSAHTCTGDG  MVARAGLPL
Sbjct: 213 EGTCQGVIALNMEDGTLHRFRATNTILATGGYGRAYFSATSAHTCTGDGNAMVARAGLPL 272

Query: 245 Q-------------------------------DMEFVQFHPTGIYGAGCLITEGARGEGG 273
           Q                               D+EFVQFHPTGIYGAGCLITEG+RGEGG
Sbjct: 273 QGYGRAYFSATSAHTCTGDGNAMVARAGLPLQDLEFVQFHPTGIYGAGCLITEGSRGEGG 332

Query: 274 YLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEIREGRGVGKSKDHIHLYLNHLDPAVL 333
            L NS+GERFMERYAP+AKDLASRDVVSR M MEIREGRGVG  KDHI+L+LNHL P VL
Sbjct: 333 ILRNSEGERFMERYAPTAKDLASRDVVSRSMTMEIREGRGVGPLKDHIYLHLNHLPPEVL 392

Query: 334 QERLPGISESARIFAGVDVTRDPIPVIPTVHYNMGGIPTNYWGEVLDANSKNPERFAPGL 393
           +ERLPGISE+A IFAGVDVT++PIPV+PTVHYNMGGIPTNY GEV+     NP+   PGL
Sbjct: 393 KERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTNYHGEVVTMKGDNPDSVVPGL 452

Query: 394 MAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIRASEMIDKSSPIPSLDISSCDRIMDR 453
           MA GEA CASVHGANRLG+NSL+D+VVFGRA   R +E          L  S+ ++ +  
Sbjct: 453 MAAGEAACASVHGANRLGANSLLDIVVFGRACANRVAETAKPGEKQKPLQKSAGEKTIAW 512

Query: 454 FDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQDSLSDGCRNLSCLWDEMADLKVHDRS 513
            D+LR+A+G +PT+ +R  MQR MQ +A VFRTQ++L +GC+ ++  W+   D+K+ DRS
Sbjct: 513 LDKLRNANGSLPTSKIRLNMQRVMQNNAAVFRTQETLEEGCKLITKAWESYHDVKISDRS 572

Query: 514 LIWNSDLVETLELQNLMINAIATVYSAEARKESRGSHAREDFKDGEFGGRDDVNWRKHSL 573
           LIWNSDL+ET+EL+NL+INA  T++SAEARKESRG+HAREDF       RDD  W KHSL
Sbjct: 573 LIWNSDLIETIELENLLINACITMHSAEARKESRGAHAREDFTK-----RDDEQWMKHSL 627

Query: 574 CWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPKARVY 611
            +  W   K++L YRPVH   L   V+     PKARVY
Sbjct: 628 GY--WENEKVRLAYRPVHMNTLDSEVE--SFPPKARVY 661


>gi|157803315|ref|YP_001491864.1| succinate dehydrogenase flavoprotein subunit [Rickettsia canadensis
           str. McKiel]
 gi|157784578|gb|ABV73079.1| succinate dehydrogenase [Rickettsia canadensis str. McKiel]
          Length = 596

 Score =  791 bits (2042), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/605 (64%), Positives = 471/605 (77%), Gaps = 9/605 (1%)

Query: 7   LKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAAS 66
           +  +Y  + H +DVVVVGAGGAGLR+  GMA++G  TAC+TK+FPTRSHTVAAQGGI+A+
Sbjct: 1   MTKAYNIIHHKFDVVVVGAGGAGLRSAFGMAKEGLNTACVTKLFPTRSHTVAAQGGISAA 60

Query: 67  LANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQ 126
           L NM  D W+WH+YDT+KGSDWLGD DAI+Y+   A  +V ELEHYGVPFSR E GKIYQ
Sbjct: 61  LGNMGEDDWRWHMYDTVKGSDWLGDQDAIEYMCKNAADAVLELEHYGVPFSRTEEGKIYQ 120

Query: 127 RPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEG 186
           RPFGG    YG+G    RTCAAADRTGH ILHTLY Q+LK+  +FF+EYFA+DL++  +G
Sbjct: 121 RPFGGMTTEYGKGKAAYRTCAAADRTGHVILHTLYQQSLKHKVQFFVEYFAIDLLM-EDG 179

Query: 187 CCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQD 246
            C GVVAW L+ G +H F A  VVLATGGYGRAYFSATSAHTCTGDG GM  RAGLPLQD
Sbjct: 180 QCRGVVAWNLDDGSMHCFRAHNVVLATGGYGRAYFSATSAHTCTGDGGGMAIRAGLPLQD 239

Query: 247 MEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMM 306
           MEFVQFHPTGIY AGCLITEGARGEGGYLVN+ GERFMERYAP+ KDLASRDVVSR M +
Sbjct: 240 MEFVQFHPTGIYSAGCLITEGARGEGGYLVNANGERFMERYAPATKDLASRDVVSRAMTI 299

Query: 307 EIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYN 366
           EIREGRGVGK KDH+ L+LNHL P +L  RLPGI+E+A+IFAGVDVT++PIPV+PTVHYN
Sbjct: 300 EIREGRGVGKYKDHVFLHLNHLSPEILYSRLPGIAETAKIFAGVDVTKEPIPVLPTVHYN 359

Query: 367 MGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAV 426
           MGGIPTNY G+V+    +N      GLMAIGEA C SVHGANRLGSNSL+DLVVFGR++ 
Sbjct: 360 MGGIPTNYHGQVIIKEGENHNTIVKGLMAIGEAACVSVHGANRLGSNSLLDLVVFGRSSA 419

Query: 427 IRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRT 486
           ++A+E+I  +SP  SL   S +++++RFD++RH++G++  A LR KMQR MQ  A +FRT
Sbjct: 420 LKAAELIKPASPHKSLKEESLEKVINRFDKVRHSNGNILVADLRLKMQRTMQSHAAIFRT 479

Query: 487 QDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKES 546
           Q+ L +G   +S +     D+KV+D+SLIWNSDLVE LEL NL+  A+ TVYSA ARKES
Sbjct: 480 QEVLDEGAEMISEIRAGYKDIKVNDKSLIWNSDLVEALELDNLLDQALVTVYSAAARKES 539

Query: 547 RGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAP 606
           RG+HARED+ D     R+D++W KH+L  ++ + G + LDY+PV    L   V    I P
Sbjct: 540 RGAHAREDYPD-----RNDLDWMKHTLSSIN-DVGTVVLDYKPVTLTTLTDEV--KAIPP 591

Query: 607 KARVY 611
             RVY
Sbjct: 592 AKRVY 596


>gi|209967180|ref|YP_002300095.1| succinate dehydrogenase flavoprotein subunit [Rhodospirillum
           centenum SW]
 gi|209960646|gb|ACJ01283.1| succinate dehydrogenase, flavoprotein subunit [Rhodospirillum
           centenum SW]
          Length = 596

 Score =  791 bits (2042), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 406/605 (67%), Positives = 469/605 (77%), Gaps = 9/605 (1%)

Query: 7   LKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAAS 66
           + ++Y   DH YDVVVVGAGGAGLRAT GMAEKG KTACITKVFPTRSHTVAAQGGI+A+
Sbjct: 1   MATAYPITDHYYDVVVVGAGGAGLRATFGMAEKGLKTACITKVFPTRSHTVAAQGGISAA 60

Query: 67  LANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQ 126
           L NM  D W++H+YDT+KGSDWLGD DAI+Y+  EA  ++ ELEHYGVPFSR   GKIYQ
Sbjct: 61  LGNMGEDDWRYHMYDTVKGSDWLGDQDAIEYMCREAIPAIIELEHYGVPFSRTAEGKIYQ 120

Query: 127 RPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEG 186
           R FGG    YGEG    RTCAAADRTGHAILHTLY Q+LK+ AEFF+EYFALDLI++ EG
Sbjct: 121 RAFGGMTTRYGEGR-AYRTCAAADRTGHAILHTLYQQSLKHQAEFFVEYFALDLIMDDEG 179

Query: 187 CCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQD 246
            C GV+AW L+ G IHRF A   VLATGGYGRAYFS TSAHT TGDG GM  RAGLPLQD
Sbjct: 180 VCRGVLAWNLDDGTIHRFRAHQTVLATGGYGRAYFSCTSAHTSTGDGGGMALRAGLPLQD 239

Query: 247 MEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMM 306
           MEFVQFHPTG+YGAGCLITEG RGEGGYL N+KGERFMERYAPSAKDLASRDVVSR M +
Sbjct: 240 MEFVQFHPTGVYGAGCLITEGVRGEGGYLTNAKGERFMERYAPSAKDLASRDVVSRSMTI 299

Query: 307 EIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYN 366
           EIREGRGVG+  DHIHL+L HLDPA++ ERLPGI+E+A+IFAGVDVT++PIPV+PTVHYN
Sbjct: 300 EIREGRGVGEHADHIHLHLEHLDPAIIHERLPGIAETAKIFAGVDVTKEPIPVLPTVHYN 359

Query: 367 MGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAV 426
           MGGIPTNY  EV+  +  +P+R  PGLMAIGEA C SVHGANRLGSNSL+DLVVFGRAA 
Sbjct: 360 MGGIPTNYKAEVVAPHGDDPDRVVPGLMAIGEAACVSVHGANRLGSNSLLDLVVFGRAAA 419

Query: 427 IRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRT 486
           IRA+E++   +P   L  SS D  ++R DR R+A G V  A LR +MQ+ MQ +  VFRT
Sbjct: 420 IRAAEIVTPGAPHKDLPASSVDHALERLDRHRNAKGEVRVAHLRLEMQKVMQNNCAVFRT 479

Query: 487 QDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKES 546
            + L +G   +   W++   + V DRSLIWNSDLVE LEL NLM  A+AT+ SA  R+ES
Sbjct: 480 GEVLEEGVELMRKAWEKRPFIGVSDRSLIWNSDLVEALELDNLMYQAVATITSAANRQES 539

Query: 547 RGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAP 606
           RG+HAREDF +     RDD  W KH++ WV  + G + LDYRPVH   L   V      P
Sbjct: 540 RGAHAREDFPE-----RDDETWMKHTVVWVKPD-GDVALDYRPVHMNTLTNEV--QAFPP 591

Query: 607 KARVY 611
           KARVY
Sbjct: 592 KARVY 596


>gi|288957016|ref|YP_003447357.1| succinate dehydrogenase flavoprotein subunit [Azospirillum sp.
           B510]
 gi|288909324|dbj|BAI70813.1| succinate dehydrogenase flavoprotein subunit [Azospirillum sp.
           B510]
          Length = 594

 Score =  790 bits (2041), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/605 (66%), Positives = 481/605 (79%), Gaps = 11/605 (1%)

Query: 7   LKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAAS 66
           + ++YT +DH+YDVVVVGAGGAGLRAT GMAEKG KTACITKVFPTRSHTVAAQGGI+A+
Sbjct: 1   MATAYTIIDHTYDVVVVGAGGAGLRATFGMAEKGLKTACITKVFPTRSHTVAAQGGISAA 60

Query: 67  LANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQ 126
           L NM  D W++H+YDT+KGSDWLGD DAI+Y+  EA  ++ ELEHYGVPFSR   GKIYQ
Sbjct: 61  LGNMGEDDWRYHMYDTVKGSDWLGDQDAIEYMCREAIPAIIELEHYGVPFSRTPEGKIYQ 120

Query: 127 RPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEG 186
           R FGG    YG+     RTCAAADRTGHAILHTLY Q+LK+ AEFF+EYFALDLI+  +G
Sbjct: 121 RAFGGMTAQYGK-TQAYRTCAAADRTGHAILHTLYQQSLKHEAEFFVEYFALDLIME-DG 178

Query: 187 CCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQD 246
            C GV+AW L+ G +HRF  ++VVLATGGYGRAYFSATSAHTCTGDG GM+ RAGLPLQD
Sbjct: 179 VCKGVLAWNLDDGTLHRFRGQMVVLATGGYGRAYFSATSAHTCTGDGGGMILRAGLPLQD 238

Query: 247 MEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMM 306
           MEFVQFHPTGIYG+GCLITEG RGEGGYL NS GERFMERYAPSAKDLASRDVVSR M +
Sbjct: 239 MEFVQFHPTGIYGSGCLITEGVRGEGGYLTNSNGERFMERYAPSAKDLASRDVVSRSMTI 298

Query: 307 EIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYN 366
           EIREGRGVG+ KDHIHL+L HL P ++ +RLPGI+E+A+IFAGVDVT++PIPV+PTVHYN
Sbjct: 299 EIREGRGVGEHKDHIHLHLEHLPPEIIHQRLPGIAETAKIFAGVDVTKEPIPVLPTVHYN 358

Query: 367 MGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAV 426
           MGGIPTN   EVL   + NP++  PGLMAIGEA C SVHGANRLGSNSL+DLVVFGRAA 
Sbjct: 359 MGGIPTNVHCEVLSPTASNPDQVVPGLMAIGEAACVSVHGANRLGSNSLLDLVVFGRAAA 418

Query: 427 IRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRT 486
           IRA+E++ K     S+   SCD+ ++RFDR+R+A G + +A LR +MQR MQ +  VFRT
Sbjct: 419 IRAAEIV-KPGKATSVKPDSCDKALERFDRIRNAKGTIKSADLRLEMQRTMQNNCAVFRT 477

Query: 487 QDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKES 546
            + L +G + +  ++ +  ++ + DRSL+WNSDLVE LEL NL+  A+AT++SA+ R ES
Sbjct: 478 GEVLDEGVKKIDAVYAKKGEMAISDRSLVWNSDLVEALELDNLLGQAVATLHSAQNRPES 537

Query: 547 RGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAP 606
           RG+HARED+ +     RDD  W KH++ WV  N G+ K+DYRPVH   L   V+     P
Sbjct: 538 RGAHAREDYPN-----RDDEGWMKHTVIWVADN-GETKIDYRPVHMYTLTDEVEV--FPP 589

Query: 607 KARVY 611
           KARVY
Sbjct: 590 KARVY 594


>gi|258541137|ref|YP_003186570.1| succinate dehydrogenase flavoprotein subunit [Acetobacter
           pasteurianus IFO 3283-01]
 gi|256632215|dbj|BAH98190.1| succinate dehydrogenase flavoprotein subunit [Acetobacter
           pasteurianus IFO 3283-01]
 gi|256635272|dbj|BAI01241.1| succinate dehydrogenase flavoprotein subunit [Acetobacter
           pasteurianus IFO 3283-03]
 gi|256638327|dbj|BAI04289.1| succinate dehydrogenase flavoprotein subunit [Acetobacter
           pasteurianus IFO 3283-07]
 gi|256641381|dbj|BAI07336.1| succinate dehydrogenase flavoprotein subunit [Acetobacter
           pasteurianus IFO 3283-22]
 gi|256644436|dbj|BAI10384.1| succinate dehydrogenase flavoprotein subunit [Acetobacter
           pasteurianus IFO 3283-26]
 gi|256647491|dbj|BAI13432.1| succinate dehydrogenase flavoprotein subunit [Acetobacter
           pasteurianus IFO 3283-32]
 gi|256650544|dbj|BAI16478.1| succinate dehydrogenase flavoprotein subunit [Acetobacter
           pasteurianus IFO 3283-01-42C]
 gi|256653535|dbj|BAI19462.1| succinate dehydrogenase flavoprotein subunit [Acetobacter
           pasteurianus IFO 3283-12]
          Length = 603

 Score =  788 bits (2035), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/609 (64%), Positives = 468/609 (76%), Gaps = 9/609 (1%)

Query: 3   NSSNLKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGG 62
           N+S  + +Y  VDH+YDVVVVGAGG+GLRATLGM   G  TAC+TKVFPTRSHTVAAQGG
Sbjct: 4   NTSPSRGAYRIVDHAYDVVVVGAGGSGLRATLGMGAAGLSTACVTKVFPTRSHTVAAQGG 63

Query: 63  IAASLANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAG 122
           I ASL NM  D+W+WH+YDT+KGSDWLGD DAI+++  EA  +V ELEH+GVPFSR E G
Sbjct: 64  IGASLGNMAEDNWRWHMYDTVKGSDWLGDQDAIEFMCREAVPAVRELEHFGVPFSRTEDG 123

Query: 123 KIYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLII 182
           KIYQRPFGGHM +YG+ P V R CAAADRTGHAILHTLY Q LK+N EFF+EYFA+DLI+
Sbjct: 124 KIYQRPFGGHMSDYGKAP-VPRACAAADRTGHAILHTLYQQCLKHNVEFFVEYFAIDLIM 182

Query: 183 NSEGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGL 242
           + EG C GV+AW  + G IHRF+AK+VVLATGGYGRAY S TSAHTCTGDG GM  RAG+
Sbjct: 183 DEEGECRGVMAWCQDDGTIHRFNAKMVVLATGGYGRAYQSCTSAHTCTGDGNGMAMRAGI 242

Query: 243 PLQDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSR 302
           P QDMEFVQFHPTGIY AGCL+TEG RGEGGYL NS+GERFMERYAP+AKDLASRDVVSR
Sbjct: 243 PTQDMEFVQFHPTGIYPAGCLLTEGCRGEGGYLTNSEGERFMERYAPTAKDLASRDVVSR 302

Query: 303 CMMMEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPT 362
            M +EI+EGRG G  KDHI ++L HL   +L +RLPGI E+ARIFAGVDVT++P+PV+PT
Sbjct: 303 AMTIEIKEGRGCGPKKDHIMMHLEHLGSDLLHQRLPGIIETARIFAGVDVTKEPVPVLPT 362

Query: 363 VHYNMGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFG 422
           VHYNMGGIPTN  GEV+     NP+   PGLMA+GEA C SVHGANRLG+NSL+DL+VFG
Sbjct: 363 VHYNMGGIPTNIHGEVVRPTPDNPDAVVPGLMAVGEAACVSVHGANRLGTNSLLDLIVFG 422

Query: 423 RAAVIRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAG 482
           RAA  RA+E++  +     L   + +  +DR DRLR+A G    +ALRE++QR MQ  A 
Sbjct: 423 RAASRRAAEVVKPTDFTRPLPAGAGEAALDRLDRLRYAKGGTKVSALRERLQRDMQTHAA 482

Query: 483 VFRTQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEA 542
           VFRTQ+SL +G   +  +W  ++D+ V D SLIWNSDL+E LE +NL+ NA  T+ S  A
Sbjct: 483 VFRTQESLQEGVDKIRDIWTGVSDISVADSSLIWNSDLMEALEFENLLANATVTLESGLA 542

Query: 543 RKESRGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYS 602
           R ESRG+HAR+D+ D     RDD  W KHS+ W+D + G +KL YRPVH + L    D  
Sbjct: 543 RHESRGAHARDDYPD-----RDDKEWLKHSVSWLD-DKGGVKLTYRPVHMKTLTD--DVQ 594

Query: 603 KIAPKARVY 611
              PK RVY
Sbjct: 595 VFPPKKRVY 603


>gi|121996854|ref|YP_001001641.1| succinate dehydrogenase flavoprotein subunit [Halorhodospira
           halophila SL1]
 gi|121588259|gb|ABM60839.1| succinate dehydrogenase subunit A [Halorhodospira halophila SL1]
          Length = 596

 Score =  788 bits (2035), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/599 (66%), Positives = 468/599 (78%), Gaps = 11/599 (1%)

Query: 14  VDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLANMTPD 73
           V+H YDVVVVGAGGAGLRAT GMAE+G  TAC+TKVFPTRSHTVAAQGG++A+L NM  D
Sbjct: 8   VEHQYDVVVVGAGGAGLRATFGMAEQGLNTACVTKVFPTRSHTVAAQGGVSAALGNMGED 67

Query: 74  SWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRPFGGHM 133
            W+WH+YDTIKGSDWLGD DAI+Y+  EA  ++ ELEHYGVPFSR E GKIYQRPFGG  
Sbjct: 68  DWRWHMYDTIKGSDWLGDQDAIEYMCREAVPAIVELEHYGVPFSRTEDGKIYQRPFGGMT 127

Query: 134 QNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCCVGVVA 193
            ++GEG   QRTCAAADRTGHAILHTLY QALK+ AEF+IE+FA+DL+++ +G C GVV 
Sbjct: 128 THFGEGT-AQRTCAAADRTGHAILHTLYQQALKHKAEFYIEHFAIDLMMD-DGVCRGVVT 185

Query: 194 WQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDMEFVQFH 253
             +ETG +H F A  VVLATGGYGR+YFS TSAHTCTGDG GMV RAGLPLQDMEFVQFH
Sbjct: 186 LDMETGTVHIFRAHQVVLATGGYGRSYFSCTSAHTCTGDGNGMVLRAGLPLQDMEFVQFH 245

Query: 254 PTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEIREGRG 313
           PTGIYGAGCLITEG RGEGGYL N++GERFMERYAP+AKDLASRDVVSR M +EIREGRG
Sbjct: 246 PTGIYGAGCLITEGVRGEGGYLTNAQGERFMERYAPNAKDLASRDVVSRSMTIEIREGRG 305

Query: 314 VGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMGGIPTN 373
           VG+  DHIHL+L HL P V+ ERLPGI+ESA+IFAGVDVT++PIPV+PTVHYNMGGIPTN
Sbjct: 306 VGEHGDHIHLHLEHLGPEVIHERLPGIAESAQIFAGVDVTKEPIPVLPTVHYNMGGIPTN 365

Query: 374 YWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIRASEMI 433
           + GEV+     +P+   PGLMAIGEA C SVHGANRLGSNSL+DLVVFGRAA  RA+E+I
Sbjct: 366 HMGEVVHLKDGDPDAVVPGLMAIGEAACVSVHGANRLGSNSLLDLVVFGRAAAHRAAEVI 425

Query: 434 -DKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQDSLSD 492
             +  P   L   + D  + R DRLR A+G  PTA LR +MQ  MQ  A VFRT D L  
Sbjct: 426 GGRGKPHAPLPAGAADLALQRLDRLRRANGSKPTAQLRREMQNTMQNYAAVFRTGDVLEQ 485

Query: 493 GCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRGSHAR 552
           GC  +  ++   AD+ V DRSLIWNSDL+ETLEL+NL+ +A+ T++SA  R ESRG+HAR
Sbjct: 486 GCNRMDDVFRGFADVGVTDRSLIWNSDLIETLELENLLGSAVTTIHSARNRLESRGAHAR 545

Query: 553 EDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPKARVY 611
           ED+ +     RDD NW KH+L  +  + G + + YRPVH   L    D   I PKARVY
Sbjct: 546 EDYAE-----RDDENWLKHTLSTL-RSDGSVDIAYRPVHLHTLSD--DVEAIPPKARVY 596


>gi|86747451|ref|YP_483947.1| succinate dehydrogenase flavoprotein subunit [Rhodopseudomonas
           palustris HaA2]
 gi|86570479|gb|ABD05036.1| succinate dehydrogenase subunit A [Rhodopseudomonas palustris HaA2]
          Length = 607

 Score =  788 bits (2034), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/602 (65%), Positives = 468/602 (77%), Gaps = 9/602 (1%)

Query: 10  SYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLAN 69
           +Y   DH YDVVVVGAGGAGLRA +G +E G +TACITKVFPTRSHTVAAQGGI+ASL N
Sbjct: 15  AYPIEDHVYDVVVVGAGGAGLRAVVGCSEAGLRTACITKVFPTRSHTVAAQGGISASLGN 74

Query: 70  MTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRPF 129
           M  D W+WH+YDT+KGSDWLGD D+I+Y+   AP++VYELEH+GVPFSR E GKIYQRPF
Sbjct: 75  MHKDDWRWHMYDTVKGSDWLGDQDSIEYMVRNAPEAVYELEHWGVPFSRTEDGKIYQRPF 134

Query: 130 GGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCCV 189
           GG   ++G+G   QRTCAAADRTGHA+LHT+YGQAL+++AEF+IE+FA+DLI++ +G C 
Sbjct: 135 GGMTLDFGKGQ-AQRTCAAADRTGHAMLHTMYGQALRHSAEFYIEFFAIDLIMDDQGVCR 193

Query: 190 GVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDMEF 249
           GV+A +L+ G IHRF A+  +LATGGYGRAY S TSAHTCTGDG  M  RAGLPLQDMEF
Sbjct: 194 GVIALKLDDGTIHRFKAQTTILATGGYGRAYASCTSAHTCTGDGGAMALRAGLPLQDMEF 253

Query: 250 VQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEIR 309
           VQFHPTGIYG+GCL+TEGARGEGGYLVNS+GERFMERYAPSAKDLASRDVVSR M +E+R
Sbjct: 254 VQFHPTGIYGSGCLVTEGARGEGGYLVNSEGERFMERYAPSAKDLASRDVVSRAMTIEMR 313

Query: 310 EGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMGG 369
           EGRGVGK KDHI L+L+HL P VL ERLPGISESARIFAGVDVTR+PIP++PTVHYNMGG
Sbjct: 314 EGRGVGKKKDHIFLHLDHLAPEVLHERLPGISESARIFAGVDVTREPIPILPTVHYNMGG 373

Query: 370 IPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIRA 429
           IPTN+ GEV+     +     PGLMAIGEA C SVHGANRLGSNSLIDLVVFGRAA +R 
Sbjct: 374 IPTNFHGEVVTKKDGDDNAVVPGLMAIGEAACVSVHGANRLGSNSLIDLVVFGRAAALRC 433

Query: 430 SEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQDS 489
           +E +  +   P L   S D  + R D+ R+A G  PTA LRE MQ  MQ +  VFRT + 
Sbjct: 434 AEKLTPNGKQPELPADSADLSLGRLDKYRYAKGGTPTAKLRESMQSVMQNNCAVFRTGEV 493

Query: 490 LSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRGS 549
           LS+G   +  ++  + D+ V DRSL+WNSDLVETLE  NL+I A+ T+ SA  R ESRG+
Sbjct: 494 LSEGKDLIRKVYGGVGDVGVSDRSLVWNSDLVETLEFDNLIIQAVVTMNSAANRTESRGA 553

Query: 550 HAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPKAR 609
           HAREDF D     RDD  W KH+L W+  + G   +DYRPVH   +   V Y  I PK R
Sbjct: 554 HAREDFPD-----RDDTQWMKHTLAWIG-DDGGTTIDYRPVHDYTMTNDVQY--IPPKPR 605

Query: 610 VY 611
           VY
Sbjct: 606 VY 607


>gi|312282069|dbj|BAJ33900.1| unnamed protein product [Thellungiella halophila]
          Length = 626

 Score =  788 bits (2034), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/608 (64%), Positives = 478/608 (78%), Gaps = 9/608 (1%)

Query: 4   SSNLKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGI 63
           S+     Y  VDH+YD VVVGAGGAGLRA +G++E GF TACITK+FPTRSHTVAAQGGI
Sbjct: 28  STGSTDDYKIVDHTYDAVVVGAGGAGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGI 87

Query: 64  AASLANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGK 123
            A+L NM+ D W+WH+YDT+KGSDWLGD DAIQY+  EAP++V ELE+YG+PFSR E GK
Sbjct: 88  NAALGNMSEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFSRTEEGK 147

Query: 124 IYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIIN 183
           IYQR FGG   ++G+G    R   AADRTGHA+LHTLYGQA+K+N +FF+EYFALDL++ 
Sbjct: 148 IYQRAFGGQSLDFGKGGQAYRCACAADRTGHALLHTLYGQAMKHNTQFFVEYFALDLLMA 207

Query: 184 SEGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLP 243
           S+G C GV+A  +E G +HRF +   +LATGGYGRAYFSATSAHTCTGDG  MVARAGLP
Sbjct: 208 SDGSCQGVIALNMEDGTLHRFRSAQTILATGGYGRAYFSATSAHTCTGDGNAMVARAGLP 267

Query: 244 LQDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRC 303
           LQD+EFVQFHPTGIYGAGCLITEG+RGEGG L NS+GERFMERYAP+AKDLASRDVVSR 
Sbjct: 268 LQDLEFVQFHPTGIYGAGCLITEGSRGEGGILRNSEGERFMERYAPTAKDLASRDVVSRS 327

Query: 304 MMMEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTV 363
           M MEIREGRGVG  KDHI+L+LNHL P VL+ERLPGISE+A IFAGVDVT++PIPV+PTV
Sbjct: 328 MTMEIREGRGVGPHKDHIYLHLNHLPPEVLKERLPGISETAAIFAGVDVTKEPIPVLPTV 387

Query: 364 HYNMGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGR 423
           HYNMGGIPTNY GEV+     +P+   PGLMA GEA CASVHGANRLG+NSL+D+VVFGR
Sbjct: 388 HYNMGGIPTNYHGEVVTIKGDDPDAVVPGLMAAGEAACASVHGANRLGANSLLDIVVFGR 447

Query: 424 AAVIRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGV 483
           A   R +E+         L+  +  + ++  ++LR++ G +PT+++R  MQR MQ +A V
Sbjct: 448 ACANRVAEINKPGEKQRPLEEDAGRKTIEWLNKLRNSRGSLPTSSIRLNMQRIMQNNAAV 507

Query: 484 FRTQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEAR 543
           FRTQ++L +GC+ +   W+   D++V DRSLIWNSDL+ET+EL+NL+INA  T++SAEAR
Sbjct: 508 FRTQETLEEGCQLIDKAWESFEDVQVKDRSLIWNSDLIETIELENLLINAAITMHSAEAR 567

Query: 544 KESRGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSK 603
           KESRG+HAREDF       R+D  W KH+L +  W   K++LDYRPVH + L   ++   
Sbjct: 568 KESRGAHAREDFTK-----REDGEWMKHTLGY--WEDEKVRLDYRPVHMDTLDDEIE--T 618

Query: 604 IAPKARVY 611
             PKARVY
Sbjct: 619 FPPKARVY 626


>gi|329114748|ref|ZP_08243505.1| Succinate dehydrogenase flavoprotein subunit [Acetobacter pomorum
           DM001]
 gi|326695879|gb|EGE47563.1| Succinate dehydrogenase flavoprotein subunit [Acetobacter pomorum
           DM001]
          Length = 603

 Score =  787 bits (2033), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/609 (64%), Positives = 469/609 (77%), Gaps = 9/609 (1%)

Query: 3   NSSNLKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGG 62
           N+S  + +Y  VDH+YDVVVVGAGG+GLRATLGM   G  TAC+TKVFPTRSHTVAAQGG
Sbjct: 4   NTSPSRGAYRIVDHAYDVVVVGAGGSGLRATLGMGAAGLSTACVTKVFPTRSHTVAAQGG 63

Query: 63  IAASLANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAG 122
           I ASL NM  D+W+WH+YDT+KGSDWLGD DAI+++  EA  +V ELEH+GVPFSR E G
Sbjct: 64  IGASLGNMAEDNWRWHMYDTVKGSDWLGDQDAIEFMCREAVPAVRELEHFGVPFSRTEDG 123

Query: 123 KIYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLII 182
           KIYQRPFGGHM +YG+ P V R CAAADRTGHAILHTLY Q LK+N EFF+EYFA+DLI+
Sbjct: 124 KIYQRPFGGHMSDYGKAP-VPRACAAADRTGHAILHTLYQQCLKHNVEFFVEYFAIDLIM 182

Query: 183 NSEGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGL 242
           + EG C GV+AW  + G IHRF+AK+VVLATGGYGRAY S TSAHTCTGDG GM  RAG+
Sbjct: 183 DEEGECRGVMAWCQDDGTIHRFNAKMVVLATGGYGRAYQSCTSAHTCTGDGNGMAMRAGI 242

Query: 243 PLQDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSR 302
           P QDMEFVQFHPTGIY AGCL+TEG RGEGGYL NS+GERFMERYAP+AKDLASRDVVSR
Sbjct: 243 PTQDMEFVQFHPTGIYPAGCLLTEGCRGEGGYLTNSEGERFMERYAPTAKDLASRDVVSR 302

Query: 303 CMMMEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPT 362
            M +EI+EGRG G  KDHI ++L HL   +L +RLPGI E+ARIFAGVDVT++P+PV+PT
Sbjct: 303 AMTIEIKEGRGCGSKKDHIMMHLEHLGSDLLHQRLPGIIETARIFAGVDVTKEPVPVLPT 362

Query: 363 VHYNMGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFG 422
           VHYNMGGIPTN  GEV+     NP+   PGLMA+GEA C SVHGANRLG+NSL+DL+VFG
Sbjct: 363 VHYNMGGIPTNIHGEVVRPTPDNPDAVVPGLMAVGEAACVSVHGANRLGTNSLLDLIVFG 422

Query: 423 RAAVIRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAG 482
           RAA  RA+E++  +     L   + +  +DR DRLR+A G    +ALRE++QR MQ  A 
Sbjct: 423 RAASRRAAEVVKPTDFTRPLPAGAGEAALDRLDRLRYAKGGTKVSALRERLQRDMQTHAA 482

Query: 483 VFRTQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEA 542
           VFRTQ+SL +G   +  +W+ ++D+ V D SLIWNSDL+E LE +NL+ NA  T+ S  A
Sbjct: 483 VFRTQESLQEGVDKIRDIWNGVSDISVADSSLIWNSDLMEALEFENLLANATVTLESGLA 542

Query: 543 RKESRGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYS 602
           R ESRG+HAR+D+ +     RDD  W KHS+ W+D + G +KL YRPVH + L    D  
Sbjct: 543 RHESRGAHARDDYPN-----RDDKEWLKHSVSWLD-DKGGVKLTYRPVHMKTLTD--DVQ 594

Query: 603 KIAPKARVY 611
              PK RVY
Sbjct: 595 VFPPKKRVY 603


>gi|190571086|ref|YP_001975444.1| succinate dehydrogenase, flavoprotein subunit [Wolbachia
           endosymbiont of Culex quinquefasciatus Pel]
 gi|190357358|emb|CAQ54789.1| succinate dehydrogenase, flavoprotein subunit [Wolbachia
           endosymbiont of Culex quinquefasciatus Pel]
          Length = 599

 Score =  787 bits (2033), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/606 (62%), Positives = 460/606 (75%), Gaps = 11/606 (1%)

Query: 8   KSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASL 67
           KS+Y  ++H YDVV+VGAGGAGLRATLGMA   F  ACI+K+FPTRSHTVAAQGGI+A+L
Sbjct: 3   KSAYEIIEHEYDVVIVGAGGAGLRATLGMAATNFSVACISKIFPTRSHTVAAQGGISAAL 62

Query: 68  ANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQR 127
           +N+  D W+WH YDTIKGSDWLGD DAI+Y+   A ++V ELE++GVPFSR E GKIYQR
Sbjct: 63  SNIAEDDWRWHAYDTIKGSDWLGDQDAIEYMCKNAAKAVIELENFGVPFSRTEDGKIYQR 122

Query: 128 PFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGC 187
            FGG   ++G+G   QRTCAAAD+TGHAILHTLY Q LK NAEFF+EYF +DLI++   C
Sbjct: 123 AFGGMTTHFGKGKSAQRTCAAADKTGHAILHTLYQQCLKFNAEFFVEYFVIDLIMDKGTC 182

Query: 188 CVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDM 247
           C GV+AW L  G +HRF A  VV+ATGGYGR YFSATSAHTCTGDG GMV RAGLPL+DM
Sbjct: 183 C-GVIAWSLCDGTLHRFRAHFVVIATGGYGRVYFSATSAHTCTGDGNGMVVRAGLPLEDM 241

Query: 248 EFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMME 307
           EFVQFHPTGIYG+GCL+TEG RGEGGYLVNS+GE+FMERYAP AKDLASRDVVSR M +E
Sbjct: 242 EFVQFHPTGIYGSGCLMTEGCRGEGGYLVNSQGEKFMERYAPKAKDLASRDVVSRAMTIE 301

Query: 308 IREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNM 367
           IREGRGVG  KDH++L ++HLDP V++ RLPGISE+A+ FAGVDVT+DPIPVIPTVHYNM
Sbjct: 302 IREGRGVGPKKDHMYLNISHLDPEVIKLRLPGISETAKTFAGVDVTKDPIPVIPTVHYNM 361

Query: 368 GGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVI 427
           GGIPTNY GEV+    K  E    GL AIGEA C SVHGANRLGSNSL+DLVVFGRAA +
Sbjct: 362 GGIPTNYHGEVITLQ-KGKEEVVEGLFAIGEAACVSVHGANRLGSNSLLDLVVFGRAAAL 420

Query: 428 RASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQ 487
           RA E +   +P   L     D I+DRF+++R A G    A +R +MQ  MQ  A VFR  
Sbjct: 421 RAKEKLKPDTPHKKLHSDCTDWIVDRFNKMRFASGEFKVAKIRSEMQHTMQKYASVFRVA 480

Query: 488 DSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESR 547
           + L +G + +  +   M ++ V DRS+IWNSDLVE LEL N++  A+ T+  A  R+ESR
Sbjct: 481 EVLEEGKKAIKEVAKMMPNIAVEDRSMIWNSDLVEALELANMIPQAVITMECAANREESR 540

Query: 548 GSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGK--IKLDYRPVHTELLCGGVDYSKIA 605
           G+HAREDF +     RDD NW KH++ W+     +  +++DY+ V  + L   +D+  IA
Sbjct: 541 GAHAREDFPE-----RDDKNWMKHTIAWLKEEKSQVSVEIDYKKVAEKTLSDEIDF--IA 593

Query: 606 PKARVY 611
           P+ R+Y
Sbjct: 594 PEKRIY 599


>gi|213019606|ref|ZP_03335412.1| succinate dehydrogenase, flavoprotein subunit [Wolbachia
           endosymbiont of Culex quinquefasciatus JHB]
 gi|212995028|gb|EEB55670.1| succinate dehydrogenase, flavoprotein subunit [Wolbachia
           endosymbiont of Culex quinquefasciatus JHB]
          Length = 601

 Score =  787 bits (2032), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/606 (62%), Positives = 460/606 (75%), Gaps = 11/606 (1%)

Query: 8   KSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASL 67
           KS+Y  ++H YDVV+VGAGGAGLRATLGMA   F  ACI+K+FPTRSHTVAAQGGI+A+L
Sbjct: 5   KSAYEIIEHEYDVVIVGAGGAGLRATLGMAATNFSVACISKIFPTRSHTVAAQGGISAAL 64

Query: 68  ANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQR 127
           +N+  D W+WH YDTIKGSDWLGD DAI+Y+   A ++V ELE++GVPFSR E GKIYQR
Sbjct: 65  SNIAEDDWRWHAYDTIKGSDWLGDQDAIEYMCKNAAKAVIELENFGVPFSRTEDGKIYQR 124

Query: 128 PFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGC 187
            FGG   ++G+G   QRTCAAAD+TGHAILHTLY Q LK NAEFF+EYF +DLI++   C
Sbjct: 125 AFGGMTTHFGKGKSAQRTCAAADKTGHAILHTLYQQCLKFNAEFFVEYFVIDLIMDKGTC 184

Query: 188 CVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDM 247
           C GV+AW L  G +HRF A  VV+ATGGYGR YFSATSAHTCTGDG GMV RAGLPL+DM
Sbjct: 185 C-GVIAWSLCDGTLHRFRAHFVVIATGGYGRVYFSATSAHTCTGDGNGMVVRAGLPLEDM 243

Query: 248 EFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMME 307
           EFVQFHPTGIYG+GCL+TEG RGEGGYLVNS+GE+FMERYAP AKDLASRDVVSR M +E
Sbjct: 244 EFVQFHPTGIYGSGCLMTEGCRGEGGYLVNSQGEKFMERYAPKAKDLASRDVVSRAMTIE 303

Query: 308 IREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNM 367
           IREGRGVG  KDH++L ++HLDP V++ RLPGISE+A+ FAGVDVT+DPIPVIPTVHYNM
Sbjct: 304 IREGRGVGPKKDHMYLNISHLDPEVIKLRLPGISETAKTFAGVDVTKDPIPVIPTVHYNM 363

Query: 368 GGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVI 427
           GGIPTNY GEV+    K  E    GL AIGEA C SVHGANRLGSNSL+DLVVFGRAA +
Sbjct: 364 GGIPTNYHGEVITLQ-KGKEEVVEGLFAIGEAACVSVHGANRLGSNSLLDLVVFGRAAAL 422

Query: 428 RASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQ 487
           RA E +   +P   L     D I+DRF+++R A G    A +R +MQ  MQ  A VFR  
Sbjct: 423 RAKEKLKPDTPHKKLHSDCTDWIVDRFNKMRFASGEFKVAKIRSEMQHTMQKYASVFRVA 482

Query: 488 DSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESR 547
           + L +G + +  +   M ++ V DRS+IWNSDLVE LEL N++  A+ T+  A  R+ESR
Sbjct: 483 EVLEEGKKAIKEVAKMMPNIAVEDRSMIWNSDLVEALELANMIPQAVITMECAANREESR 542

Query: 548 GSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGK--IKLDYRPVHTELLCGGVDYSKIA 605
           G+HAREDF +     RDD NW KH++ W+     +  +++DY+ V  + L   +D+  IA
Sbjct: 543 GAHAREDFPE-----RDDKNWMKHTIAWLKEEKSQVSVEIDYKKVAEKTLSDEIDF--IA 595

Query: 606 PKARVY 611
           P+ R+Y
Sbjct: 596 PEKRIY 601


>gi|296532573|ref|ZP_06895279.1| succinate dehydrogenase flavoprotein subunit; fumarate
           dehydrogenase [Roseomonas cervicalis ATCC 49957]
 gi|296267098|gb|EFH13017.1| succinate dehydrogenase flavoprotein subunit; fumarate
           dehydrogenase [Roseomonas cervicalis ATCC 49957]
          Length = 603

 Score =  786 bits (2031), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 402/611 (65%), Positives = 467/611 (76%), Gaps = 11/611 (1%)

Query: 3   NSSNLKSS--YTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQ 60
           N+  + SS  Y  VDH+YDVVVVGAGGAGLRAT GM   G KTACITKVFPTRSHTVAAQ
Sbjct: 2   NAITMPSSGAYRVVDHTYDVVVVGAGGAGLRATFGMGAAGLKTACITKVFPTRSHTVAAQ 61

Query: 61  GGIAASLANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNE 120
           GG+ A+L NM  D W+WH+YDT+KGSDWLGD DAI+Y+  EA  ++ ELEH+GVPFSR E
Sbjct: 62  GGVGAALGNMGEDDWRWHMYDTVKGSDWLGDQDAIEYMCREAVPAIIELEHFGVPFSRTE 121

Query: 121 AGKIYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDL 180
            GKIYQRPFGGHMQNYG+  P  R CAAADRTGHAILHTLY Q+LK+N EFF+EYFALDL
Sbjct: 122 DGKIYQRPFGGHMQNYGK-TPAMRACAAADRTGHAILHTLYQQSLKHNCEFFVEYFALDL 180

Query: 181 IINSEGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARA 240
           I++ EG C GV+AW LE G +HRF A+ VVLATGGYGRAYFS TSAHTCTGDG GMV RA
Sbjct: 181 IMDEEGACRGVMAWNLEDGSMHRFRAQTVVLATGGYGRAYFSCTSAHTCTGDGGGMVLRA 240

Query: 241 GLPLQDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVV 300
           GLPLQD EFVQFHPTGIYG+GCL+TEGARGEGGYL NS+GERFMERYAP+AKDLASRDVV
Sbjct: 241 GLPLQDNEFVQFHPTGIYGSGCLVTEGARGEGGYLTNSEGERFMERYAPTAKDLASRDVV 300

Query: 301 SRCMMMEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVI 360
           SR M MEIREGRGVG  KDHIHL+L HL   +L ERLPGISE+A+IFAGVDVT++PIP++
Sbjct: 301 SRAMSMEIREGRGVGPHKDHIHLHLEHLGADLLHERLPGISETAKIFAGVDVTKEPIPML 360

Query: 361 PTVHYNMGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVV 420
           PTVHYNMGGIPTN   EVL A   + +R  PGLMA+GEA   SVHGANRLG+NSL+DLVV
Sbjct: 361 PTVHYNMGGIPTNIHCEVLAATGTDQDRVVPGLMAVGEAASVSVHGANRLGTNSLLDLVV 420

Query: 421 FGRAAVIRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLD 480
           FGRAA +RA+  I   +    L   + +  +DR DR+RHA G +  A LR  MQR MQ  
Sbjct: 421 FGRAAALRAAATIKPGATQAPLPPKAGEMALDRLDRVRHAKGDISVAELRLNMQRTMQTH 480

Query: 481 AGVFRTQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSA 540
           A VFRT + L +GC  ++ + D   ++++ DRSLIWNSDL+E +EL NL+ NA+ TV   
Sbjct: 481 AAVFRTSELLKEGCEKMAKVADSYKNIRIADRSLIWNSDLMEAMELDNLIGNALTTVVGG 540

Query: 541 EARKESRGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVD 600
           EAR ESRG+HA ED+ +     RDD NW KH+L  VD N  K+ LDYR V    L   V 
Sbjct: 541 EARHESRGAHAHEDYPE-----RDDANWMKHTLARVDENY-KVTLDYRDVKMRTLTNEVQ 594

Query: 601 YSKIAPKARVY 611
                PK RVY
Sbjct: 595 V--FPPKPRVY 603


>gi|88658480|ref|YP_507136.1| succinate dehydrogenase flavoprotein subunit [Ehrlichia chaffeensis
           str. Arkansas]
 gi|88599937|gb|ABD45406.1| succinate dehydrogenase, flavoprotein subunit [Ehrlichia
           chaffeensis str. Arkansas]
          Length = 598

 Score =  786 bits (2031), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/603 (62%), Positives = 455/603 (75%), Gaps = 8/603 (1%)

Query: 9   SSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLA 68
           S+Y  ++H YDVV+VGAGGAGLRAT GM   G   ACI+KVFPTRSHTVAAQGGI+A+L 
Sbjct: 4   SAYDIINHEYDVVIVGAGGAGLRATFGMTNVGLSVACISKVFPTRSHTVAAQGGISAALG 63

Query: 69  NMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRP 128
           N++ D W+WH++DT+KGSDWLGD DAI+Y+   A ++V ELE YGVPFSR   GKIYQRP
Sbjct: 64  NVSEDDWRWHMFDTVKGSDWLGDQDAIEYMCKNAAEAVIELERYGVPFSRTSDGKIYQRP 123

Query: 129 FGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCC 188
           FGG    +G+G P  RTCAA+D+TGHAILHTLY Q+LK NA+FF+EYFA+DLI++ EG C
Sbjct: 124 FGGMTTEFGKGKPAVRTCAASDKTGHAILHTLYQQSLKYNAKFFVEYFAIDLIMDEEGQC 183

Query: 189 VGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDME 248
            GV+AW L  G +HRF A +VVLATGGYGR YFSATSAHTCTGDG GMV+R  LPL+DME
Sbjct: 184 KGVLAWSLCDGTLHRFRAHIVVLATGGYGRIYFSATSAHTCTGDGGGMVSRINLPLEDME 243

Query: 249 FVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEI 308
           FVQFHPTGIYGAGCLITEG RGEGGYL+NS+GERFMERYAP AKDLASRDVVSR M +EI
Sbjct: 244 FVQFHPTGIYGAGCLITEGCRGEGGYLINSEGERFMERYAPKAKDLASRDVVSRAMTLEI 303

Query: 309 REGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMG 368
           REGRGVG  KDH++L ++HL   V+ ERLPGI E+AR FAGVDV ++PIPV+PTVHYNMG
Sbjct: 304 REGRGVGPKKDHVYLSISHLGAKVISERLPGIRETARTFAGVDVIKEPIPVLPTVHYNMG 363

Query: 369 GIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIR 428
           GIPTNY GEV+   S N E+  PGL AIGEA C SVHGANRLGSNSL+DLVVFGRAA IR
Sbjct: 364 GIPTNYHGEVVTL-SNNTEQIIPGLFAIGEAACVSVHGANRLGSNSLLDLVVFGRAAAIR 422

Query: 429 ASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQD 488
           A E+I        +  SS + I+DRFD LR + G +  + +R  MQ  MQ  A VFRT++
Sbjct: 423 AKELIKPGMLHAPVQKSSEEWIIDRFDALRFSKGSLRVSEIRSNMQNVMQNHAAVFRTEE 482

Query: 489 SLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRG 548
            L +G + +  + + ++++ V DRS+IWNSDLVE LEL N+M  A+ T+  A  R+ESRG
Sbjct: 483 VLEEGKQKIRSVAESLSEIAVKDRSMIWNSDLVEALELTNMMPQAVVTMECAANRQESRG 542

Query: 549 SHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPKA 608
           +HAREDF D     RDD NW KHSL W +     + + Y+ V    L   V Y    P+ 
Sbjct: 543 AHAREDFPD-----RDDENWMKHSLAWYNSTDCSVHIKYKDVAKATLTDDVQY--FPPQK 595

Query: 609 RVY 611
           RVY
Sbjct: 596 RVY 598


>gi|75676984|ref|YP_319405.1| succinate dehydrogenase flavoprotein subunit [Nitrobacter
           winogradskyi Nb-255]
 gi|74421854|gb|ABA06053.1| succinate dehydrogenase subunit A [Nitrobacter winogradskyi Nb-255]
          Length = 607

 Score =  786 bits (2030), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/603 (64%), Positives = 465/603 (77%), Gaps = 9/603 (1%)

Query: 9   SSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLA 68
            +Y   DH+YDVVVVGAGGAGLRA +G  E G +TACITKVFPTRSHTVAAQGGI+ASL 
Sbjct: 14  KAYPIEDHTYDVVVVGAGGAGLRAVVGCGEAGLRTACITKVFPTRSHTVAAQGGISASLG 73

Query: 69  NMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRP 128
           NM  D W+WH+YDT+KGSDWLGD D I+Y+   AP++VYELEH+GVPFSR E G+IYQRP
Sbjct: 74  NMHKDDWRWHMYDTVKGSDWLGDQDCIEYMVRNAPEAVYELEHWGVPFSRTEDGRIYQRP 133

Query: 129 FGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCC 188
           FGG   +YG+    QRTCAAADRTGHA+LHT+YGQAL+  AEFFIE+FA+DLI++ +G C
Sbjct: 134 FGGMTIDYGKSQ-AQRTCAAADRTGHAMLHTMYGQALRRAAEFFIEFFAIDLIMDDQGAC 192

Query: 189 VGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDME 248
            GV+A +L+ G +HRF A+  +LATGGYGR Y S TSAH CTGDG GM  RAGLPLQDME
Sbjct: 193 RGVIALKLDDGTLHRFRAQTTILATGGYGRVYASCTSAHICTGDGGGMALRAGLPLQDME 252

Query: 249 FVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEI 308
           FVQFHPTGIYG+GCL+TEGARGEGGYLVN++GERFMERYAPSAKDLASRDVVSR M +EI
Sbjct: 253 FVQFHPTGIYGSGCLVTEGARGEGGYLVNAEGERFMERYAPSAKDLASRDVVSRAMTIEI 312

Query: 309 REGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMG 368
           REGRGVGK KDHI L+L+HLDP VL ERLPGISE+ +IFAGVDVTR+PIP++PT HYNMG
Sbjct: 313 REGRGVGKKKDHIFLHLDHLDPKVLHERLPGISETVKIFAGVDVTREPIPILPTAHYNMG 372

Query: 369 GIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIR 428
           GIPTN+ GEV+     N     PGLMA+GEA C SVHGANRLGSNSLIDLVVFGRAA  R
Sbjct: 373 GIPTNFHGEVVTKKDGNDNAVVPGLMAVGEAACVSVHGANRLGSNSLIDLVVFGRAAARR 432

Query: 429 ASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQD 488
            +E +  ++  P L  +S D  + R D+ R+A G  PTA LRE MQR MQ +  VFRTQD
Sbjct: 433 CAEKLTANAEQPDLPANSSDMALGRLDKFRYAAGGTPTARLRENMQRVMQANCAVFRTQD 492

Query: 489 SLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRG 548
           +L++G + +  + + ++DL V DRSL+WN+DL+ET+E  NL+  A+ T+  A  R ESRG
Sbjct: 493 TLAEGQKLIHQVHEGISDLAVFDRSLVWNTDLMETMEYDNLISQAVVTMDCAANRTESRG 552

Query: 549 SHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPKA 608
           +HARED+       RDD NW KH+L  +  + G   +DYRPVH   +    D   I PKA
Sbjct: 553 AHAREDYPQ-----RDDQNWMKHTLARLS-DRGVTTIDYRPVHDYTMTN--DVQSIPPKA 604

Query: 609 RVY 611
           RVY
Sbjct: 605 RVY 607


>gi|159463224|ref|XP_001689842.1| succinate dehydrogenase subunit A [Chlamydomonas reinhardtii]
 gi|158283830|gb|EDP09580.1| succinate dehydrogenase subunit A [Chlamydomonas reinhardtii]
          Length = 635

 Score =  784 bits (2024), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/603 (63%), Positives = 468/603 (77%), Gaps = 7/603 (1%)

Query: 9   SSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLA 68
            SY  +DH YD +VVGAGGAGLRA +G++E GF TACITK+FPTRSHTVAAQGGI A+L 
Sbjct: 40  QSYPVIDHQYDAIVVGAGGAGLRAAVGLSELGFNTACITKLFPTRSHTVAAQGGINAALG 99

Query: 69  NMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRP 128
           NMT D W+WH YDTIKGSDWLGD DAI Y+  EAP++V ELE+YG+PFSR E GKIYQR 
Sbjct: 100 NMTEDDWRWHAYDTIKGSDWLGDQDAIHYMCREAPKAVIELENYGLPFSRTEDGKIYQRA 159

Query: 129 FGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCC 188
           FGG   ++G+G    R   AADRTGHA+LHTLYGQA+K++ +F++EYFALDLI++S+G C
Sbjct: 160 FGGQSLDFGKGGQAYRCACAADRTGHAMLHTLYGQAMKHDIQFYVEYFALDLIMDSDGVC 219

Query: 189 VGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDME 248
            GV+A  +E G +HRF A   VLATGGYGRAYFSATSAHTCTGDG  M ARAG+PLQD+E
Sbjct: 220 RGVMALCMEDGTLHRFQAHQTVLATGGYGRAYFSATSAHTCTGDGNAMAARAGIPLQDLE 279

Query: 249 FVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEI 308
           FVQFHPTGIYGAGCLITEG+RGEGG L NS+GERFMERYAP+AKDLASRDVVSR M MEI
Sbjct: 280 FVQFHPTGIYGAGCLITEGSRGEGGILRNSEGERFMERYAPTAKDLASRDVVSRSMTMEI 339

Query: 309 REGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMG 368
           REGRG G  KDHI+L+LNHL P +L ERLPGISE+A IFAGVDVT++PIPV+PTVHYNMG
Sbjct: 340 REGRGCGPEKDHIYLHLNHLPPELLAERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMG 399

Query: 369 GIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIR 428
           G+PTNY GEVL     NP++  PGL A GEA CASVHGANRLG+NSL+D+VVFGRA   R
Sbjct: 400 GVPTNYMGEVLAPTPDNPDKVVPGLFAAGEAACASVHGANRLGANSLLDIVVFGRACANR 459

Query: 429 ASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQD 488
             +++  ++P   L  ++ +  + R D+LR+A G++ TA +R  MQ+ MQ +A VFRTQ+
Sbjct: 460 IGQIMKPNTPHKPLPATAGEGAVARLDKLRNAKGNLRTAEIRRNMQKVMQNNAAVFRTQE 519

Query: 489 SLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRG 548
           SL +GC+ +        D+K  DR L+WN+DL+ETLEL+NL+INA  T++SAE RKESRG
Sbjct: 520 SLEEGCKLIDETMASFQDVKTTDRGLVWNTDLIETLELENLLINAAVTMHSAEKRKESRG 579

Query: 549 SHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPKA 608
           +HAREDF       RDD NW KH+L ++     K+ + YRPVH + L   + +  I PK 
Sbjct: 580 AHAREDFTQ-----RDDANWMKHTLGFLPSTNDKVNISYRPVHMKPLSEEMPF--IPPKP 632

Query: 609 RVY 611
           RVY
Sbjct: 633 RVY 635


>gi|210075713|ref|XP_502696.2| YALI0D11374p [Yarrowia lipolytica]
 gi|199425795|emb|CAG80884.2| YALI0D11374p [Yarrowia lipolytica]
          Length = 638

 Score =  783 bits (2023), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/607 (63%), Positives = 464/607 (76%), Gaps = 7/607 (1%)

Query: 5   SNLKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIA 64
           S++ S Y  VDH YD VVVGAGGAGLRA  G+AE GF TACI+K+FPTRSHTVAAQGGI 
Sbjct: 39  SHVASKYAVVDHEYDCVVVGAGGAGLRAAFGLAEAGFNTACISKLFPTRSHTVAAQGGIN 98

Query: 65  ASLANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKI 124
           A+L NM PD+W+WH+YDT+KGSDWLGD DAI Y+  EAP+S+ ELEHYGVPFSRN+ G+I
Sbjct: 99  AALGNMHPDNWKWHMYDTVKGSDWLGDQDAIHYMTKEAPKSIIELEHYGVPFSRNDEGRI 158

Query: 125 YQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINS 184
           YQR FGG  ++YG+G    RTCA ADRTGHA+LH+LYGQ+L++N  FFIEYFA+DL++  
Sbjct: 159 YQRAFGGQSKDYGKGGQAYRTCAVADRTGHAMLHSLYGQSLRHNTHFFIEYFAMDLLME- 217

Query: 185 EGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPL 244
           +G CVGVVA+  E G +HRF A   VLATGGYGRAYFS TSAHTCTGDG  MV RAGLPL
Sbjct: 218 DGACVGVVAYNQEDGTLHRFRAHKTVLATGGYGRAYFSCTSAHTCTGDGMAMVTRAGLPL 277

Query: 245 QDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCM 304
           QD+EFVQFHPTGIYG+GCLITEG+RGEGGYL+N  GERFMERYAP+AKDLASRDVVSR M
Sbjct: 278 QDLEFVQFHPTGIYGSGCLITEGSRGEGGYLLNKNGERFMERYAPTAKDLASRDVVSRSM 337

Query: 305 MMEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVH 364
            +EIREGRGVG+  DHI L L+HL  +VL ERLPGISE+A IFAGVDVT++PIPV+PTVH
Sbjct: 338 TLEIREGRGVGQHGDHIFLQLSHLPASVLHERLPGISETAAIFAGVDVTKEPIPVLPTVH 397

Query: 365 YNMGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRA 424
           YNMGGIPT Y GEVL  +    ++   GL A GEA C SVHGANRLG+NSL+DLVVFGRA
Sbjct: 398 YNMGGIPTRYTGEVLTQDENGQDKVVEGLFACGEAACVSVHGANRLGANSLLDLVVFGRA 457

Query: 425 AVIRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVF 484
              R +E +   +P+P +        +   D++R+ADG + TA +R+KMQR MQ+D  VF
Sbjct: 458 VAHRITETLTPGAPLPPVSADIGYESIANLDKMRNADGPLSTATIRDKMQRTMQMDVSVF 517

Query: 485 RTQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARK 544
           RTQ+SL DG R ++ +   +  + V DRS+IWN+DL ETLELQNL+  A+ T YSA ARK
Sbjct: 518 RTQESLEDGVRGITAVDRLIDQVGVTDRSMIWNTDLTETLELQNLLTCAMQTAYSAVARK 577

Query: 545 ESRGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKI 604
           ESRG+HARED+ D     RDDVNW KH+L W D    +IKL YR V    L    +   +
Sbjct: 578 ESRGAHAREDYPD-----RDDVNWMKHTLSWQDKPGDEIKLGYRAVQMHTL-DESECPTV 631

Query: 605 APKARVY 611
            P  RVY
Sbjct: 632 PPAKRVY 638


>gi|71005306|ref|XP_757319.1| hypothetical protein UM01172.1 [Ustilago maydis 521]
 gi|46096723|gb|EAK81956.1| hypothetical protein UM01172.1 [Ustilago maydis 521]
          Length = 654

 Score =  782 bits (2019), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/586 (64%), Positives = 447/586 (76%), Gaps = 7/586 (1%)

Query: 11  YTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLANM 70
           Y  +DH YD +VVGAGG+GLRA  G+AE G  TACITK+FPTRSHTVAAQGGI A+L NM
Sbjct: 60  YPVIDHEYDAIVVGAGGSGLRAAFGLAEAGLNTACITKLFPTRSHTVAAQGGINAALGNM 119

Query: 71  TPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRPFG 130
           T D W+WH+YDT+KGSDWLGD DAI Y+  EAP++V ELEH+G+PFSR + GKIYQR FG
Sbjct: 120 TEDDWRWHMYDTVKGSDWLGDQDAIHYMCREAPRTVIELEHFGLPFSRTKDGKIYQRAFG 179

Query: 131 GHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCCVG 190
           G   NYG+G    R  AAADRTGHA+LHTLYGQ+L++N  FFIEYFALDLI+  +G CVG
Sbjct: 180 GQSLNYGKGGQAYRCAAAADRTGHAMLHTLYGQSLRHNTNFFIEYFALDLIME-DGECVG 238

Query: 191 VVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDMEFV 250
           V A  +E G IHRF A   VLATGGYGRAYFSATSAHTCTGDG  MV+RAGLPLQD+EFV
Sbjct: 239 VTALNMEDGTIHRFRAHKTVLATGGYGRAYFSATSAHTCTGDGMAMVSRAGLPLQDLEFV 298

Query: 251 QFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEIRE 310
           QFHPTGIYGAGCLITEG+RGEGGYL+NS+GERFMERYAP+AKDLASRDVVSR M +EIRE
Sbjct: 299 QFHPTGIYGAGCLITEGSRGEGGYLLNSEGERFMERYAPTAKDLASRDVVSRSMTIEIRE 358

Query: 311 GRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMGGI 370
           GRGVG  KDHI+L L+HL P VL ERLPGISE+A IFAGVDVT++PIPV+PTVHYNMGGI
Sbjct: 359 GRGVGPEKDHIYLQLSHLPPEVLHERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGI 418

Query: 371 PTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIRAS 430
           PT Y GEV+       ++  PGL A GE  C SVHGANRLG+NSL+D+VVFGRA      
Sbjct: 419 PTKYTGEVITKGPNGEDKIVPGLYAAGETACVSVHGANRLGANSLLDIVVFGRACANHIK 478

Query: 431 EMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQDSL 490
           E +D   P   L   +  + ++  D +R+A+G   TA +R  MQR MQ DA VFRTQ +L
Sbjct: 479 ENLDPGKPHKELKGDAGAKSINDLDWVRNANGTKTTADIRNDMQRVMQSDAAVFRTQKTL 538

Query: 491 SDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRGSH 550
            +G   +  ++    D+ + DRS+IWNSDLVETLEL+NL+  A  T++SA ARKESRG+H
Sbjct: 539 DEGVEKIDKVYSTFPDVSIQDRSMIWNSDLVETLELKNLLTCATQTMHSAAARKESRGAH 598

Query: 551 AREDFKDGEFGGRDDVNWRKHSLCWVDWNTG-KIKLDYRPVHTELL 595
           ARED+ D     RDD  W +H+L W    TG K+KLDYR V +  L
Sbjct: 599 AREDYPD-----RDDEQWMRHTLSWQHEGTGDKVKLDYRGVISTTL 639


>gi|162147199|ref|YP_001601660.1| succinate dehydrogenase flavoprotein subunit [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209544252|ref|YP_002276481.1| succinate dehydrogenase flavoprotein subunit [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|161785776|emb|CAP55347.1| Succinate dehydrogenase flavoprotein subunit [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209531929|gb|ACI51866.1| succinate dehydrogenase, flavoprotein subunit [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 603

 Score =  781 bits (2018), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/611 (64%), Positives = 463/611 (75%), Gaps = 11/611 (1%)

Query: 3   NSSNLKSSYTY--VDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQ 60
           N+  L SS  Y  VDH+YDVVVVGAGG+GLRATLGM   G KTAC+TKVFPTRSHTVAAQ
Sbjct: 2   NAITLPSSNAYRIVDHAYDVVVVGAGGSGLRATLGMGAAGLKTACVTKVFPTRSHTVAAQ 61

Query: 61  GGIAASLANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNE 120
           GGI ASL NM  D+W+WH+YDT+KGSDWLGD DAI+Y+  EA  +V ELEH GVPFSR E
Sbjct: 62  GGIGASLGNMAEDNWRWHMYDTVKGSDWLGDQDAIEYMCREAVPAVQELEHLGVPFSRTE 121

Query: 121 AGKIYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDL 180
            GKIYQRPFGGHM+NYGE P V R CAAADRTGHAILHTLY Q LK+N EFF+EYFALDL
Sbjct: 122 EGKIYQRPFGGHMRNYGEAP-VPRACAAADRTGHAILHTLYQQCLKHNVEFFVEYFALDL 180

Query: 181 IINSEGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARA 240
           I++ +G C GV+AW LE G IHRF A+ VVLATGGYGRAY S TSAHTCTGDG GM  RA
Sbjct: 181 IMDDQGACRGVIAWCLEDGSIHRFRAQTVVLATGGYGRAYQSCTSAHTCTGDGGGMAMRA 240

Query: 241 GLPLQDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVV 300
           G+P QDMEFVQFHPTGIY AGCL+TEG RGEGGYL NS+GERFMERYAP+AKDLASRDVV
Sbjct: 241 GVPTQDMEFVQFHPTGIYPAGCLLTEGCRGEGGYLTNSEGERFMERYAPTAKDLASRDVV 300

Query: 301 SRCMMMEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVI 360
           SR M +EI EGRG G  KD++ L+L HL   +L ERLPGISE+ARIFAG+DVT++P+PV+
Sbjct: 301 SRSMTIEINEGRGCGPKKDYMLLHLEHLGADLLHERLPGISETARIFAGIDVTKEPVPVL 360

Query: 361 PTVHYNMGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVV 420
           PTVHYNMGGIPTNY GEV+   + N +   PGLMA+GEA C SVHGANRLG+NSL+DLVV
Sbjct: 361 PTVHYNMGGIPTNYHGEVIRPTADNVDAVVPGLMAVGEAACVSVHGANRLGTNSLLDLVV 420

Query: 421 FGRAAVIRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLD 480
           FGRAA  RA+E+I     I  L   + +  +DR DRLR A G    + +R+ +QR MQ  
Sbjct: 421 FGRAAAKRAAELIKPMETIAPLPPKAGEAALDRLDRLRSAKGGTHVSVMRDTLQRTMQKH 480

Query: 481 AGVFRTQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSA 540
           A VFR   SL++G   +  +W  + DL + DRSLIWN+DL+E LE +NL+ NA  T+  A
Sbjct: 481 AAVFRNTKSLAEGVEKIKDIWTGVPDLSISDRSLIWNTDLMEALEFENLLANATVTMAGA 540

Query: 541 EARKESRGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVD 600
           EAR ESRG+ A +D+ +     RDD NW KH++  +D + G ++L YRPVH + L   V 
Sbjct: 541 EARHESRGAQAHDDYPE-----RDDKNWMKHTVAHLD-DKGGVELSYRPVHMKTLTDEVQ 594

Query: 601 YSKIAPKARVY 611
                PK RVY
Sbjct: 595 V--FPPKKRVY 603


>gi|58579380|ref|YP_197592.1| succinate dehydrogenase flavoprotein subunit [Ehrlichia ruminantium
           str. Welgevonden]
 gi|58418006|emb|CAI27210.1| Succinate dehydrogenase flavoprotein subunit [Ehrlichia ruminantium
           str. Welgevonden]
          Length = 606

 Score =  781 bits (2018), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/603 (61%), Positives = 458/603 (75%), Gaps = 8/603 (1%)

Query: 9   SSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLA 68
           S+Y+ +DH YDVV++GAGGAGLRAT GM   G   ACI+KVFPTRSHTVAAQGGI+A+L 
Sbjct: 12  STYSIIDHEYDVVIIGAGGAGLRATFGMTSVGLSVACISKVFPTRSHTVAAQGGISAALG 71

Query: 69  NMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRP 128
           N+T D W+WH++DT+KGSDWLGD DAI+Y+   A ++V ELE YGVPFSR   GKIYQRP
Sbjct: 72  NVTEDDWRWHMFDTVKGSDWLGDQDAIEYMCKNAAEAVIELERYGVPFSRTSDGKIYQRP 131

Query: 129 FGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCC 188
           FGG    +G+G P  RTCAA+D+TGHAILHTLY Q+LK+NAEFF+EYFA+DLI+N  G C
Sbjct: 132 FGGMTTEFGKGKPAIRTCAASDKTGHAILHTLYQQSLKHNAEFFVEYFAIDLIMNEVGQC 191

Query: 189 VGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDME 248
            GV+AW L  G +HRF +  VVLATGGYGR YFSATSAHTCTGDG GMV+R  LPL+DME
Sbjct: 192 QGVIAWSLCDGTLHRFRSHAVVLATGGYGRIYFSATSAHTCTGDGGGMVSRINLPLEDME 251

Query: 249 FVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEI 308
           FVQFHPTGIYG+GCL+TEG RGEGGYL+NS+GERFMERYAP AKDLASRDVVSR M +EI
Sbjct: 252 FVQFHPTGIYGSGCLMTEGCRGEGGYLINSEGERFMERYAPKAKDLASRDVVSRAMTLEI 311

Query: 309 REGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMG 368
           REGRGVG +KDH++L ++HL   V+ ++LPGISE+AR FAGVDVT++PIPV+PTVHYNMG
Sbjct: 312 REGRGVGPNKDHVYLSISHLGAEVIHDKLPGISETARTFAGVDVTKEPIPVLPTVHYNMG 371

Query: 369 GIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIR 428
           GIPTNY+G+V+   + + E+  PGL AIGEA C SVHGANRLGSNSL+DLVVFGRAA I+
Sbjct: 372 GIPTNYYGQVITL-TDSEEKIVPGLFAIGEAACVSVHGANRLGSNSLLDLVVFGRAAAIK 430

Query: 429 ASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQD 488
           A E+I        ++ +S ++I+ RFD +R + G +  A +R KMQ  MQ  A VFRT +
Sbjct: 431 AKELIKPGMLHAPINKASEEKIIARFDGIRFSKGSLRVAEVRGKMQHVMQNHAAVFRTAE 490

Query: 489 SLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRG 548
            L +G   +  +   M ++ V D+S+IWNSDLVE LEL N+M  A+ T+  A  R+ESRG
Sbjct: 491 VLDEGKVKIKDVAKLMPEIVVQDKSMIWNSDLVEALELTNMMPQAVVTMECAANRQESRG 550

Query: 549 SHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPKA 608
           +HAREDF +     RDD NW KH+L W D     +++ Y+ V    L   V Y    P+ 
Sbjct: 551 AHAREDFPE-----RDDENWMKHTLAWYDAANCSVEIKYKDVAKTTLTNDVQY--FPPQR 603

Query: 609 RVY 611
           RVY
Sbjct: 604 RVY 606


>gi|145356472|ref|XP_001422453.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gi|144582696|gb|ABP00770.1| predicted protein [Ostreococcus lucimarinus CCE9901]
          Length = 633

 Score =  781 bits (2018), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/601 (64%), Positives = 473/601 (78%), Gaps = 10/601 (1%)

Query: 11  YTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLANM 70
           Y  +DH YD +VVGAGGAGLRA +G+ E GFKTAC+TK+FPTRSHTVAAQGGI A+L NM
Sbjct: 43  YEIIDHEYDALVVGAGGAGLRAAIGLGEHGFKTACVTKLFPTRSHTVAAQGGINAALGNM 102

Query: 71  TPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRPFG 130
           T D W+WH YDT+KG+DWLGD DAIQY+  EAP++V ELE YG+PFSR + GKIYQR FG
Sbjct: 103 TEDDWRWHAYDTVKGADWLGDQDAIQYMCREAPKAVIELEKYGMPFSRTDEGKIYQRAFG 162

Query: 131 GHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCCVG 190
           G   +YG+G    R  AAADRTGHA+LHTLYG ALK++ +FF+EYFALDLI++ +G CVG
Sbjct: 163 GQSLDYGKGGQAYRCAAAADRTGHAMLHTLYGAALKHDVQFFVEYFALDLIMD-KGECVG 221

Query: 191 VVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDMEFV 250
           ++A  LE G +HRF +   +LATGGYGRAYFSATSAHTCTGDG  MVARAGLPLQD EFV
Sbjct: 222 IMALCLEDGTLHRFRSHQTILATGGYGRAYFSATSAHTCTGDGNAMVARAGLPLQDQEFV 281

Query: 251 QFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEIRE 310
           QFHPTGIYGAGCLITEG+RGEGG L NS+GERFMERYAPSAKDLASRDVVSR M +EIRE
Sbjct: 282 QFHPTGIYGAGCLITEGSRGEGGILRNSEGERFMERYAPSAKDLASRDVVSRSMTLEIRE 341

Query: 311 GRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMGGI 370
           GRGVGK KDHI+L+LNHL P +L ERLPGISE+A IFAGVDVT++PIPVIPTVHYNMGGI
Sbjct: 342 GRGVGKEKDHIYLHLNHLPPELLAERLPGISETAAIFAGVDVTKEPIPVIPTVHYNMGGI 401

Query: 371 PTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIRAS 430
           PTNY GEV+   + +P+   PGL+A GEA CASVHGANRLG+NSL+D+VVFGRA     +
Sbjct: 402 PTNYKGEVVAPKNGDPDAIVPGLLAAGEAACASVHGANRLGANSLLDIVVFGRACANTVA 461

Query: 431 EMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQDSL 490
           + + + +P   +   +    ++R D++R++ G  PTA LR+ MQ+ MQ DA VFRTQ++L
Sbjct: 462 DKLKRGAPHREIASDAGSNAIERLDKIRNSKGSAPTAMLRKTMQKVMQEDAAVFRTQETL 521

Query: 491 SDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRGSH 550
           ++GC+ +  +  ++ +LK+ DRSL+WN+DLVE LEL NLM NA  T++SAE RKESRG+H
Sbjct: 522 ANGCKRIDDVAAQLDNLKLTDRSLVWNTDLVEALELHNLMPNAQTTMHSAEQRKESRGAH 581

Query: 551 AREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPKARV 610
           AREDF D     R D  W KH+L +V+   GK+K+DYRP H   L   +D   I PKARV
Sbjct: 582 AREDFPD-----RLDDVWMKHTLAYVE--NGKVKIDYRPNHHYTLDAEMDV--IPPKARV 632

Query: 611 Y 611
           Y
Sbjct: 633 Y 633


>gi|308810990|ref|XP_003082803.1| succinate dehydrogenase flavoprotein alpha subunit (ISS)
           [Ostreococcus tauri]
 gi|116054681|emb|CAL56758.1| succinate dehydrogenase flavoprotein alpha subunit (ISS)
           [Ostreococcus tauri]
          Length = 681

 Score =  781 bits (2017), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/607 (64%), Positives = 474/607 (78%), Gaps = 10/607 (1%)

Query: 5   SNLKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIA 64
           ++  S+Y  +DH YD +VVGAGGAGLRA +G+ E GFKTAC+TK+FPTRSHTVAAQGGI 
Sbjct: 85  TSASSAYEIIDHEYDALVVGAGGAGLRAAIGLGEHGFKTACVTKLFPTRSHTVAAQGGIN 144

Query: 65  ASLANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKI 124
           A+L NMT D W+WH YDT+KG+DWLGD DAIQY+  EAP++V ELE YG+PFSR + G+I
Sbjct: 145 AALGNMTEDDWRWHAYDTVKGADWLGDQDAIQYMCREAPKAVIELEKYGMPFSRTDDGRI 204

Query: 125 YQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINS 184
           YQR FGG   ++G+G    R  AAADRTGHA+LHTLYG ALK++ +FF+EYFALDLI++ 
Sbjct: 205 YQRAFGGQSLDFGKGGQAYRCAAAADRTGHAMLHTLYGAALKHDVQFFVEYFALDLIMD- 263

Query: 185 EGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPL 244
           +G CVGV+A  LE G +HRF +   +LATGGYGRAYFSATSAHTCTGDG  MVARAGLPL
Sbjct: 264 KGECVGVMALCLEDGTLHRFRSHQTILATGGYGRAYFSATSAHTCTGDGNAMVARAGLPL 323

Query: 245 QDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCM 304
           QD EFVQFHPTGIYGAGCLITEG+RGEGG L NS+GERFMERYAPSAKDLASRDVVSR M
Sbjct: 324 QDQEFVQFHPTGIYGAGCLITEGSRGEGGILRNSEGERFMERYAPSAKDLASRDVVSRAM 383

Query: 305 MMEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVH 364
            MEIREGRGVGK KDHI+L+LNHL P +L ERLPGISE+A IFAGVDVT++PIPVIPTVH
Sbjct: 384 TMEIREGRGVGKEKDHIYLHLNHLPPELLAERLPGISETAAIFAGVDVTKEPIPVIPTVH 443

Query: 365 YNMGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRA 424
           YNMGGIPTNY GEV+   + + +   PGLMA GEA CASVHGANRLG+NSL+D+VVFGRA
Sbjct: 444 YNMGGIPTNYKGEVVAPKNGDMDAIVPGLMAAGEAACASVHGANRLGANSLLDIVVFGRA 503

Query: 425 AVIRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVF 484
                SE +   +P   +   +    ++R D++R++ G  PTA LR  MQ+ MQ DA VF
Sbjct: 504 CANTVSEKLKPGTPHRQIAADAGSNAVERLDKIRNSKGSAPTAMLRRTMQKVMQDDAAVF 563

Query: 485 RTQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARK 544
           RTQ+SL++GC+ +  +  ++ +LK+ DRSL+WN+DLVE LEL NLM NA  T++SAE RK
Sbjct: 564 RTQESLANGCKRIDDVAAQLDNLKLTDRSLVWNTDLVEALELHNLMPNAQTTMHSAEQRK 623

Query: 545 ESRGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKI 604
           ESRG+HAREDF D     R D  W KH+L +V+   GK+K+DYRP H   L   ++   I
Sbjct: 624 ESRGAHAREDFPD-----RLDDTWMKHTLAYVE--NGKVKIDYRPNHHYTLDDEMEV--I 674

Query: 605 APKARVY 611
            PKARVY
Sbjct: 675 PPKARVY 681


>gi|58617435|ref|YP_196634.1| succinate dehydrogenase flavoprotein subunit [Ehrlichia ruminantium
           str. Gardel]
 gi|58417047|emb|CAI28160.1| Succinate dehydrogenase flavoprotein subunit [Ehrlichia ruminantium
           str. Gardel]
          Length = 598

 Score =  781 bits (2016), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/603 (61%), Positives = 458/603 (75%), Gaps = 8/603 (1%)

Query: 9   SSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLA 68
           S+Y+ +DH YDVV++GAGGAGLRAT GM   G   ACI+KVFPTRSHTVAAQGGI+A+L 
Sbjct: 4   STYSIIDHEYDVVIIGAGGAGLRATFGMTSVGLSVACISKVFPTRSHTVAAQGGISAALG 63

Query: 69  NMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRP 128
           N+T D W+WH++DT+KGSDWLGD DAI+Y+   A ++V ELE YGVPFSR   GKIYQRP
Sbjct: 64  NVTEDDWRWHMFDTVKGSDWLGDQDAIEYMCKNAAEAVIELERYGVPFSRTSDGKIYQRP 123

Query: 129 FGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCC 188
           FGG    +G+G P  RTCAA+D+TGHAILHTLY Q+LK+NAEFF+EYFA+DLI+N  G C
Sbjct: 124 FGGMTTEFGKGKPAIRTCAASDKTGHAILHTLYQQSLKHNAEFFVEYFAIDLIMNEVGQC 183

Query: 189 VGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDME 248
            GV+AW L  G +HRF +  VVLATGGYGR YFSATSAHTCTGDG GMV+R  LPL+DME
Sbjct: 184 QGVIAWSLCDGTLHRFRSHAVVLATGGYGRIYFSATSAHTCTGDGGGMVSRINLPLEDME 243

Query: 249 FVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEI 308
           FVQFHPTGIYG+GCL+TEG RGEGGYL+NS+GERFMERYAP AKDLASRDVVSR M +EI
Sbjct: 244 FVQFHPTGIYGSGCLMTEGCRGEGGYLINSEGERFMERYAPKAKDLASRDVVSRAMTLEI 303

Query: 309 REGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMG 368
           REGRGVG +KDH++L ++HL   V+ ++LPGISE+AR FAGVDVT++PIPV+PTVHYNMG
Sbjct: 304 REGRGVGPNKDHVYLSISHLGAEVIHDKLPGISETARTFAGVDVTKEPIPVLPTVHYNMG 363

Query: 369 GIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIR 428
           GIPTNY+G+V+   + + E+  PGL AIGEA C SVHGANRLGSNSL+DLVVFGRAA I+
Sbjct: 364 GIPTNYYGQVITL-TDSGEKIVPGLFAIGEAACVSVHGANRLGSNSLLDLVVFGRAAAIK 422

Query: 429 ASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQD 488
           A E+I        ++ +S ++I+ RFD +R + G +  A +R KMQ  MQ  A VFRT +
Sbjct: 423 AKELIKPGMLHAPINKASEEKIIARFDGIRFSKGSLRVAEVRGKMQHVMQNHAAVFRTAE 482

Query: 489 SLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRG 548
            L +G   +  +   M ++ V D+S+IWNSDLVE LEL N+M  A+ T+  A  R+ESRG
Sbjct: 483 VLDEGKVKIKDVAKLMPEIVVQDKSMIWNSDLVEALELTNMMPQAVVTMECAANRQESRG 542

Query: 549 SHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPKA 608
           +HAREDF +     RDD NW KH+L W D     +++ Y+ V    L   V Y    P+ 
Sbjct: 543 AHAREDFPE-----RDDENWMKHTLAWYDAANCSVEIKYKDVAKTTLTNDVQY--FPPQK 595

Query: 609 RVY 611
           RVY
Sbjct: 596 RVY 598


>gi|57239408|ref|YP_180544.1| succinate dehydrogenase flavoprotein subunit [Ehrlichia ruminantium
           str. Welgevonden]
 gi|57161487|emb|CAH58413.1| succinate dehydrogenase flavoprotein subunit [Ehrlichia ruminantium
           str. Welgevonden]
          Length = 598

 Score =  781 bits (2016), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/603 (61%), Positives = 458/603 (75%), Gaps = 8/603 (1%)

Query: 9   SSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLA 68
           S+Y+ +DH YDVV++GAGGAGLRAT GM   G   ACI+KVFPTRSHTVAAQGGI+A+L 
Sbjct: 4   STYSIIDHEYDVVIIGAGGAGLRATFGMTSVGLSVACISKVFPTRSHTVAAQGGISAALG 63

Query: 69  NMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRP 128
           N+T D W+WH++DT+KGSDWLGD DAI+Y+   A ++V ELE YGVPFSR   GKIYQRP
Sbjct: 64  NVTEDDWRWHMFDTVKGSDWLGDQDAIEYMCKNAAEAVIELERYGVPFSRTSDGKIYQRP 123

Query: 129 FGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCC 188
           FGG    +G+G P  RTCAA+D+TGHAILHTLY Q+LK+NAEFF+EYFA+DLI+N  G C
Sbjct: 124 FGGMTTEFGKGKPAIRTCAASDKTGHAILHTLYQQSLKHNAEFFVEYFAIDLIMNEVGQC 183

Query: 189 VGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDME 248
            GV+AW L  G +HRF +  VVLATGGYGR YFSATSAHTCTGDG GMV+R  LPL+DME
Sbjct: 184 QGVIAWSLCDGTLHRFRSHAVVLATGGYGRIYFSATSAHTCTGDGGGMVSRINLPLEDME 243

Query: 249 FVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEI 308
           FVQFHPTGIYG+GCL+TEG RGEGGYL+NS+GERFMERYAP AKDLASRDVVSR M +EI
Sbjct: 244 FVQFHPTGIYGSGCLMTEGCRGEGGYLINSEGERFMERYAPKAKDLASRDVVSRAMTLEI 303

Query: 309 REGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMG 368
           REGRGVG +KDH++L ++HL   V+ ++LPGISE+AR FAGVDVT++PIPV+PTVHYNMG
Sbjct: 304 REGRGVGPNKDHVYLSISHLGAEVIHDKLPGISETARTFAGVDVTKEPIPVLPTVHYNMG 363

Query: 369 GIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIR 428
           GIPTNY+G+V+   + + E+  PGL AIGEA C SVHGANRLGSNSL+DLVVFGRAA I+
Sbjct: 364 GIPTNYYGQVITL-TDSEEKIVPGLFAIGEAACVSVHGANRLGSNSLLDLVVFGRAAAIK 422

Query: 429 ASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQD 488
           A E+I        ++ +S ++I+ RFD +R + G +  A +R KMQ  MQ  A VFRT +
Sbjct: 423 AKELIKPGMLHAPINKASEEKIIARFDGIRFSKGSLRVAEVRGKMQHVMQNHAAVFRTAE 482

Query: 489 SLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRG 548
            L +G   +  +   M ++ V D+S+IWNSDLVE LEL N+M  A+ T+  A  R+ESRG
Sbjct: 483 VLDEGKVKIKDVAKLMPEIVVQDKSMIWNSDLVEALELTNMMPQAVVTMECAANRQESRG 542

Query: 549 SHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPKA 608
           +HAREDF +     RDD NW KH+L W D     +++ Y+ V    L   V Y    P+ 
Sbjct: 543 AHAREDFPE-----RDDENWMKHTLAWYDAANCSVEIKYKDVAKTTLTNDVQY--FPPQR 595

Query: 609 RVY 611
           RVY
Sbjct: 596 RVY 598


>gi|307822160|ref|ZP_07652392.1| succinate dehydrogenase, flavoprotein subunit [Methylobacter
           tundripaludum SV96]
 gi|307736726|gb|EFO07571.1| succinate dehydrogenase, flavoprotein subunit [Methylobacter
           tundripaludum SV96]
          Length = 594

 Score =  781 bits (2016), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/605 (64%), Positives = 470/605 (77%), Gaps = 11/605 (1%)

Query: 7   LKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAAS 66
           + + Y  ++H+YDVVVVGAGGAGLRATLGMAEKG KTACITKVFPTRSHTVAAQGGI+A+
Sbjct: 1   MAADYKIIEHTYDVVVVGAGGAGLRATLGMAEKGLKTACITKVFPTRSHTVAAQGGISAA 60

Query: 67  LANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQ 126
           L NM  D W++H+YDT+KGSDWLGD DAI+Y+  EA  +V ELEHYGVPFSR   GKIYQ
Sbjct: 61  LGNMGEDDWRFHMYDTVKGSDWLGDQDAIEYMCREAIPAVIELEHYGVPFSRTADGKIYQ 120

Query: 127 RPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEG 186
           R FGG   +YG+G   QRTCAAAD+TGHAILHTLY Q+LK+ AEFF+EY ALDLI+  +G
Sbjct: 121 RAFGGMTTHYGKGL-AQRTCAAADKTGHAILHTLYQQSLKHKAEFFVEYIALDLIME-DG 178

Query: 187 CCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQD 246
            C G++AW L+ G +H F +++ VLATGGYGR +FS TSAHT TGDG  MV RAGLPLQD
Sbjct: 179 ECRGILAWCLDDGSLHLFKSQMTVLATGGYGRTFFSCTSAHTVTGDGNAMVLRAGLPLQD 238

Query: 247 MEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMM 306
           MEF+QFHPTGIYGAGCLITEG RGEGGYL NS+GERFMERYAPSAKDLASRDVVSR M +
Sbjct: 239 MEFIQFHPTGIYGAGCLITEGVRGEGGYLTNSEGERFMERYAPSAKDLASRDVVSRAMTI 298

Query: 307 EIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYN 366
           EI EGRGVG  KDH++L++ HLDPA++ ERLPGISE++RIFA VD+T++PIPV+PTVHYN
Sbjct: 299 EIEEGRGVGPLKDHLYLHIEHLDPAIIHERLPGISETSRIFANVDITKEPIPVLPTVHYN 358

Query: 367 MGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAV 426
           MGGIPTNY  EV+     +P+   PGLMAIGEA C SVHGANRLGSNSL+DLVVFGR+A 
Sbjct: 359 MGGIPTNYKAEVVTLRGDDPDAVVPGLMAIGEAACVSVHGANRLGSNSLLDLVVFGRSAA 418

Query: 427 IRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRT 486
           IR +E+I   S    L  ++CD+ + RFD++R+A+G   T+ +R  MQ+ MQ  A VFRT
Sbjct: 419 IRCAELIKPGSRQKPLASNACDKAIARFDKIRNANGSRSTSDIRLDMQKVMQAKAAVFRT 478

Query: 487 QDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKES 546
             +L++G   ++ +    AD+KV D+SLIWN+DLVETLEL NL+  A   + +A  R ES
Sbjct: 479 GTTLTEGVNAMAEVRKTFADVKVVDKSLIWNTDLVETLELDNLLSQATVAINAAGNRTES 538

Query: 547 RGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAP 606
           RG HAREDF       RDD NW KH+L W+D +  ++K+DYRPVH   L   VD   I P
Sbjct: 539 RGGHAREDFPK-----RDDENWLKHTLTWLDGD--QVKIDYRPVHMYTLTDEVDV--IPP 589

Query: 607 KARVY 611
           K RVY
Sbjct: 590 KERVY 594


>gi|330991158|ref|ZP_08315111.1| Succinate dehydrogenase flavoprotein subunit [Gluconacetobacter sp.
           SXCC-1]
 gi|329761744|gb|EGG78235.1| Succinate dehydrogenase flavoprotein subunit [Gluconacetobacter sp.
           SXCC-1]
          Length = 603

 Score =  779 bits (2012), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/609 (64%), Positives = 463/609 (76%), Gaps = 9/609 (1%)

Query: 3   NSSNLKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGG 62
            +S L  SY  VDH+YDVVVVGAGG+GLRATLGM   G KTAC+TKVFPTRSHTVAAQGG
Sbjct: 4   TTSPLTGSYRIVDHAYDVVVVGAGGSGLRATLGMGAAGLKTACVTKVFPTRSHTVAAQGG 63

Query: 63  IAASLANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAG 122
           I ASL NM  D+W+WH+YDT+KGSDWLGD DAI+Y+  EA  +V ELEH GVPFSR E G
Sbjct: 64  IGASLGNMAEDNWRWHMYDTVKGSDWLGDQDAIEYMCREAVPAVQELEHMGVPFSRTEDG 123

Query: 123 KIYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLII 182
           KIYQRPFGGHM+NYGE P V R CAAADRTGHAILHTLY Q LK+N EFF+EYFA+DLI+
Sbjct: 124 KIYQRPFGGHMRNYGEAP-VPRACAAADRTGHAILHTLYQQCLKHNVEFFVEYFAIDLIM 182

Query: 183 NSEGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGL 242
           + EG C GV+AW LE G +HRF A+ VVLATGGYGRAY S TSAHTCTGDG GM  RAGL
Sbjct: 183 DEEGACRGVMAWCLEDGTLHRFRAQKVVLATGGYGRAYHSCTSAHTCTGDGGGMAIRAGL 242

Query: 243 PLQDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSR 302
           P+QDMEFVQFHPTGI+ AGCL+TEG RGEGGYL NSKGERFMERYAP+AKDLASRDVVSR
Sbjct: 243 PMQDMEFVQFHPTGIFPAGCLLTEGCRGEGGYLTNSKGERFMERYAPTAKDLASRDVVSR 302

Query: 303 CMMMEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPT 362
            M +EI EGRG G  K++I L+L HL P +L ERLPGISE+ARIFAG+DVT++P+PV+PT
Sbjct: 303 AMTIEINEGRGCGPEKNYIMLHLEHLGPEILHERLPGISETARIFAGIDVTKEPVPVLPT 362

Query: 363 VHYNMGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFG 422
           VHYNMGGIPTNY GEV+   + + +   PGLMA+GEA C SVHGANRLG+NSL+DLVVFG
Sbjct: 363 VHYNMGGIPTNYHGEVIRPTADDVDAVVPGLMAVGEAACVSVHGANRLGTNSLLDLVVFG 422

Query: 423 RAAVIRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAG 482
           RAA  RA+  I     I  L   + D  + RFDRLR+A G    A +R K+QR MQ  A 
Sbjct: 423 RAAAQRAAATIKSEETIRPLPPGAGDAAIARFDRLRYAKGKTHVADMRGKLQRTMQKHAA 482

Query: 483 VFRTQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEA 542
           VFR  +SL+ G   +  +W E+ D+ ++DRSLIWNSDL+E LE +NL+ NA  T+  A+A
Sbjct: 483 VFRNTESLAQGVEKIKEIWSEIPDISINDRSLIWNSDLMEALEFENLLANATVTMAGADA 542

Query: 543 RKESRGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYS 602
           R ESRG+ A +D+ D     RDD NW KH++  ++   G + L YRPVH + L    D  
Sbjct: 543 RHESRGAQAHDDYPD-----RDDKNWMKHTVAHMN-EAGDVTLSYRPVHMKTLTD--DVQ 594

Query: 603 KIAPKARVY 611
              PK RVY
Sbjct: 595 VFPPKKRVY 603


>gi|88608201|ref|YP_506265.1| succinate dehydrogenase flavoprotein subunit [Neorickettsia
           sennetsu str. Miyayama]
 gi|88600370|gb|ABD45838.1| succinate dehydrogenase, flavoprotein subunit [Neorickettsia
           sennetsu str. Miyayama]
          Length = 597

 Score =  776 bits (2005), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/603 (63%), Positives = 463/603 (76%), Gaps = 9/603 (1%)

Query: 9   SSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLA 68
           SSY  V+H YDVVVVGAGG+GLRATLGMA +G K AC++KVFPTRSHTVAAQGGI+A+L 
Sbjct: 4   SSYPIVEHEYDVVVVGAGGSGLRATLGMASQGLKVACLSKVFPTRSHTVAAQGGISAALG 63

Query: 69  NMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRP 128
           N++ D W+WH YDT+KGSDWLGD DAI+Y+   A  SV ELE++GVPFSR   GKIYQRP
Sbjct: 64  NISEDDWRWHAYDTVKGSDWLGDQDAIEYMCKNASSSVIELENFGVPFSRTSEGKIYQRP 123

Query: 129 FGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCC 188
           FGG   +YG+G  + RTCAA D+TGHAILH LY Q++K + EFF+EY  LDL+++ EGC 
Sbjct: 124 FGGMTTHYGKGRAI-RTCAAEDKTGHAILHALYQQSIKLDTEFFVEYIVLDLLMDDEGCK 182

Query: 189 VGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDME 248
            GV+AW L+ G +HRF A +VV+ATGGYGR YFSAT AHTCTGDG   V RAGLPLQDME
Sbjct: 183 -GVIAWDLKDGSLHRFRAHIVVIATGGYGRIYFSATGAHTCTGDGNAFVLRAGLPLQDME 241

Query: 249 FVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEI 308
           FVQFHPTGIYGAGCLI+E  RGEGGYL+NS+GERFM +YAPSA DLASRDVVSR + MEI
Sbjct: 242 FVQFHPTGIYGAGCLISEAVRGEGGYLINSEGERFMAKYAPSAIDLASRDVVSRAITMEI 301

Query: 309 REGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMG 368
           R GRGVG  KDHI+L ++HL   V+++RLPGISE+ARIFA VDVT++PIPV+PTVHYNMG
Sbjct: 302 RAGRGVGPKKDHIYLQVSHLGSKVIEQRLPGISETARIFANVDVTKEPIPVLPTVHYNMG 361

Query: 369 GIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIR 428
           GIP NY GEVL  + +N E+  PGLMAIGEA C SVHGANRLGSNSL+DLVVFGR A IR
Sbjct: 362 GIPANYHGEVLTVDDENVEKVVPGLMAIGEAACISVHGANRLGSNSLLDLVVFGRTAAIR 421

Query: 429 ASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQD 488
           A E+I  ++    +D    +R++ RFDR R+ADG +PTA LR KMQ  MQ  A VFRTQ+
Sbjct: 422 AREVIKANTKHSPIDKELTERVLARFDRFRYADGGLPTAVLRRKMQLIMQEHAAVFRTQE 481

Query: 489 SLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRG 548
            L +GC+ +     EM ++ V DRSL+WN+DLVETLEL N++  A+AT+ SA  RKESRG
Sbjct: 482 VLDEGCKKMREFLREMDEINVTDRSLVWNTDLVETLELDNMVSQAVATIESAANRKESRG 541

Query: 549 SHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPKA 608
           SHARED+ +     RDD NW +H+L W   +  + K  YRPV  + +   ++     P+ 
Sbjct: 542 SHAREDYPE-----RDDENWLRHTLFWFLPDGNETKFGYRPVRLQPMTNEIE--SFPPQK 594

Query: 609 RVY 611
           RVY
Sbjct: 595 RVY 597


>gi|147801802|emb|CAN74538.1| hypothetical protein VITISV_023718 [Vitis vinifera]
          Length = 587

 Score =  774 bits (1999), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/591 (63%), Positives = 458/591 (77%), Gaps = 21/591 (3%)

Query: 24  GAGGAGLRATLGMAEK---GFKTACITKVFPTRSHTVAAQGGIAASLANMTPDSWQWHLY 80
           G   A ++A +G   K   GF TACITK+FPTRSHTVAAQGGI A+L NMT D W+WH+Y
Sbjct: 15  GTSEAEIKAAIGELSKHGHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMY 74

Query: 81  DTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRPFGGHMQNYGEGP 140
           DT+KGSDWLGD DAIQY+  EAP++V ELE+YG+PFSR E G+IYQR FGG   N+G+G 
Sbjct: 75  DTVKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFSRTEDGRIYQRAFGGQSLNFGKGG 134

Query: 141 PVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCCVGVVAWQLETGE 200
              R   AADRTGHA+LHTLYGQA+K+N +FF+EYFALDL+++++G C GV+A  +E G 
Sbjct: 135 QAYRCACAADRTGHALLHTLYGQAMKHNTQFFVEYFALDLLMDNDGACQGVIALNMEDGT 194

Query: 201 IHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDMEFVQFHPTGIYGA 260
           +HRF A   +LATGGYGR YFSATSAHTCTGDG  MVARAGLPLQD+EFVQFHPTGIYGA
Sbjct: 195 LHRFQAASTILATGGYGRTYFSATSAHTCTGDGNAMVARAGLPLQDLEFVQFHPTGIYGA 254

Query: 261 GCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEIREGRGVGKSKDH 320
           GCLITEG+RGEGG L NS+GERFMERYAP+AKDLASRDVVSR M MEIREGRGV    DH
Sbjct: 255 GCLITEGSRGEGGILRNSEGERFMERYAPTAKDLASRDVVSRSMTMEIREGRGV----DH 310

Query: 321 IHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMGGIPTNYWGEVLD 380
           I+L+LNHL P VL+ERLPGISE+A IFAGVDVT++PIPV+PTVHYNMGGIPTNY GEVL 
Sbjct: 311 IYLHLNHLPPEVLKERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTNYHGEVLT 370

Query: 381 ANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIRASEMIDKSSPIP 440
               +P+   PGLMA GEA CASVHGANRLG+NSL+D+VVFGRA   R +E+       P
Sbjct: 371 IKGNDPDAVVPGLMAAGEAACASVHGANRLGANSLLDIVVFGRACANRVAEIHK-----P 425

Query: 441 SLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQDSLSDGCRNLSCL 500
              + S ++ +   D+LR+++G +PT+ +R  MQR MQ +A VFRTQ++L +GC+ +   
Sbjct: 426 GKFLDSGEKTIAWLDKLRNSNGSIPTSKIRLNMQRVMQNNAAVFRTQETLEEGCKLIDKA 485

Query: 501 WDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRGSHAREDFKDGEF 560
           W+   D+++ DRSLIWNSDL ET+EL+NL+INA  T++SAEARKESRG+HAREDF     
Sbjct: 486 WESFHDVQLKDRSLIWNSDLSETIELENLLINACITMHSAEARKESRGAHAREDFTK--- 542

Query: 561 GGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPKARVY 611
             RDD NW +H+L +  W   K++LDYRPVH   L   ++   I PKARVY
Sbjct: 543 --RDDENWIRHTLGY--WENEKVRLDYRPVHMNPLDDEIE--SIPPKARVY 587


>gi|42520311|ref|NP_966226.1| succinate dehydrogenase flavoprotein subunit [Wolbachia
           endosymbiont of Drosophila melanogaster]
 gi|42410049|gb|AAS14160.1| succinate dehydrogenase, flavoprotein subunit [Wolbachia
           endosymbiont of Drosophila melanogaster]
          Length = 599

 Score =  774 bits (1999), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/606 (63%), Positives = 465/606 (76%), Gaps = 11/606 (1%)

Query: 8   KSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASL 67
           KS+Y  ++H YDVVVVGAGGAGLRATLGMA   F  ACI+K+FPTRSHTVAAQGGI+A+L
Sbjct: 3   KSAYEIIEHEYDVVVVGAGGAGLRATLGMAATNFSVACISKIFPTRSHTVAAQGGISAAL 62

Query: 68  ANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQR 127
            N+  D W+WH YDTIKGSDWLGD DAI+Y+   A ++V ELE++GVPFSR E GKIYQR
Sbjct: 63  GNIGEDDWRWHAYDTIKGSDWLGDQDAIEYMCKNAAKAVIELENFGVPFSRTEDGKIYQR 122

Query: 128 PFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGC 187
            FGG   ++G+G   QRTCAAAD+TGHAILHTLY Q LK NAEFF+EYF +DLI++SE C
Sbjct: 123 SFGGMTTHFGKGKSAQRTCAAADKTGHAILHTLYQQCLKFNAEFFVEYFVIDLIMDSETC 182

Query: 188 CVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDM 247
           C GV+AW L  G +HRF A  VVLATGGYGR YFSATSAHTCTGDG GMV RAGLPL+DM
Sbjct: 183 C-GVLAWSLCDGTLHRFRAHRVVLATGGYGRVYFSATSAHTCTGDGNGMVVRAGLPLEDM 241

Query: 248 EFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMME 307
           EFVQFHPTGIYG+GCL+TEG RGEGGYLVNS+GE+FMERYAP AKDLASRDVVSR + +E
Sbjct: 242 EFVQFHPTGIYGSGCLMTEGCRGEGGYLVNSQGEKFMERYAPKAKDLASRDVVSRAITIE 301

Query: 308 IREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNM 367
           IREGRGVG  KDH++L + HLDP V++ RLPGISE+AR FAGVDVT+DPIPVIPTVHYNM
Sbjct: 302 IREGRGVGPKKDHMYLTIAHLDPEVIKLRLPGISETARTFAGVDVTKDPIPVIPTVHYNM 361

Query: 368 GGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVI 427
           GGIPTNY+GEV+    +  E    GL AIGEA C SVHGANRLGSNSL+DLVVFGRAA +
Sbjct: 362 GGIPTNYYGEVITLK-QGKEEVVDGLFAIGEAACVSVHGANRLGSNSLLDLVVFGRAAAL 420

Query: 428 RASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQ 487
           RA E +   +P   L     D I+DRF+++R A G +  A +R +MQ  MQ  A VFR  
Sbjct: 421 RAKEKLKSGTPHKKLHSDCTDWIVDRFNKMRFASGGLKVAKIRGEMQNTMQKYASVFRVA 480

Query: 488 DSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESR 547
           + L +G + +  +   M D+ + DRS++WNSDLVE LEL N++  A+ T+  A  R+ESR
Sbjct: 481 EVLEEGKKAIKKVAKMMPDISLEDRSMMWNSDLVEALELANMIPQAVITMECAANREESR 540

Query: 548 GSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKI--KLDYRPVHTELLCGGVDYSKIA 605
           G+HAREDF +     RDD NW KH++ W++   G+I  K+DY+ V  + L G +D+  IA
Sbjct: 541 GAHAREDFPE-----RDDKNWMKHTIAWLEEKKGQINVKIDYKKVAEKTLSGEIDF--IA 593

Query: 606 PKARVY 611
           P+ RVY
Sbjct: 594 PEKRVY 599


>gi|88607039|ref|YP_504785.1| succinate dehydrogenase flavoprotein subunit [Anaplasma
           phagocytophilum HZ]
 gi|88598102|gb|ABD43572.1| succinate dehydrogenase, flavoprotein subunit [Anaplasma
           phagocytophilum HZ]
          Length = 604

 Score =  773 bits (1997), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/606 (63%), Positives = 458/606 (75%), Gaps = 9/606 (1%)

Query: 8   KSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASL 67
           +S+Y  VDH YDVVVVGAGGAGLR  +GM   GF  ACITKVFPTRSHTVAAQGGI A+L
Sbjct: 6   RSAYEVVDHEYDVVVVGAGGAGLRVVIGMTAAGFSVACITKVFPTRSHTVAAQGGINAAL 65

Query: 68  ANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQR 127
            N+T D W+WH++DT+KGSDWLGD DAI+Y+   A QSV ELEHYGVPFSR + GKIYQR
Sbjct: 66  GNVTEDDWRWHMFDTVKGSDWLGDQDAIEYMCKNAIQSVIELEHYGVPFSRTKEGKIYQR 125

Query: 128 PFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEG- 186
           P+GG    YG+G P  RTCAA+D+TGHAILH LY Q+L+ +A+FF+EYFA+DLI++ +  
Sbjct: 126 PYGGMTTEYGKGKPAVRTCAASDKTGHAILHALYQQSLRFDAKFFVEYFAIDLIMSEDNR 185

Query: 187 CCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQD 246
            C GV+AW L  G +HRF A  VVLATGGYGR YFSATSAHTCTGDG GM ARAG+PL+D
Sbjct: 186 SCCGVLAWSLCDGVLHRFRAHAVVLATGGYGRVYFSATSAHTCTGDGGGMAARAGIPLED 245

Query: 247 MEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMM 306
           MEFVQFHPTGIYG+GCL+TEG RGEGGYL+NS GERFMERYAP AKDLASRDVVSR M M
Sbjct: 246 MEFVQFHPTGIYGSGCLMTEGCRGEGGYLLNSAGERFMERYAPKAKDLASRDVVSRSMTM 305

Query: 307 EIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYN 366
           EIREGRGVG+ KDHI+L + HLDP V+ ERLPGISE+A+ FAGVDVT++PIPVIPTVHYN
Sbjct: 306 EIREGRGVGEKKDHIYLSIAHLDPKVIHERLPGISETAKTFAGVDVTKEPIPVIPTVHYN 365

Query: 367 MGGIPTNYWGEVLDANSKNPE-RFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAA 425
           MGGIPTNY GEVL  NS +       GL AIGEA C SVHGANRLGSNSL+DLVVFGRAA
Sbjct: 366 MGGIPTNYHGEVLSLNSSSGSYEVVEGLFAIGEAACVSVHGANRLGSNSLLDLVVFGRAA 425

Query: 426 VIRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFR 485
            IRA E+I        +     D I+DRFDR+R+A+G    A +R +MQ  MQ  A VFR
Sbjct: 426 AIRAKEVIKPGGLHRPIRKDFEDSIIDRFDRMRYANGATRVAEIRSRMQNVMQEHAAVFR 485

Query: 486 TQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKE 545
             + L  G + +  +   M D+ V DRS++WNSDLVE LEL N+M  A+ TV  A  RKE
Sbjct: 486 VAEVLEKGKKEIRGVAAMMKDISVTDRSMVWNSDLVEALELSNMMPQAVVTVDCAANRKE 545

Query: 546 SRGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIA 605
           SRG+HAREDF +     RDD NW KH++ W + +T ++K+ Y+ V T  L   V+Y    
Sbjct: 546 SRGAHAREDFPE-----RDDENWMKHTMAWCNCDTYEVKIGYKEVATYTLTNEVEY--FP 598

Query: 606 PKARVY 611
           P+ RVY
Sbjct: 599 PQKRVY 604


>gi|73667302|ref|YP_303318.1| succinate dehydrogenase flavoprotein subunit [Ehrlichia canis str.
           Jake]
 gi|72394443|gb|AAZ68720.1| succinate dehydrogenase subunit A [Ehrlichia canis str. Jake]
          Length = 598

 Score =  773 bits (1996), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/603 (63%), Positives = 458/603 (75%), Gaps = 8/603 (1%)

Query: 9   SSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLA 68
           S+Y  +DH YDVVVVGAGGAGLRAT GM   G   ACI+KVFPTRSHTVAAQGGI+A+L 
Sbjct: 4   SAYDIIDHEYDVVVVGAGGAGLRATFGMTNVGLSVACISKVFPTRSHTVAAQGGISAALG 63

Query: 69  NMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRP 128
           N++ D W+WH++DT+KGSDWLGD DAI+Y+   AP++V ELE YGVPFSR   GKIYQRP
Sbjct: 64  NVSEDDWRWHMFDTVKGSDWLGDQDAIEYMCKNAPEAVIELERYGVPFSRTSEGKIYQRP 123

Query: 129 FGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCC 188
           FGG    +G+G P  RTCAA+D+TGHAILHTLY Q+LK NA+FF+EYFA+DLI++ EG C
Sbjct: 124 FGGMTTEFGKGKPAVRTCAASDKTGHAILHTLYQQSLKYNAKFFVEYFAIDLIMDEEGQC 183

Query: 189 VGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDME 248
            GV+AW L  G +HRF A +VVLATGGYGR YFSATSAHTCTGDG GMV+R  LPL+DME
Sbjct: 184 KGVLAWSLCDGTLHRFRAHVVVLATGGYGRIYFSATSAHTCTGDGGGMVSRINLPLEDME 243

Query: 249 FVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEI 308
           FVQFHPTGIYGAGCLITEG RGEGGYL+NS+GERFMERYAP AKDLASRDVVSR M +EI
Sbjct: 244 FVQFHPTGIYGAGCLITEGCRGEGGYLINSEGERFMERYAPKAKDLASRDVVSRAMTLEI 303

Query: 309 REGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMG 368
           REGRGVG  KDH++L ++HL   V+ ERLPGISE+AR FAGVDVT+DPIPV+PTVHYNMG
Sbjct: 304 REGRGVGPKKDHVYLSVSHLGAKVISERLPGISETARTFAGVDVTKDPIPVLPTVHYNMG 363

Query: 369 GIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIR 428
           GIPTNY+GEV+   S   ++  PGL AIGEA C SVHGANRLGSNSL+DLVVFGRAA IR
Sbjct: 364 GIPTNYYGEVVTL-SNGQQKVVPGLFAIGEAACVSVHGANRLGSNSLLDLVVFGRAAAIR 422

Query: 429 ASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQD 488
           A E+I        +  SS D I+DRFD LR + G +  + +R  MQ  MQ  A VFRT +
Sbjct: 423 AKELIKPGMLHVPVKKSSEDWIIDRFDALRFSKGSLRVSEIRNNMQNVMQNHAAVFRTAE 482

Query: 489 SLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRG 548
            L +G +N+  + + ++++ V DRS+IWNSDLVE LEL N+M  A+ T+  A  R+ESRG
Sbjct: 483 VLEEGKKNIKNVAESVSEIAVEDRSMIWNSDLVEALELTNMMPQAVVTMECAANRQESRG 542

Query: 549 SHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPKA 608
           +HAREDF +     RDD NW KHSL W +     + + Y+ V    L   V Y    P+ 
Sbjct: 543 AHAREDFPE-----RDDENWMKHSLAWYNPVDCSVNIKYKDVAKTTLTDDVQY--FPPQK 595

Query: 609 RVY 611
           RVY
Sbjct: 596 RVY 598


>gi|320166305|gb|EFW43204.1| succinate dehydrogenase flavoprotein subunit [Capsaspora owczarzaki
           ATCC 30864]
          Length = 654

 Score =  773 bits (1996), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/619 (63%), Positives = 473/619 (76%), Gaps = 17/619 (2%)

Query: 6   NLKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAA 65
            L  +Y  +DH +D VVVGAGGAGLRA  G++ +GFKTACITK+FPTRSHTVAAQGGI A
Sbjct: 40  QLSKAYPIIDHDFDAVVVGAGGAGLRAAFGLSSQGFKTACITKLFPTRSHTVAAQGGINA 99

Query: 66  SLANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIY 125
           +L NM PD W+WH+YDT+KGSDWLGD DAI Y+  EAPQ+V ELEHYGVPFSR E GKIY
Sbjct: 100 ALGNMGPDDWRWHMYDTVKGSDWLGDQDAIHYMTREAPQAVVELEHYGVPFSRTEEGKIY 159

Query: 126 QRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSE 185
           QRPFGG   NYG+G   QR  A ADRTGH++LHTLYGQ+L+ + ++FIEYFALDLI+ + 
Sbjct: 160 QRPFGGQSLNYGKGGQAQRCAAVADRTGHSLLHTLYGQSLRYDTQYFIEYFALDLIMEN- 218

Query: 186 GCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQ 245
           G C GV+A  +E G IHRF +   VLATGGYGRAYFS TSAHTCTGDG  MV+RAGLPL 
Sbjct: 219 GECRGVIAINMEDGSIHRFRSHNTVLATGGYGRAYFSCTSAHTCTGDGNAMVSRAGLPLS 278

Query: 246 DMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMM 305
           D+EFVQFHPTGIYGAGCLITEG+RGEGGYL+NSKGERFMERYAP+AKDLASRDVVSR M 
Sbjct: 279 DLEFVQFHPTGIYGAGCLITEGSRGEGGYLLNSKGERFMERYAPTAKDLASRDVVSRAMT 338

Query: 306 MEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHY 365
           +EIREGRGVG  +DH++L L+H+   +L ERLPGISE+A IFAGVDVT++PIPV+PTVHY
Sbjct: 339 IEIREGRGVGPEQDHVYLQLSHIPAEILAERLPGISETAHIFAGVDVTKEPIPVLPTVHY 398

Query: 366 NMGGIPTNYWGEVLD-ANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRA 424
           NMGGIPTNY+G+ L  AN K  +    GL A GEA CASVHGANRLG+NSL+D+VVFGRA
Sbjct: 399 NMGGIPTNYYGQALTHANGK--DSIVKGLYAAGEAACASVHGANRLGANSLLDIVVFGRA 456

Query: 425 AVIRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVF 484
                +      +P  +L   + ++ +   D LR+A+G +PTAALR KMQ+ MQ  A VF
Sbjct: 457 CANHIAANAKPGTPHRALPKGAGEQSIANLDALRYANGRIPTAALRLKMQKVMQTHAAVF 516

Query: 485 RTQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARK 544
           RT D L +GC+ +  ++ EMADLKVHDR ++WNSDL+ETLELQNLMINA  T+ SAEARK
Sbjct: 517 RTGDVLQEGCKLIGDVYSEMADLKVHDRGMVWNSDLIETLELQNLMINAAQTMISAEARK 576

Query: 545 ESRGSHAREDFK------------DGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHT 592
           ESRG+HARED+K             G+     + +WRKH+L  +D  TG+++LDYRPV  
Sbjct: 577 ESRGAHAREDYKARSDEFDYSKPLAGQTKRPFNEHWRKHTLSTIDPLTGRVQLDYRPVID 636

Query: 593 ELLCGGVDYSKIAPKARVY 611
           + L    +   + P  RVY
Sbjct: 637 DTL-DEKECKPVPPTLRVY 654


>gi|225630126|ref|YP_002726917.1| succinate dehydrogenase, flavoprotein subunit [Wolbachia sp. wRi]
 gi|225592107|gb|ACN95126.1| succinate dehydrogenase, flavoprotein subunit [Wolbachia sp. wRi]
          Length = 599

 Score =  770 bits (1989), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/606 (63%), Positives = 464/606 (76%), Gaps = 11/606 (1%)

Query: 8   KSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASL 67
           KS+Y  ++H YDVVVVGAGGAGLRATLGMA   F  ACI+K+FPTRSHTVAAQGGI+A+L
Sbjct: 3   KSAYEIIEHEYDVVVVGAGGAGLRATLGMAATNFSVACISKIFPTRSHTVAAQGGISAAL 62

Query: 68  ANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQR 127
            N+  D W+WH YDTIKGSDWLGD DAI+Y+   A ++V ELE++GVPFSR E GKIYQR
Sbjct: 63  GNIGEDDWRWHAYDTIKGSDWLGDQDAIEYMCKNAAKAVIELENFGVPFSRTEDGKIYQR 122

Query: 128 PFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGC 187
            FGG   ++G+G   QRTCAAAD+TGHAILHTLY Q LK NAEFF+EYF +DLI++SE C
Sbjct: 123 SFGGMTTHFGKGKSAQRTCAAADKTGHAILHTLYQQCLKFNAEFFVEYFVIDLIMDSETC 182

Query: 188 CVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDM 247
           C GV+AW L  G +HRF A  VVLATGGYGR YFSATSAHTCTGDG GMV RAGLPL+DM
Sbjct: 183 C-GVLAWSLCDGTLHRFRAHRVVLATGGYGRVYFSATSAHTCTGDGNGMVVRAGLPLEDM 241

Query: 248 EFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMME 307
           EFVQFHPTGIYG+GCL+TEG RGEGGYLVNS+GE+FMERYAP AKDLASRDVVSR + +E
Sbjct: 242 EFVQFHPTGIYGSGCLMTEGCRGEGGYLVNSQGEKFMERYAPKAKDLASRDVVSRAITIE 301

Query: 308 IREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNM 367
           IREGRGVG  KD+++L + HLDP V++ RLPGISE+AR FAGVDVT+DPIPVIPTVHYNM
Sbjct: 302 IREGRGVGPKKDYMYLTIAHLDPEVIKLRLPGISETARTFAGVDVTKDPIPVIPTVHYNM 361

Query: 368 GGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVI 427
           GGIPTNY+GEV+    +  E    GL AIGEA C SVHGANRLGSNSL+DLVVFGRAA +
Sbjct: 362 GGIPTNYYGEVITLK-QGKEEVVDGLFAIGEAACVSVHGANRLGSNSLLDLVVFGRAAAL 420

Query: 428 RASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQ 487
           RA E +   +P   L     D I+DRF+++R A G +  A +R +MQ  MQ  A VFR  
Sbjct: 421 RAKEKLKSGTPHKKLHSDCTDWIVDRFNKMRFASGGLKVAKIRSEMQNTMQKYASVFRVA 480

Query: 488 DSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESR 547
           + L +G + +  +   M D+ + D S++WNSDLVE LEL N++  A+ T+  A  R+ESR
Sbjct: 481 EVLEEGKKAIKKVAKMMPDISLEDHSMMWNSDLVEALELANMIPQAVITMECAANREESR 540

Query: 548 GSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKI--KLDYRPVHTELLCGGVDYSKIA 605
           G+HAREDF +     RDD NW KH++ W++   G+I  K+DY+ V  + L G +D+  IA
Sbjct: 541 GAHAREDFPE-----RDDKNWMKHTIAWLEEKKGQINVKIDYKKVAEKTLSGEIDF--IA 593

Query: 606 PKARVY 611
           P+ RVY
Sbjct: 594 PEKRVY 599


>gi|88607253|ref|YP_504782.1| succinate dehydrogenase flavoprotein subunit [Anaplasma
           phagocytophilum HZ]
 gi|88598316|gb|ABD43786.1| succinate dehydrogenase, flavoprotein subunit [Anaplasma
           phagocytophilum HZ]
          Length = 604

 Score =  769 bits (1985), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/606 (63%), Positives = 457/606 (75%), Gaps = 9/606 (1%)

Query: 8   KSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASL 67
           +S+Y  VDH YDVVVVGAGGAGLRA +GM   G   AC+TKVFPTRSHTVAAQGGI+A+L
Sbjct: 6   RSAYEVVDHEYDVVVVGAGGAGLRAVVGMTAAGLSVACVTKVFPTRSHTVAAQGGISAAL 65

Query: 68  ANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQR 127
            N+  D W+WH++DT+KGSDWLGD DAI+Y+   A QSV ELEH GVPFSR + GKIYQR
Sbjct: 66  GNIAEDDWRWHMFDTVKGSDWLGDQDAIEYMCKNAMQSVVELEHCGVPFSRTKEGKIYQR 125

Query: 128 PFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEG- 186
           PFGG    YG+G P  RTCAA+D+TGHAILH LY Q+L+ +A+FF+EYFA+DLI++ +  
Sbjct: 126 PFGGMTTEYGKGKPAVRTCAASDKTGHAILHALYQQSLRFDAKFFVEYFAIDLIMSEDNR 185

Query: 187 CCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQD 246
            C GV+AW L  G +HRF A  VVLATGGYGR YFSATSAHTCTGDG GM ARAG+PL+D
Sbjct: 186 SCCGVLAWSLCDGVLHRFRAHAVVLATGGYGRVYFSATSAHTCTGDGGGMAARAGIPLED 245

Query: 247 MEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMM 306
           MEFVQFHPTGIYG+GCL+TEG RGEGGYL+NS GERFMERYAP AKDLASRDVVSR M M
Sbjct: 246 MEFVQFHPTGIYGSGCLMTEGCRGEGGYLLNSAGERFMERYAPKAKDLASRDVVSRSMTM 305

Query: 307 EIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYN 366
           EIREGRGVG+ KDHI+L + HLDP V+ ERLPGISE+A+ FAGVDVT++PIPVIPTVHYN
Sbjct: 306 EIREGRGVGEKKDHIYLSIAHLDPKVIHERLPGISETAKTFAGVDVTKEPIPVIPTVHYN 365

Query: 367 MGGIPTNYWGEVLDANSKNPE-RFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAA 425
           MGGIPTNY GEVL  NS +       GL AIGEA C SVHGANRLGSNSL+DLVVFGRAA
Sbjct: 366 MGGIPTNYHGEVLSLNSSSGSYEVVEGLFAIGEAACVSVHGANRLGSNSLLDLVVFGRAA 425

Query: 426 VIRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFR 485
            IRA E+I        +     D I+DRFDR+R+A+G    A +R +MQ  MQ  A VFR
Sbjct: 426 AIRAKEVIKPGGLHRPIRKDFEDSIIDRFDRMRYANGATRVAEIRSRMQNVMQEHAAVFR 485

Query: 486 TQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKE 545
             + L  G + +  +   M D+ V DRS++WNSDLVE LEL N+M  A+ TV  A  RKE
Sbjct: 486 VAEVLEKGKKEIRGVAAMMKDISVTDRSMVWNSDLVEALELSNMMPQAVVTVDCAANRKE 545

Query: 546 SRGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIA 605
           SRG+HAREDF +     RDD NW KH++ W + +T ++K+ Y+ V T  L   V+Y    
Sbjct: 546 SRGAHAREDFPE-----RDDENWMKHTMAWCNCDTYEVKIGYKEVATYTLTNEVEY--FP 598

Query: 606 PKARVY 611
           P+ RVY
Sbjct: 599 PQKRVY 604


>gi|295841391|dbj|BAJ07109.1| succinate dehydrogenase subunit A [Corynespora cassiicola]
          Length = 647

 Score =  768 bits (1984), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/590 (63%), Positives = 444/590 (75%), Gaps = 12/590 (2%)

Query: 4   SSNLKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGI 63
           S  +   Y  +DH YD VVVGAGG+GLRA  G+AE GF TACI+K+FPTRSHTVAAQGGI
Sbjct: 47  SGFISRKYPVIDHEYDAVVVGAGGSGLRAAFGLAEAGFNTACISKLFPTRSHTVAAQGGI 106

Query: 64  AASLANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGK 123
            A+L NM  D W+WH+YDT+KGSDWLGD DAI Y+  EAPQSV ELE+YG PFSR + G+
Sbjct: 107 NAALGNMHEDDWRWHMYDTVKGSDWLGDQDAIHYMTREAPQSVIELENYGCPFSRTDDGR 166

Query: 124 IYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIIN 183
           IYQR FGG  Q YG+G    R CAAADRTGHA+LHTLYGQ+L++N ++FIE+FA DLI+ 
Sbjct: 167 IYQRAFGGQSQKYGKGGQAYRCCAAADRTGHALLHTLYGQSLRHNTKYFIEFFATDLIME 226

Query: 184 SEGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLP 243
            +G C GVVA+  E G IHRF AK  VLATGGYGRAYFS TSAHTCTGDG  MVARAGLP
Sbjct: 227 -DGVCKGVVAYNQEDGTIHRFLAKNTVLATGGYGRAYFSCTSAHTCTGDGMAMVARAGLP 285

Query: 244 LQDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRC 303
            QD+EFVQFHPTGIYGAGCLITEG+RGEGGYL+NS+GERFMERYAP+AKDLASRDVVSR 
Sbjct: 286 NQDLEFVQFHPTGIYGAGCLITEGSRGEGGYLLNSEGERFMERYAPTAKDLASRDVVSRS 345

Query: 304 MMMEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTV 363
           M +EIREGRGVG  KDHI+L L+HL P +L ERLPGISE+A IF+GVDVT+ PIPV+PTV
Sbjct: 346 MTLEIREGRGVGPEKDHIYLQLSHLPPEILHERLPGISETAAIFSGVDVTKQPIPVLPTV 405

Query: 364 HYNMGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGR 423
           HYNMGGIPT Y GEVL  +++  ++  PGL A GEA C SVHGANRLG+NSL+DL+VFGR
Sbjct: 406 HYNMGGIPTKYTGEVLTQDAQGNDQVVPGLFACGEAACVSVHGANRLGANSLLDLIVFGR 465

Query: 424 AAVIRASEMIDKSSPIPSLDISSCD---RIMDRFDRLRHADGHVPTAALREKMQRAMQLD 480
           A    +  + D  +P    D  S D     ++  D+ R ADG   TA +R  MQ+ MQ D
Sbjct: 466 AV---SHTIRDNFTPGQKQDPISADAGAESIEIIDQARTADGSKSTAEIRLAMQKVMQTD 522

Query: 481 AGVFRTQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSA 540
             VFRTQ+SL +G R +  +    AD+   DRS+IWNSDLVETLEL+NL+  A+ T  +A
Sbjct: 523 VSVFRTQESLDEGVRKIREVDSTYADVGTKDRSMIWNSDLVETLELRNLLTCAVQTAEAA 582

Query: 541 EARKESRGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPV 590
             RKESRG+HARED+ D     RDD  W KH+L W     GK+ L YR V
Sbjct: 583 ANRKESRGAHAREDYPD-----RDDETWMKHTLTWQKKPHGKVDLGYRAV 627


>gi|56416485|ref|YP_153559.1| succinate dehydrogenase flavoprotein subunit [Anaplasma marginale
           str. St. Maries]
 gi|56387717|gb|AAV86304.1| succinate dehydrogenase flavoprotein subunit [Anaplasma marginale
           str. St. Maries]
          Length = 599

 Score =  768 bits (1982), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/604 (63%), Positives = 460/604 (76%), Gaps = 11/604 (1%)

Query: 9   SSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLA 68
           S+Y  VDH YDVVVVGAGGAGLRA +GMA  G   AC++KVFPTRSHTVAAQGGI+A+L 
Sbjct: 6   SAYKIVDHEYDVVVVGAGGAGLRAVVGMAAAGLSVACVSKVFPTRSHTVAAQGGISAALG 65

Query: 69  NMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRP 128
           N++ D W+WH++DT+KGSDWLGD DAI+Y+   A ++V ELEHYGVPFSR E GKIYQRP
Sbjct: 66  NISEDDWRWHMFDTVKGSDWLGDQDAIEYMCKHAMEAVVELEHYGVPFSRTEDGKIYQRP 125

Query: 129 FGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEG-C 187
           FGG    YG+G    RTCAA+D+TGHAILHTLY QALK   EFF+EYFA+DLI+++    
Sbjct: 126 FGGMTTEYGKGKMAVRTCAASDKTGHAILHTLYQQALKYKVEFFVEYFAIDLIMSANNSA 185

Query: 188 CVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDM 247
           C GVVAW L  G +HRF A  VVLATGGYGR YFSATSAHTCTGDG GM ARAGLP++DM
Sbjct: 186 CHGVVAWSLCDGTLHRFRAHAVVLATGGYGRVYFSATSAHTCTGDGGGMAARAGLPMEDM 245

Query: 248 EFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMME 307
           EFVQFHPTGIYG+GCL+TEG RGEGGYL+NS+GERFMERYAP A+DLASRDVVSR + ME
Sbjct: 246 EFVQFHPTGIYGSGCLMTEGCRGEGGYLLNSEGERFMERYAPKARDLASRDVVSRAITME 305

Query: 308 IREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNM 367
           IREGRGVG  KDH+ L + HLDPAV++ERLPGISE+A+ FAGVDVT+DPIPV+PTVHYNM
Sbjct: 306 IREGRGVGPKKDHVFLSIAHLDPAVIKERLPGISETAKTFAGVDVTKDPIPVLPTVHYNM 365

Query: 368 GGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVI 427
           GG+PTNY+GEV+ +      +   GL AIGEA C SVHGANRLGSNSL+DLVVFGRAA +
Sbjct: 366 GGVPTNYYGEVILSEKG---KIVAGLFAIGEAACVSVHGANRLGSNSLLDLVVFGRAAAL 422

Query: 428 RASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQ 487
           RA E+I   +P   ++ S  D I+DRFD+LR + G    A +R+ MQR MQ  A VFRT 
Sbjct: 423 RAKEIIKPGAPHAPIEESFVDAIVDRFDKLRFSRGGPRVAEVRDSMQRVMQDHAAVFRTA 482

Query: 488 DSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESR 547
           D L++G + +  +     D+ V DRS+IWNSDLVE LEL N++  A+ T+  A  R ESR
Sbjct: 483 DILNEGKQKIREVASMAKDMSVSDRSMIWNSDLVEALELTNMLPQAVITMDCAANRTESR 542

Query: 548 GSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPK 607
           G+HAREDF +     RDD NW KH++ W D  T  +K+ Y+ V T  L   V++    P+
Sbjct: 543 GAHAREDFPE-----RDDENWMKHTMAWYDSKTHGVKIAYKSVATSTLTNEVEW--FPPQ 595

Query: 608 ARVY 611
            RVY
Sbjct: 596 KRVY 599


>gi|225677087|ref|ZP_03788090.1| succinate dehydrogenase, flavoprotein subunit [Wolbachia
           endosymbiont of Muscidifurax uniraptor]
 gi|225590872|gb|EEH12096.1| succinate dehydrogenase, flavoprotein subunit [Wolbachia
           endosymbiont of Muscidifurax uniraptor]
          Length = 601

 Score =  767 bits (1981), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/607 (62%), Positives = 464/607 (76%), Gaps = 11/607 (1%)

Query: 8   KSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASL 67
           KS+Y  ++H YDVVVVGAGGAGLRATLGMA   F  ACI+K+FPTRSHTVAAQGGI+A+L
Sbjct: 3   KSAYEIIEHEYDVVVVGAGGAGLRATLGMAATNFSVACISKIFPTRSHTVAAQGGISAAL 62

Query: 68  ANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQR 127
            N+  D W+WH YDTIKGSDWLGD DAI+Y+   A ++V ELE++GVPFSR E GKIYQR
Sbjct: 63  GNIGEDDWRWHAYDTIKGSDWLGDQDAIEYMCKNAAKAVIELENFGVPFSRTEDGKIYQR 122

Query: 128 PFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSE-G 186
            FGG   ++G+G   QRTCAAAD+TGHAILHTLY Q LK NAEFF+EYF +DLI++SE G
Sbjct: 123 SFGGMTTHFGKGKSAQRTCAAADKTGHAILHTLYQQCLKFNAEFFVEYFVIDLIMDSETG 182

Query: 187 CCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQD 246
            C GV+AW L  G +HRF A  VVLATGGYGR YFSATSAHTCTGDG GMV RAGLPL+D
Sbjct: 183 ACCGVLAWSLCDGTLHRFCAHRVVLATGGYGRVYFSATSAHTCTGDGNGMVVRAGLPLED 242

Query: 247 MEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMM 306
           MEFVQFHPTGIYG+GCL+TEG RGEGGYLVNS+GE+FMERYAP A+DLASRDVVSR + +
Sbjct: 243 MEFVQFHPTGIYGSGCLMTEGCRGEGGYLVNSQGEKFMERYAPKARDLASRDVVSRAITI 302

Query: 307 EIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYN 366
           EIREGRGVG  KD+++L + HLDP V++ RLPGISE+AR FAGVDVT+DPIPVIPTVHYN
Sbjct: 303 EIREGRGVGPKKDYMYLTIAHLDPEVIKLRLPGISETARTFAGVDVTKDPIPVIPTVHYN 362

Query: 367 MGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAV 426
           MGGIPTNY GEV+    +  E    GL AIGEA C SVHGANRLGSNSL+DLVVFGRAA 
Sbjct: 363 MGGIPTNYHGEVITLK-QGKEEVVDGLFAIGEAACVSVHGANRLGSNSLLDLVVFGRAAA 421

Query: 427 IRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRT 486
           +RA E +   +P   L     D I+DRF+++R A G +  A +R +MQ  MQ  A VFR 
Sbjct: 422 LRAREKLKSGTPHKKLHSDCTDWIVDRFNKMRFASGGLKVAKIRSEMQNTMQKYASVFRV 481

Query: 487 QDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKES 546
            + L +G + +  +   M D+ + DRS++WNSDLVE LE+ N++  A+ T+  A  R+ES
Sbjct: 482 AEVLEEGKKAIKKVAKMMPDISLEDRSMMWNSDLVEALEIANMIPQAVITMECAANREES 541

Query: 547 RGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKI--KLDYRPVHTELLCGGVDYSKI 604
           RG+HAREDF +     RDD NW KH++ W++   G+I  K+DY+ V  + L G +D+  I
Sbjct: 542 RGAHAREDFPE-----RDDKNWMKHTIAWLEEKKGQINVKIDYKKVAEKTLSGEIDF--I 594

Query: 605 APKARVY 611
           AP+ RVY
Sbjct: 595 APEKRVY 601


>gi|302836143|ref|XP_002949632.1| succinate dehydrogenase subunit A, mitochondrial [Volvox carteri f.
           nagariensis]
 gi|300264991|gb|EFJ49184.1| succinate dehydrogenase subunit A, mitochondrial [Volvox carteri f.
           nagariensis]
          Length = 641

 Score =  767 bits (1981), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/603 (64%), Positives = 473/603 (78%), Gaps = 7/603 (1%)

Query: 9   SSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLA 68
            +Y  +DH YD VVVGAGGAGLRA +G++E GFKTAC+TK+FPTRSHTVAAQGGI A+L 
Sbjct: 46  QTYPVIDHQYDAVVVGAGGAGLRAAVGLSELGFKTACVTKLFPTRSHTVAAQGGINAALG 105

Query: 69  NMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRP 128
           NMT D W+WH YDT+KGSDWLGD DAI Y+  EAP++V ELE+YG+PFSR E GKIYQR 
Sbjct: 106 NMTEDDWRWHAYDTVKGSDWLGDQDAIHYMCREAPKAVIELENYGLPFSRTEDGKIYQRA 165

Query: 129 FGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCC 188
           FGG   ++G+G    R   AADRTGHA+LHTLYG A+K+N +FF+EYFALDL+++S+G C
Sbjct: 166 FGGQSLDFGKGGQAYRCACAADRTGHAMLHTLYGMAMKHNIQFFVEYFALDLMMDSDGAC 225

Query: 189 VGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDME 248
            G++A  +E G IHRF A   VLATGGYGRAYFSATSAHTCTGDG GMVARAGLPLQD+E
Sbjct: 226 RGIMALCMEDGTIHRFQAHQTVLATGGYGRAYFSATSAHTCTGDGGGMVARAGLPLQDLE 285

Query: 249 FVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEI 308
           FVQFHPTGIYGAGCLITEG RGEGG L NS+GERFMERYAP+AKDLASRDVVSR M +EI
Sbjct: 286 FVQFHPTGIYGAGCLITEGCRGEGGILRNSEGERFMERYAPTAKDLASRDVVSRSMTIEI 345

Query: 309 REGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMG 368
           REGRG G  KDHI+L+LNHL P +L ERLPGISE+A IFAGVDVT++PIPV+PTVHYNMG
Sbjct: 346 REGRGCGPEKDHIYLHLNHLPPELLAERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMG 405

Query: 369 GIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIR 428
           GIPTNY GEVL    +NP++  PGL A GEA CASVHGANRLG+NSL+D+VVFGRA   R
Sbjct: 406 GIPTNYMGEVLAPTKENPDKVVPGLFAAGEAACASVHGANRLGANSLLDIVVFGRACANR 465

Query: 429 ASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQD 488
             E++  ++P   L  S+ +  + R D+LR+A G++ TA +R  MQ+ MQ +A VFRTQ+
Sbjct: 466 VGEIMKPNTPHKPLPASAGEHAIARLDKLRNAKGNLRTAEIRRNMQKVMQNNAAVFRTQE 525

Query: 489 SLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRG 548
           +L++GC+ +       +D+KV DR L+WN+DLVETLEL+NL++NA  T++ AE RKESRG
Sbjct: 526 TLAEGCKLIDECAASFSDVKVTDRGLVWNTDLVETLELENLLLNAAITMHGAEQRKESRG 585

Query: 549 SHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPKA 608
           +HAREDF +     RDD  W KH+L ++     K+ + YRPVH + L   + Y  I PKA
Sbjct: 586 AHAREDFTE-----RDDAKWLKHTLGYMPSVENKVSISYRPVHMQPLSEEMPY--IPPKA 638

Query: 609 RVY 611
           RVY
Sbjct: 639 RVY 641


>gi|53804137|ref|YP_114005.1| succinate dehydrogenase flavoprotein subunit [Methylococcus
           capsulatus str. Bath]
 gi|53757898|gb|AAU92189.1| succinate dehydrogenase, flavoprotein subunit [Methylococcus
           capsulatus str. Bath]
          Length = 595

 Score =  767 bits (1980), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 402/605 (66%), Positives = 469/605 (77%), Gaps = 10/605 (1%)

Query: 7   LKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAAS 66
           +  +Y  + H+YD VVVGAGGA LRATLGMAEKG KTACITKVFPTRSHTVAAQGGI+A+
Sbjct: 1   MSKAYEIIRHTYDAVVVGAGGAALRATLGMAEKGLKTACITKVFPTRSHTVAAQGGISAA 60

Query: 67  LANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQ 126
           L NM  D W+WH+YDT+KGSDWLGD DAI+Y+  EA Q+V ELEHYGVPFSR E+GKIYQ
Sbjct: 61  LGNMGEDDWRWHMYDTVKGSDWLGDQDAIEYMCREAMQAVIELEHYGVPFSRTESGKIYQ 120

Query: 127 RPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEG 186
           RPFGG    YG+G   QRTCAAAD TGHAIL TLY Q+LK+ AEFFIEYFALDL+++ EG
Sbjct: 121 RPFGGMTTRYGKGV-AQRTCAAADHTGHAILQTLYQQSLKHEAEFFIEYFALDLVMD-EG 178

Query: 187 CCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQD 246
            C GV+AW+L+ G +H F A + VLATGGYGR YFS+TSAHTCTGDG  MV RAGLPLQD
Sbjct: 179 ECRGVLAWRLDDGTLHLFRAHMTVLATGGYGRTYFSSTSAHTCTGDGNAMVLRAGLPLQD 238

Query: 247 MEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMM 306
           MEFVQFHPTGIYGAGCLITEG RGEGGYL NS+GERFMERYAP AKDLASRDVVSR M +
Sbjct: 239 MEFVQFHPTGIYGAGCLITEGVRGEGGYLTNSEGERFMERYAPHAKDLASRDVVSRAMTI 298

Query: 307 EIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYN 366
           EIREGRG+G  KDH+HL+L HLDPAV+QERLPG++E+ARIF G+DVTR+PIPV+PTVHYN
Sbjct: 299 EIREGRGLGPEKDHLHLHLEHLDPAVIQERLPGVAETARIFGGIDVTREPIPVLPTVHYN 358

Query: 367 MGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAV 426
           MGG+PTNY  EVL     +PE   PGLMAIGE  C SVHGANRLGSNSL+DLVVFGRAA 
Sbjct: 359 MGGVPTNYRAEVLTLKDGDPETVVPGLMAIGEGACVSVHGANRLGSNSLLDLVVFGRAAA 418

Query: 427 IRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRT 486
           +R +E+I        L   +CD  + RFDRLRHA G   TA +R  MQR MQ  A VFRT
Sbjct: 419 LRCAELIRPRQMHKPLPEGACDTTLARFDRLRHASGSRRTADIRLDMQRTMQSHASVFRT 478

Query: 487 QDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKES 546
            + L +G + L  + D  +D+ + DRSL+WN+DL+ETLEL+NL+  A+ TV +A  R+ES
Sbjct: 479 GEVLREGVKALKRIMDSFSDVCIRDRSLVWNTDLLETLELENLLQQAMVTVAAALNREES 538

Query: 547 RGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAP 606
           RGSHAREDF +     RDDV+W KHSL W+D    +  + YRPVH   L    D   I P
Sbjct: 539 RGSHAREDFPE-----RDDVHWLKHSLIWLD-QRHETTIAYRPVHLHTLTS--DVEPIPP 590

Query: 607 KARVY 611
           + RVY
Sbjct: 591 QKRVY 595


>gi|195056497|ref|XP_001995110.1| GH22974 [Drosophila grimshawi]
 gi|193899316|gb|EDV98182.1| GH22974 [Drosophila grimshawi]
          Length = 667

 Score =  766 bits (1978), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/621 (59%), Positives = 450/621 (72%), Gaps = 15/621 (2%)

Query: 3   NSSNLKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGG 62
           N   +   Y  +DH+YD +VVGAGG+GLRA  G+  +GF+TA ITK+FPTRSHT+AAQGG
Sbjct: 50  NPDAISKQYPVIDHAYDAIVVGAGGSGLRAAFGLVAEGFRTAVITKLFPTRSHTIAAQGG 109

Query: 63  IAASLANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAG 122
           I A+L NM  D W+WH+YDT+KGSDWLGD DAI Y+  EAP++V ELE+YG+PFSR + G
Sbjct: 110 INAALGNMEQDDWKWHMYDTVKGSDWLGDQDAIHYMTREAPKAVIELENYGMPFSRTQDG 169

Query: 123 KIYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLII 182
           KIYQR FGG    +G+G    R CA ADRTGH++LHTLYGQ+L  +  +F+EYFALDLI 
Sbjct: 170 KIYQRAFGGQSLKFGKGGQAHRCCAVADRTGHSLLHTLYGQSLSYDCNYFVEYFALDLIF 229

Query: 183 NSEGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGL 242
             EG C GV+A  LE G +HRF A+  V+ATGGYGRA+FS TSAHTCTGDG  +VAR GL
Sbjct: 230 E-EGECRGVLAINLEDGSLHRFRAQNTVIATGGYGRAFFSCTSAHTCTGDGTALVARQGL 288

Query: 243 PLQDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSR 302
           P QD+EFVQFHPTGIYGAGCLITEG RGEGGYL+NSKGERFMERYAP AKDLASRDVVSR
Sbjct: 289 PSQDLEFVQFHPTGIYGAGCLITEGCRGEGGYLINSKGERFMERYAPVAKDLASRDVVSR 348

Query: 303 CMMMEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPT 362
            + +EI EGRGVG  KDH+ L L+HL P  L ERLPGISE+A IFAGVDVTR+PIPV+PT
Sbjct: 349 SITIEIMEGRGVGPDKDHVFLQLHHLPPKQLAERLPGISETAMIFAGVDVTREPIPVLPT 408

Query: 363 VHYNMGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFG 422
           VHYNMGGIPTNY G+VL   +   ++  PGL A GEA C+SVHGANRLG+NSL+DLVVFG
Sbjct: 409 VHYNMGGIPTNYRGQVLTIGANGEDKIVPGLYAAGEAACSSVHGANRLGANSLLDLVVFG 468

Query: 423 RAAVIRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAG 482
           RA     +E     +P P++  ++ +  +   D+LRHA+G + TA LR KMQR MQ  A 
Sbjct: 469 RACAKTIAEENKPGAPAPTIKDNAGEFSVANLDKLRHANGQISTADLRLKMQRCMQNHAA 528

Query: 483 VFRTQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEA 542
           VFR    L  G   +  ++ +  D+KV D+SL+WNSDL+ETLELQNL+ NA  T+  AEA
Sbjct: 529 VFRDGPILQKGVAEMKKIYKQFQDVKVIDKSLVWNSDLIETLELQNLLANAQMTIVGAEA 588

Query: 543 RKESRGSHAREDFK------------DGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPV 590
           RKESRG+HAREDFK            DG+     + +WRKH+L WV    G I L YRPV
Sbjct: 589 RKESRGAHAREDFKTRIDEYDYSKPVDGQTKKPVEQHWRKHTLAWVTNEQGDIDLKYRPV 648

Query: 591 HTELLCGGVDYSKIAPKARVY 611
               L   V+   + P  R Y
Sbjct: 649 IDSTLDQEVE--TVPPAIRSY 667


>gi|58584705|ref|YP_198278.1| succinate dehydrogenase flavoprotein subunit [Wolbachia
           endosymbiont strain TRS of Brugia malayi]
 gi|58419021|gb|AAW71036.1| Succinate dehydrogenase flavoprotein subunit, SdhA [Wolbachia
           endosymbiont strain TRS of Brugia malayi]
          Length = 601

 Score =  766 bits (1977), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/607 (62%), Positives = 463/607 (76%), Gaps = 11/607 (1%)

Query: 8   KSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASL 67
           KS+Y  V+H YDVVVVGAGGAGLRATLGMA   F  ACI+K+FPTRSHTVAAQGGI+A+L
Sbjct: 3   KSAYEIVEHEYDVVVVGAGGAGLRATLGMAATNFSVACISKIFPTRSHTVAAQGGISAAL 62

Query: 68  ANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQR 127
            N+  D W+WH YDTIKGSDWLGD DAI+Y+   A ++V ELE++GVPFSR   GKIYQR
Sbjct: 63  GNIAEDDWRWHAYDTIKGSDWLGDQDAIEYMCKNAAKAVIELENFGVPFSRTGNGKIYQR 122

Query: 128 PFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSE-G 186
           PFGG   ++G+G   QRTCAAAD+TGHAILHTLY Q LK N EFF+EYF +DLII++E G
Sbjct: 123 PFGGMTTHFGKGKSAQRTCAAADKTGHAILHTLYQQCLKFNTEFFVEYFVIDLIIDNETG 182

Query: 187 CCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQD 246
            C GV+AW L  G +H+F A  VVLATGGYGR YFSATSAHTCTGDG GMV RAGLPL+D
Sbjct: 183 ACCGVLAWSLCEGTLHKFRAHSVVLATGGYGRVYFSATSAHTCTGDGNGMVVRAGLPLED 242

Query: 247 MEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMM 306
           MEFVQFHPTGIYG+GCL+TEG RGEGGYLVNS+GERFMERYAP  KDLASRDVVSR + +
Sbjct: 243 MEFVQFHPTGIYGSGCLMTEGCRGEGGYLVNSQGERFMERYAPKVKDLASRDVVSRAITI 302

Query: 307 EIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYN 366
           EIREGRGVG  KDHI+L + HLDP +++ RLPGISE+AR FAGVDVT+DPIPVIPTVHYN
Sbjct: 303 EIREGRGVGPKKDHIYLTIAHLDPEIIKLRLPGISETARTFAGVDVTKDPIPVIPTVHYN 362

Query: 367 MGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAV 426
           MGGIPTNY GEV+    ++ E    GL AIGEA C SVHGANRLGSNSL+DLVVFGRAA 
Sbjct: 363 MGGIPTNYHGEVVTLK-ESKEEVVEGLFAIGEAACISVHGANRLGSNSLLDLVVFGRAAA 421

Query: 427 IRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRT 486
           +RA + +  + P   L+ +  D I+DRF+++R A G +  + +R +MQ  MQ  A VFR 
Sbjct: 422 LRAKKKLKPNMPHKKLNSACIDWIVDRFNKMRFASGGLRVSKIRSEMQHTMQKYASVFRV 481

Query: 487 QDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKES 546
            + L +G R +  +   M D+ + DRS++WNSDLVE LEL N++  A+ T+  A  R+ES
Sbjct: 482 AEVLEEGKRAIKGVAKMMPDIAIEDRSMVWNSDLVEALELANMIPQAVITMECAANREES 541

Query: 547 RGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKI--KLDYRPVHTELLCGGVDYSKI 604
           RG+HAREDF +     RDD NW KH++ W++   G+I  ++DY+ V    L   +D+  I
Sbjct: 542 RGAHAREDFPE-----RDDKNWMKHTIAWLEEKEGQINTRIDYKKVAENTLSDEIDF--I 594

Query: 605 APKARVY 611
           AP+ RVY
Sbjct: 595 APEKRVY 601


>gi|222474854|ref|YP_002563269.1| succinate dehydrogenase flavoprotein subunit (sdhA/frdA) [Anaplasma
           marginale str. Florida]
 gi|255002823|ref|ZP_05277787.1| succinate dehydrogenase flavoprotein subunit [Anaplasma marginale
           str. Puerto Rico]
 gi|222418990|gb|ACM49013.1| succinate dehydrogenase flavoprotein subunit (sdhA/frdA) [Anaplasma
           marginale str. Florida]
          Length = 599

 Score =  766 bits (1977), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/604 (63%), Positives = 459/604 (75%), Gaps = 11/604 (1%)

Query: 9   SSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLA 68
           S+Y  VDH YDVVVVGAGGAGLRA +GMA  G   AC++KVFPTRSHTVAAQGGI+A+L 
Sbjct: 6   SAYKIVDHEYDVVVVGAGGAGLRAVVGMAAAGLSVACVSKVFPTRSHTVAAQGGISAALG 65

Query: 69  NMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRP 128
           N++ D W+WH++DT+KGSDWLGD DAI+Y+   A ++V ELEHYGVPFSR E GKIYQRP
Sbjct: 66  NISEDDWRWHMFDTVKGSDWLGDQDAIEYMCKHAMEAVVELEHYGVPFSRTEDGKIYQRP 125

Query: 129 FGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEG-C 187
           FGG    YG+G    RTCAA+D+TGHAILHTLY QALK   EFF+EYFA+DLI+++    
Sbjct: 126 FGGMTTEYGKGKMAVRTCAASDKTGHAILHTLYQQALKYKVEFFVEYFAIDLIMSANNSA 185

Query: 188 CVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDM 247
           C GVVAW L  G +HRF A  VVLATGGYGR YFSATSAHTCTGDG GM ARAGLP++DM
Sbjct: 186 CHGVVAWSLCDGTLHRFRAHAVVLATGGYGRVYFSATSAHTCTGDGGGMAARAGLPMEDM 245

Query: 248 EFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMME 307
           EFVQFHPTGIYG+GCL+TEG RGEGGYL+NS+GERFMERYAP A+DLASRDVVSR + ME
Sbjct: 246 EFVQFHPTGIYGSGCLMTEGCRGEGGYLLNSEGERFMERYAPKARDLASRDVVSRAITME 305

Query: 308 IREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNM 367
           IREGRGVG  KDH+ L + HLDP V++ERLPGISE+A+ FAGVDVT+DPIPV+PTVHYNM
Sbjct: 306 IREGRGVGPKKDHVFLSIAHLDPGVIKERLPGISETAKTFAGVDVTKDPIPVLPTVHYNM 365

Query: 368 GGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVI 427
           GG+PTNY+GEV+ +      +   GL AIGEA C SVHGANRLGSNSL+DLVVFGRAA +
Sbjct: 366 GGVPTNYYGEVILSEKG---KIVAGLFAIGEAACVSVHGANRLGSNSLLDLVVFGRAAAL 422

Query: 428 RASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQ 487
           RA E+I   +P   ++ S  D I+DRFD+LR + G    A +R+ MQR MQ  A VFRT 
Sbjct: 423 RAKEIIKPGAPHAPIEESFVDAIVDRFDKLRFSRGGPRVAEVRDSMQRVMQDHAAVFRTA 482

Query: 488 DSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESR 547
           D L++G + +  +     D+ V DRS+IWNSDLVE LEL N++  A+ T+  A  R ESR
Sbjct: 483 DILNEGKQKIREVASMAKDMSVSDRSMIWNSDLVEALELTNMLPQAVITMDCAANRTESR 542

Query: 548 GSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPK 607
           G+HAREDF +     RDD NW KH++ W D  T  +K+ Y+ V T  L   V++    P+
Sbjct: 543 GAHAREDFPE-----RDDENWMKHTMAWYDSKTHGVKIAYKSVATSTLTNEVEW--FPPQ 595

Query: 608 ARVY 611
            RVY
Sbjct: 596 KRVY 599


>gi|269959102|ref|YP_003328891.1| succinate dehydrogenase flavoprotein subunit [Anaplasma centrale
           str. Israel]
 gi|269848933|gb|ACZ49577.1| succinate dehydrogenase flavoprotein subunit [Anaplasma centrale
           str. Israel]
          Length = 599

 Score =  765 bits (1976), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/604 (63%), Positives = 459/604 (75%), Gaps = 11/604 (1%)

Query: 9   SSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLA 68
           S+Y  VDH YDVVVVGAGGAGLRA +GMA  G   AC++KVFPTRSHTVAAQGGI+A+L 
Sbjct: 6   SAYKIVDHEYDVVVVGAGGAGLRAVVGMAAAGLSVACVSKVFPTRSHTVAAQGGISAALG 65

Query: 69  NMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRP 128
           N++ D W+WH++DT+KGSDWLGD DAI+Y+   A ++V ELEHYGVPFSR E GKIYQRP
Sbjct: 66  NISEDDWRWHMFDTVKGSDWLGDQDAIEYMCKHAMEAVVELEHYGVPFSRTEDGKIYQRP 125

Query: 129 FGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEG-C 187
           FGG    YG+G    RTCAA+D+TGHAILHTLY QALK   EFF+EYFA+DLI+++    
Sbjct: 126 FGGMTTEYGKGKMAVRTCAASDKTGHAILHTLYQQALKYKVEFFVEYFAIDLIMSANNSA 185

Query: 188 CVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDM 247
           C GVVAW L  G +HRF A  VVLATGGYGR YFSATSAHTCTGDG GM ARAGLP++DM
Sbjct: 186 CHGVVAWSLCDGTLHRFRAHAVVLATGGYGRVYFSATSAHTCTGDGGGMAARAGLPMEDM 245

Query: 248 EFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMME 307
           EFVQFHPTGIYG+GCL+TEG RGEGGYL+NS+GERFMERYAP A+DLASRDVVSR + ME
Sbjct: 246 EFVQFHPTGIYGSGCLMTEGCRGEGGYLLNSEGERFMERYAPKARDLASRDVVSRAITME 305

Query: 308 IREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNM 367
           IREGRGVG  KDH+ L + HLDP V++ERLPGISE+A+ FAGVDVT+DPIPV+PTVHYNM
Sbjct: 306 IREGRGVGPKKDHVFLSIAHLDPGVIKERLPGISETAKTFAGVDVTKDPIPVLPTVHYNM 365

Query: 368 GGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVI 427
           GG+PTNY+GEV+ +      +   GL AIGEA C SVHGANRLGSNSL+DLVVFGRAA +
Sbjct: 366 GGVPTNYYGEVILSEKG---KIVAGLFAIGEAACVSVHGANRLGSNSLLDLVVFGRAAAL 422

Query: 428 RASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQ 487
           RA E+I   +P   ++ S  D I+DRFD+LR + G    A +R+ MQR MQ  A VFRT 
Sbjct: 423 RAREIIKPGAPHAPIEESFVDAIVDRFDKLRFSRGGPRVAEVRDSMQRVMQDHAAVFRTA 482

Query: 488 DSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESR 547
           D L++G + +  +     D+ V DRS+IWNSDLVE LEL N++  A+ T+  A  R ESR
Sbjct: 483 DILNEGKQKIREVASMAKDMSVSDRSMIWNSDLVEALELTNMLPQAVITMDCAANRTESR 542

Query: 548 GSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPK 607
           G+HAREDF +     RDD NW KH++ W D  T  +K+ Y+ V T  L   V++    P+
Sbjct: 543 GAHAREDFPE-----RDDENWMKHTMAWYDSKTHGVKIAYKSVATSTLTNEVEW--FPPQ 595

Query: 608 ARVY 611
            RVY
Sbjct: 596 KRVY 599


>gi|328768451|gb|EGF78497.1| hypothetical protein BATDEDRAFT_90431 [Batrachochytrium
           dendrobatidis JAM81]
          Length = 639

 Score =  764 bits (1973), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/607 (63%), Positives = 460/607 (75%), Gaps = 8/607 (1%)

Query: 5   SNLKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIA 64
           S + ++Y  +DH+YD +VVGAGGAGLRA  G+A++G KTACITK+FPTRSHTVAAQGGI 
Sbjct: 41  STISAAYPIIDHTYDALVVGAGGAGLRAAFGLAKEGLKTACITKLFPTRSHTVAAQGGIN 100

Query: 65  ASLANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKI 124
           A+LANMT D W+WH+YDT+KGSDWLGD DAI Y+  EAPQSV ELEH+GVPFSR   GKI
Sbjct: 101 AALANMTEDDWRWHMYDTVKGSDWLGDQDAIHYMCREAPQSVIELEHFGVPFSRTPEGKI 160

Query: 125 YQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINS 184
           YQR FGG    +G+G    R  A ADRTGHAILHTLYGQ+L+++  FFIEYFALDLI+ +
Sbjct: 161 YQRAFGGQSLKFGKGGQAYRCAAVADRTGHAILHTLYGQSLRHDTTFFIEYFALDLIMEN 220

Query: 185 EGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPL 244
            G C GV+A  +E G IHRF +   VLATGGYGRAYFS TSAHTCTGDG  MV RAGLPL
Sbjct: 221 -GECRGVIALNMEDGTIHRFRSHKTVLATGGYGRAYFSCTSAHTCTGDGNAMVTRAGLPL 279

Query: 245 QDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCM 304
           QD+EFVQFHPTGIYGAGCLITEG+RGEGGYL+NS+GE FM RYAP+AKDLASRDVVSR M
Sbjct: 280 QDLEFVQFHPTGIYGAGCLITEGSRGEGGYLLNSEGEPFMARYAPTAKDLASRDVVSRSM 339

Query: 305 MMEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVH 364
            +EIREGRGVG  KDH++L L+HL   VL  RLPGISE+A IFAGVDVT++PIPV+PTVH
Sbjct: 340 TIEIREGRGVGPQKDHLYLQLSHLPAEVLHSRLPGISETAAIFAGVDVTKEPIPVLPTVH 399

Query: 365 YNMGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRA 424
           YNMGGIPT Y GEV++      +   PGL A GEA C SVHGANRLG+NSL+D+VVFGRA
Sbjct: 400 YNMGGIPTRYTGEVIN-YVDGKDVVVPGLYAAGEAACVSVHGANRLGANSLLDIVVFGRA 458

Query: 425 AVIRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVF 484
           A +   + +   +P   L   +    +   D+LR+A G  PTA +R +MQ+ MQ DA VF
Sbjct: 459 AALHIKDTLAPDTPHKPLPADAGAATIANLDKLRYASGANPTANVRLEMQKVMQTDAAVF 518

Query: 485 RTQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARK 544
           RT+ SL +G + +  +  ++ DLKV DRSLIWN+DLVETLELQNLM NA+ T++SA ARK
Sbjct: 519 RTESSLLEGVKKIDQVSTKLKDLKVTDRSLIWNTDLVETLELQNLMTNAVQTMHSAYARK 578

Query: 545 ESRGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKI 604
           ESRG+HAREDFKD     R+D  W KH+L   D  TG + L+YR V +  L    +   +
Sbjct: 579 ESRGAHAREDFKD-----RNDTEWMKHTLSRHDLETGAVSLEYRKVISHTLDEN-EAKSV 632

Query: 605 APKARVY 611
            P ARVY
Sbjct: 633 PPVARVY 639


>gi|303289252|ref|XP_003063914.1| predicted protein [Micromonas pusilla CCMP1545]
 gi|226454982|gb|EEH52287.1| predicted protein [Micromonas pusilla CCMP1545]
          Length = 640

 Score =  764 bits (1972), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/605 (64%), Positives = 468/605 (77%), Gaps = 10/605 (1%)

Query: 8   KSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASL 67
           K +Y  +DH YD VVVGAGGAGLRA +G++E G KTAC+TK+FPTRSHTVAAQGGI A+L
Sbjct: 45  KPAYQIIDHEYDAVVVGAGGAGLRAAIGLSEHGLKTACVTKLFPTRSHTVAAQGGINAAL 104

Query: 68  ANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQR 127
            NMT D W+WH YDTIKG+DWLGD DAIQY+  EAP++V ELE+YG+PFSR +  KIYQR
Sbjct: 105 GNMTEDDWRWHAYDTIKGADWLGDQDAIQYMCREAPKAVIELENYGLPFSRTDDEKIYQR 164

Query: 128 PFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGC 187
            FGG   +YG G    R   AADRTGHA+LHTLYGQALK++ +FF+EYFALDLI++  G 
Sbjct: 165 AFGGQSLDYGRGGQAYRCACAADRTGHAMLHTLYGQALKHDTQFFVEYFALDLIMD-RGE 223

Query: 188 CVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDM 247
           CVGVVA  +E G IHRF +   +LATGGYGRAYFSATSAHTCTGDG  MVARAGLPLQD+
Sbjct: 224 CVGVVAMCMEDGTIHRFRSHKTILATGGYGRAYFSATSAHTCTGDGNAMVARAGLPLQDL 283

Query: 248 EFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMME 307
           EFVQFHPTGIYGAGCLITEG+RGEGG L NS+GERFMERYAP+AKDLASRDVVSR M ME
Sbjct: 284 EFVQFHPTGIYGAGCLITEGSRGEGGILRNSEGERFMERYAPTAKDLASRDVVSRSMTME 343

Query: 308 IREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNM 367
           IREGRGVG  KDHI+L+LNHL P +L ERLPGISE+A IFAGVDVT++PIPVIPTVHYNM
Sbjct: 344 IREGRGVGPEKDHIYLHLNHLPPEILAERLPGISETAAIFAGVDVTKEPIPVIPTVHYNM 403

Query: 368 GGIPTNYWGEVLDANSK-NPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAV 426
           GGIPTNY GEVL   S  NP+   PGL+A GE   ASVHGANRLG+NSL+D+VVFGRA  
Sbjct: 404 GGIPTNYKGEVLTIGSDGNPDTVVPGLLAAGECASASVHGANRLGANSLLDIVVFGRACA 463

Query: 427 IRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRT 486
              SE +    P   L     +  +   + +R A G   TA++R+ MQR MQ DA VFRT
Sbjct: 464 NTVSETLKPGMPHRKLASDFGEHAIAHLESVRSASGAHSTASVRKAMQRVMQDDAAVFRT 523

Query: 487 QDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKES 546
           Q++L++GC  +  +   + DL V D+SL+WN+DL+E LEL NLM NA  T++SAE RKES
Sbjct: 524 QETLAEGCVKIDEVASRLEDLDVTDKSLVWNTDLIEALELHNLMPNAQITMHSAEQRKES 583

Query: 547 RGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAP 606
           RG+HAREDF +     RDDV+W KH+L +VD    K+K+DYRPVH++ L   +++  + P
Sbjct: 584 RGAHAREDFPN-----RDDVSWMKHTLGFVDEKR-KVKIDYRPVHSQPLDDEMEH--VPP 635

Query: 607 KARVY 611
           KARVY
Sbjct: 636 KARVY 640


>gi|255087886|ref|XP_002505866.1| succinate dehydrogenase [Micromonas sp. RCC299]
 gi|226521136|gb|ACO67124.1| succinate dehydrogenase [Micromonas sp. RCC299]
          Length = 640

 Score =  763 bits (1971), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/604 (64%), Positives = 469/604 (77%), Gaps = 9/604 (1%)

Query: 8   KSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASL 67
           KS+YT +DH YD VVVGAGGAGLRA +G++E G KTACITK+FPTRSHTVAAQGGI A+L
Sbjct: 46  KSAYTIIDHEYDAVVVGAGGAGLRAAIGLSEHGLKTACITKLFPTRSHTVAAQGGINAAL 105

Query: 68  ANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQR 127
            NMT D W+WH YDTIKGSDWLGD DAIQY+  EAP++V ELE+YG+PFSR + GKIYQR
Sbjct: 106 GNMTEDDWRWHAYDTIKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFSRTDDGKIYQR 165

Query: 128 PFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGC 187
            FGG   +YG+G    R   AADRTGHA+LHTLYGQALK++ +FF+EYFALDLI++ EG 
Sbjct: 166 AFGGQSLDYGKGGQAYRCACAADRTGHAMLHTLYGQALKHDTQFFVEYFALDLIMH-EGE 224

Query: 188 CVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDM 247
           CVGVVA  +E G IHRF +   VLATGGYGRAYFSATSAHTCTGDG  MV RAGLP+QD+
Sbjct: 225 CVGVVAMCMEDGTIHRFRSHKTVLATGGYGRAYFSATSAHTCTGDGNAMVTRAGLPMQDL 284

Query: 248 EFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMME 307
           EFVQFHPTGIYGAGCLITEG+RGEGG L NS+GERFMERYAPSAKDLASRDVVSR M +E
Sbjct: 285 EFVQFHPTGIYGAGCLITEGSRGEGGILRNSEGERFMERYAPSAKDLASRDVVSRSMTIE 344

Query: 308 IREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNM 367
           IREGRGVG  KDHI+L+LNHL P +L ERLPGISE+A IFAGVDVT++PIPVIPTVHYNM
Sbjct: 345 IREGRGVGPEKDHIYLHLNHLPPELLAERLPGISETAAIFAGVDVTKEPIPVIPTVHYNM 404

Query: 368 GGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVI 427
           GGIPTNY GEVL   S   +   PGL+A GE   +SVHGANRLG+NSL+D+VVFGRA   
Sbjct: 405 GGIPTNYKGEVLTLGSDGKDTVVPGLLAAGECASSSVHGANRLGANSLLDIVVFGRACAN 464

Query: 428 RASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQ 487
             +E +   +P   +   + +  +   D++R ++G   TA +R+ MQR MQ DA VFRTQ
Sbjct: 465 TIAETLKPGTPHKKIPSDAGENAVAHLDKVRWSNGQHSTADVRKTMQRVMQDDAAVFRTQ 524

Query: 488 DSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESR 547
           ++L++G + +  +   + DLKV D+S++WN+DL+E LEL NLM NA  T++SAE RKESR
Sbjct: 525 ETLAEGVKKIDEVAARLDDLKVTDKSMVWNTDLIEALELHNLMPNAQITMHSAEQRKESR 584

Query: 548 GSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPK 607
           G+HAREDF D     RDD NW KH+L WVD +  K+ +DYR V    L   +++  + PK
Sbjct: 585 GAHAREDFPD-----RDDANWMKHTLGWVD-DKRKVNIDYRAVIQTPLDDEMEH--VPPK 636

Query: 608 ARVY 611
           ARVY
Sbjct: 637 ARVY 640


>gi|47060299|gb|AAT09765.1| succinate dehydrogenase subunit A [Anaplasma phagocytophilum]
          Length = 604

 Score =  761 bits (1966), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/606 (63%), Positives = 455/606 (75%), Gaps = 9/606 (1%)

Query: 8   KSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASL 67
           +S+Y  VDH YDVVVVGAGGAGLRA +GM   G   AC+TKVFPTRSHTVAAQGGI+A+L
Sbjct: 6   RSAYEVVDHEYDVVVVGAGGAGLRAVVGMTAAGLSVACVTKVFPTRSHTVAAQGGISAAL 65

Query: 68  ANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQR 127
            N+  D W+WH++DT+KGSDWLGD DAI+Y+   A QSV ELEH G  FSR + GKIYQR
Sbjct: 66  GNIAEDDWRWHMFDTVKGSDWLGDQDAIEYMCKNAMQSVVELEHCGCLFSRTKEGKIYQR 125

Query: 128 PFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEG- 186
           P+GG    YG+G P  RTCAA+D+TGHAILH LY Q+L+ +A+FF+EYFA+DLI++ +  
Sbjct: 126 PYGGMTTEYGKGKPAVRTCAASDKTGHAILHALYQQSLRFDAKFFVEYFAIDLIMSEDNR 185

Query: 187 CCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQD 246
            C GV+AW L  G +HRF A  VVLATGGYGR YFSATSAHTCTGDG GM ARAG+PL+D
Sbjct: 186 SCCGVLAWSLCDGVLHRFRAHAVVLATGGYGRVYFSATSAHTCTGDGGGMAARAGIPLED 245

Query: 247 MEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMM 306
           MEFVQFHPTGIYG+GCL+TEG RGEGGYL+NS GERFMERYAP AKDLASRDVVSR M M
Sbjct: 246 MEFVQFHPTGIYGSGCLMTEGCRGEGGYLLNSAGERFMERYAPKAKDLASRDVVSRSMTM 305

Query: 307 EIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYN 366
           EIREGRGVG+ KDHI+L + HLDP V+ ERLPGISE+A+ FAGVDVT++PIPVIPTVHYN
Sbjct: 306 EIREGRGVGEKKDHIYLSIAHLDPKVIHERLPGISETAKTFAGVDVTKEPIPVIPTVHYN 365

Query: 367 MGGIPTNYWGEVLDANSKNPE-RFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAA 425
           MGGIPTNY GEVL  NS +       GL AIGEA C SVHGANRLGSNSL+DLVVFGRAA
Sbjct: 366 MGGIPTNYHGEVLSLNSSSGSYEVVEGLFAIGEAACVSVHGANRLGSNSLLDLVVFGRAA 425

Query: 426 VIRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFR 485
            IRA E+I        +     D I+DRFDR+R+A+G    A +R +MQ  MQ  A VFR
Sbjct: 426 AIRAKEVIKPGGLHRPIRKDFEDSIIDRFDRMRYANGATRVAEIRSRMQNVMQEHAAVFR 485

Query: 486 TQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKE 545
             + L  G + +  +   M D+ V DRS++WNSDLVE LEL N+M  A+ TV  A  RKE
Sbjct: 486 VAEVLEKGKKEIRGVAAMMKDISVTDRSMVWNSDLVEALELSNMMPQAVVTVDCAANRKE 545

Query: 546 SRGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIA 605
           SRG+HAREDF +     RDD NW KH++ W + +T ++K+ Y+ V T  L   V+Y    
Sbjct: 546 SRGAHAREDFPE-----RDDENWMKHTMAWCNCDTYEVKIGYKEVATYTLTNEVEY--FP 598

Query: 606 PKARVY 611
           P+ RVY
Sbjct: 599 PQKRVY 604


>gi|88812338|ref|ZP_01127588.1| succinate dehydrogenase [Nitrococcus mobilis Nb-231]
 gi|88790345|gb|EAR21462.1| succinate dehydrogenase [Nitrococcus mobilis Nb-231]
          Length = 596

 Score =  761 bits (1964), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/605 (64%), Positives = 466/605 (77%), Gaps = 9/605 (1%)

Query: 7   LKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAAS 66
           +   Y  +DHSYDVVVVGAGGAGLRATLGMAEKG  TAC+TK+FPTRSHTV+AQGGI+A+
Sbjct: 1   MAGDYVIIDHSYDVVVVGAGGAGLRATLGMAEKGLTTACVTKLFPTRSHTVSAQGGISAA 60

Query: 67  LANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQ 126
           L NM  D W+WH YDTIKGSDWLGD DAI+Y+  EA  ++ ELEHYGVPFSR E G+IYQ
Sbjct: 61  LGNMGEDDWRWHAYDTIKGSDWLGDQDAIEYMCREAIPAILELEHYGVPFSRTEQGRIYQ 120

Query: 127 RPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEG 186
           R FGG   ++GEG  + RTCAAADRTGHAILH LY QALK+ AEFFIE+FA+DLI++++G
Sbjct: 121 RAFGGMTTHFGEGRAL-RTCAAADRTGHAILHALYQQALKHQAEFFIEFFAIDLIMDAQG 179

Query: 187 CCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQD 246
            C GV+A +L TGEIHRF A L VLATGGYGR+YFS TSAHTCTGDG GM  RAGL LQD
Sbjct: 180 VCRGVIALELATGEIHRFRAHLTVLATGGYGRSYFSCTSAHTCTGDGNGMALRAGLALQD 239

Query: 247 MEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMM 306
           MEF+QFHPTGIYGAG LITEG RGEGGYL NS+G RFME YAP AKDLASRDVVSR M +
Sbjct: 240 MEFIQFHPTGIYGAGMLITEGVRGEGGYLTNSEGNRFMEHYAPHAKDLASRDVVSRAMTV 299

Query: 307 EIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYN 366
           EIREGRGVG SKDH+HL+L+HL P V+ ERLPGI+E+ RIFAGVDV RDPIPV+PT HY 
Sbjct: 300 EIREGRGVGPSKDHLHLHLDHLSPEVIHERLPGIAETTRIFAGVDVRRDPIPVLPTAHYT 359

Query: 367 MGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAV 426
           MGG+PTN  GE +     +     PGLMAIGEA C SVHGANRLGSNSL+D+VVFGRAA 
Sbjct: 360 MGGVPTNLHGEAVTLRGGDSNSVVPGLMAIGEAACVSVHGANRLGSNSLLDIVVFGRAAA 419

Query: 427 IRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRT 486
           +RA++++ +  P P L   + +  + R +RLR+A G  PTA +RE+MQR MQ  A VFR 
Sbjct: 420 LRAAQIVKEQGPPPPLPRDAAEPALTRLERLRYAKGGEPTAMIRERMQRTMQDCAAVFRD 479

Query: 487 QDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKES 546
             +L +GC+ ++ ++   A + V DRSLIWN+DLVETLEL+NL+  AI  V SA  R E+
Sbjct: 480 LPTLEEGCKRIAEVYQHFAGVSVSDRSLIWNTDLVETLELENLLGCAITAVESARNRTET 539

Query: 547 RGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAP 606
           RG+H+RED+ +     RDD +W KH+L W+D  +GK+ LDYRPV    L G +    + P
Sbjct: 540 RGAHSREDYPE-----RDDRHWLKHTLSWLD-ASGKVSLDYRPVRLTPLTGAM--KAVPP 591

Query: 607 KARVY 611
           + RVY
Sbjct: 592 QVRVY 596


>gi|163796397|ref|ZP_02190357.1| Succinate dehydrogenase flavoprotein subunit [alpha proteobacterium
           BAL199]
 gi|159178247|gb|EDP62791.1| Succinate dehydrogenase flavoprotein subunit [alpha proteobacterium
           BAL199]
          Length = 596

 Score =  760 bits (1963), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/606 (64%), Positives = 466/606 (76%), Gaps = 16/606 (2%)

Query: 10  SYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLAN 69
           SY  +DH YD VVVGAGGAGLRATLGM  +G KTACITKVFPTRSHTVAAQGGI A+L N
Sbjct: 3   SYKIIDHEYDAVVVGAGGAGLRATLGMTMEGLKTACITKVFPTRSHTVAAQGGIGAALDN 62

Query: 70  MTP-DSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRP 128
           M   D+W++H+YDT+KGSDWLGD DAI+Y+   A  +V ELEH+GVPFSR + GKIYQRP
Sbjct: 63  MGEGDNWRFHMYDTVKGSDWLGDQDAIEYMCRNAIPAVIELEHFGVPFSRTDEGKIYQRP 122

Query: 129 FGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCC 188
           FGGH  ++G+    +R CAAADRTGHAILHTLY Q+L+N+AEFF+EYFALDLI+  +G C
Sbjct: 123 FGGHTLDHGKAM-AKRACAAADRTGHAILHTLYQQSLRNHAEFFVEYFALDLIMGDDGAC 181

Query: 189 VGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDME 248
            GV+A  LE G IHRF A   VLATGGYGRAYFS TSAHTCTGDG  MV RAGLPLQDME
Sbjct: 182 RGVMALCLEDGTIHRFRAHETVLATGGYGRAYFSCTSAHTCTGDGNAMVLRAGLPLQDME 241

Query: 249 FVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEI 308
           FVQFHPTGIYGAGCLITEGARGEGGYL NS+GERFMERYAP+AKDLASRDVVSR M +EI
Sbjct: 242 FVQFHPTGIYGAGCLITEGARGEGGYLTNSEGERFMERYAPTAKDLASRDVVSRAMTIEI 301

Query: 309 REGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMG 368
            EGRGVG +KDHI L+L HLDP VL  RLPGISE+A++FAG +VT++PIPV+PTVHYNMG
Sbjct: 302 NEGRGVGPNKDHIMLHLEHLDPQVLHHRLPGISETAKVFAGAEVTKEPIPVLPTVHYNMG 361

Query: 369 GIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIR 428
           GIPTNY GEVL   + +P+R  PGLMAIGEA C SVHGANRLG+NSL+D+VVFGRAA  R
Sbjct: 362 GIPTNYHGEVLSPTADDPDRVVPGLMAIGEAACVSVHGANRLGTNSLLDIVVFGRAAAHR 421

Query: 429 ASEMI---DKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFR 485
           A+E++   ++  P+P+    + +  + R +R+R A G     A+R  MQR MQ +A VFR
Sbjct: 422 AAEVVTPGERHKPMPT---DAGEHAIARLERMRTAKGDRKAGAIRLDMQRTMQTNAAVFR 478

Query: 486 TQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKE 545
           T + +  G + +  + D MAD+ ++DRSLIWNSDLVE LEL+NL+  AI T+ SA  RKE
Sbjct: 479 TDELMQAGLKKIHEVADSMADVGLNDRSLIWNSDLVEALELENLISQAIVTLTSASLRKE 538

Query: 546 SRGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIA 605
           SRG+HA EDF D     RDD NW KH+  W+D    + K+ YR VH   L   V+   I 
Sbjct: 539 SRGAHAHEDFPD-----RDDANWMKHTAMWLD-EKNQHKVLYRDVHMNTLSNEVE--SIP 590

Query: 606 PKARVY 611
           P ARVY
Sbjct: 591 PVARVY 596


>gi|288856295|ref|NP_001165801.1| succinate dehydrogenase complex, subunit A, flavoprotein (Fp)
           [Nasonia vitripennis]
          Length = 661

 Score =  760 bits (1963), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/601 (63%), Positives = 459/601 (76%), Gaps = 14/601 (2%)

Query: 2   KNSSNLKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQG 61
           K S  +  +Y  VDH++D VVVGAGGAGLRA  G+ E+GFKTA +TK+FPTRSHTVAAQG
Sbjct: 43  KTSDGISQNYPVVDHTFDAVVVGAGGAGLRAAYGLVEEGFKTAVVTKLFPTRSHTVAAQG 102

Query: 62  GIAASLANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEA 121
           GI A+L NM  D+WQWH+YDT+KGSDWLGD DAI Y+  EAP++V ELE+ G+PFSR   
Sbjct: 103 GINAALGNMEEDNWQWHMYDTVKGSDWLGDQDAIHYMTREAPKAVIELENCGMPFSRTTE 162

Query: 122 GKIYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLI 181
           GKIYQR FGG    +G+G    R C  ADRTGH++LHTLYGQ+L  +  +FIEYFALDL+
Sbjct: 163 GKIYQRAFGGQSLKFGKGGQAHRCCCVADRTGHSLLHTLYGQSLSFDCNYFIEYFALDLL 222

Query: 182 INSEGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAG 241
           +  +G C GV+A  LE G +HRF AK  VLATGGYGRAYFS TSAHTCTGDG  MV+RA 
Sbjct: 223 M-EDGECRGVIALCLEDGTLHRFHAKNTVLATGGYGRAYFSCTSAHTCTGDGTAMVSRAN 281

Query: 242 LPLQDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVS 301
           LP QD+EFVQFHPTGIYGAGCLITEG+RGEGGYLVNS+GERFMERYAP AKDLASRDVVS
Sbjct: 282 LPNQDLEFVQFHPTGIYGAGCLITEGSRGEGGYLVNSEGERFMERYAPVAKDLASRDVVS 341

Query: 302 RCMMMEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIP 361
           R M +EIREGRGVG  KDHI+L L+HL P  L  RLPGISE+A IFAGVDVTR+PIPV+P
Sbjct: 342 RSMTIEIREGRGVGPEKDHIYLQLHHLPPEQLAARLPGISETAMIFAGVDVTREPIPVLP 401

Query: 362 TVHYNMGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVF 421
           TVHYNMGG+PTNY G+VL + + N +   PGL A GE+ CASVHGANRLG+NSL+DLVVF
Sbjct: 402 TVHYNMGGVPTNYRGQVLTSKN-NQDSVVPGLYACGESACASVHGANRLGANSLLDLVVF 460

Query: 422 GRAAVIRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDA 481
           GRA     SE       I SL  ++ +  +   D++R+A G++ TA LR  MQ+ MQ  A
Sbjct: 461 GRACAKTISEENKPGEKIGSLRTNAGEESVANLDKIRNAKGNISTAELRLTMQKTMQTHA 520

Query: 482 GVFRTQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAE 541
            VFR  D+L +GC+ +S L+ ++ DLK+ DRSL+WNSDL+ETLELQNLM+NA+ T+Y+AE
Sbjct: 521 AVFRQADTLQEGCKKMSALYKKLDDLKITDRSLVWNSDLIETLELQNLMVNAMQTIYAAE 580

Query: 542 ARKESRGSHAREDFKD------------GEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRP 589
            RKESRG+HAREDFKD            G+     D +WRKH+L  VD NTG +K+DYRP
Sbjct: 581 NRKESRGAHAREDFKDRIDEYDYSKPLEGQQPKPLDQHWRKHTLTHVDINTGDVKIDYRP 640

Query: 590 V 590
           V
Sbjct: 641 V 641


>gi|328855613|gb|EGG04738.1| hypothetical protein MELLADRAFT_44058 [Melampsora larici-populina
           98AG31]
          Length = 648

 Score =  760 bits (1962), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/603 (63%), Positives = 455/603 (75%), Gaps = 8/603 (1%)

Query: 11  YTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLANM 70
           Y  +DH YD +VVGAGGAGLRA  G+AE G  TACITK+FPTRSHTVAAQGG+ A+L NM
Sbjct: 52  YPIIDHEYDAIVVGAGGAGLRAAFGLAEAGLNTACITKLFPTRSHTVAAQGGVNAALGNM 111

Query: 71  TPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRPFG 130
           T D W+WH+YDT+KGSDWLGD DAI Y+  EAPQ+V ELEH+GVPFSR + GKIYQR FG
Sbjct: 112 TEDDWRWHMYDTVKGSDWLGDQDAIHYMCKEAPQAVIELEHFGVPFSRTKDGKIYQRAFG 171

Query: 131 GHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCCVG 190
           G    YG+G    R  AAADRTGHAILHTLYGQ+L++N  FF+E+FALDLI++  G CVG
Sbjct: 172 GQSLKYGKGGQAYRCAAAADRTGHAILHTLYGQSLRHNTNFFVEFFALDLIMDDAGRCVG 231

Query: 191 VVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDMEFV 250
           V A+  E G +HRF A   VLATGGYGRAYFS TSAHTC+GDG  MV RAGLPLQD+EFV
Sbjct: 232 VTAYNQEDGTLHRFRAHQTVLATGGYGRAYFSCTSAHTCSGDGNAMVTRAGLPLQDLEFV 291

Query: 251 QFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEIRE 310
           QFHPTGIYGAGCLITEG+RGEGGYL+NS+GERFMERYAP+AKDLASRDVVSR M +EIRE
Sbjct: 292 QFHPTGIYGAGCLITEGSRGEGGYLLNSEGERFMERYAPTAKDLASRDVVSRSMTIEIRE 351

Query: 311 GRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMGGI 370
           GRGVG  KDH +L L+HL P VL ERLPGISE+A IFAGVDVT++PIPV+PTVHYNMGGI
Sbjct: 352 GRGVGPDKDHCYLQLSHLPPEVLHERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGI 411

Query: 371 PTNYWGEVLDANSKN-PERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIRA 429
           PTNY G+V+  +SK   ++  PGL A GEA C SVHGANRLG+NSL+D+VVFGRA     
Sbjct: 412 PTNYHGQVITQDSKTGADKIVPGLYAAGEAACVSVHGANRLGANSLLDIVVFGRACAKHI 471

Query: 430 SEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQDS 489
           +  ++ + P   +   +  + +D  DRLR+A G  PTA +R  MQ+ MQ DA VFRTQ S
Sbjct: 472 AANLEPNQPHAKIAEDAGMKSIDDLDRLRNASGPKPTAEIRSDMQKVMQSDAAVFRTQSS 531

Query: 490 LSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRGS 549
           L +G   ++ + D   D+ V DRS+IWN+DLVETLEL+NL+  A  T+ SAEARKESRG+
Sbjct: 532 LEEGVTKINKVVDSFKDIGVTDRSMIWNTDLVETLELRNLLTCAAQTMASAEARKESRGA 591

Query: 550 HAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGK-IKLDYRPVHTELLCGGVDYSKIAPKA 608
           HAREDF +     R+D  W KH+L W +   GK +KL YR V +  L    +   + P  
Sbjct: 592 HAREDFPE-----REDDTWMKHTLSWHEPEAGKPVKLTYRDVISNTLDEN-ECKSVPPFK 645

Query: 609 RVY 611
           R Y
Sbjct: 646 RTY 648


>gi|195381245|ref|XP_002049364.1| GJ21546 [Drosophila virilis]
 gi|194144161|gb|EDW60557.1| GJ21546 [Drosophila virilis]
          Length = 665

 Score =  759 bits (1959), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/621 (59%), Positives = 451/621 (72%), Gaps = 15/621 (2%)

Query: 3   NSSNLKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGG 62
           N   +   Y  VDH+YD +VVGAGG+GLRA  G+  +GF+TA ITK+FPTRSHT+AAQGG
Sbjct: 48  NPDAISKQYPIVDHAYDAIVVGAGGSGLRAAFGLVAEGFRTAVITKLFPTRSHTIAAQGG 107

Query: 63  IAASLANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAG 122
           I A+L NM  D W+WH+YDTIKGSDWLGD DAI Y+  EAP++V ELE+YG+PFSR + G
Sbjct: 108 INAALGNMEQDDWKWHMYDTIKGSDWLGDQDAIHYMTREAPKAVIELENYGMPFSRTQDG 167

Query: 123 KIYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLII 182
           KIYQR FGG    +G+G    R CA ADRTGH++LHTLYGQ+L  +  +F+EYFALDLI 
Sbjct: 168 KIYQRAFGGQSLKFGKGGQAHRCCAVADRTGHSLLHTLYGQSLSYDCHYFVEYFALDLIF 227

Query: 183 NSEGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGL 242
             +G C GV+A  LE G +HRF A+  V+ATGGYGRA+FS TSAHTCTGDG  +VAR GL
Sbjct: 228 -EDGECRGVLAINLEDGSLHRFRAQNTVVATGGYGRAFFSCTSAHTCTGDGTALVARQGL 286

Query: 243 PLQDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSR 302
           P QD+EFVQFHPTGIYGAGCLITEG RGEGGYL+NSKGERFMERYAP AKDLASRDVVSR
Sbjct: 287 PSQDLEFVQFHPTGIYGAGCLITEGCRGEGGYLINSKGERFMERYAPVAKDLASRDVVSR 346

Query: 303 CMMMEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPT 362
            + +E+ EGRGVG  KDH++L L+HL P  L ERLPGISE+A IFAGVDVTR+PIPV+PT
Sbjct: 347 SITIEVMEGRGVGPEKDHVYLQLHHLPPKQLAERLPGISETAMIFAGVDVTREPIPVLPT 406

Query: 363 VHYNMGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFG 422
           VHYNMGGIPTNY G+VL  +    ++  PGL A GEA C+SVHGANRLG+NSL+DLVVFG
Sbjct: 407 VHYNMGGIPTNYRGQVLTIDKDGNDKIVPGLYAAGEAACSSVHGANRLGANSLLDLVVFG 466

Query: 423 RAAVIRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAG 482
           RA     +E     +P P++  ++ +  +   D+LRHA+G++ TA LR KMQR MQ  A 
Sbjct: 467 RACAKTIAEENKPGAPAPTVKDNAGEFSVANLDKLRHANGNITTADLRLKMQRCMQNHAA 526

Query: 483 VFRTQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEA 542
           VFR    L  G R +  ++    D+KV D+SL+WNSDL+ETLELQNL+ NA  T+  AEA
Sbjct: 527 VFRDGPILQKGVREMKEIYKLFKDVKVIDKSLVWNSDLIETLELQNLLANAQMTIVGAEA 586

Query: 543 RKESRGSHAREDFK------------DGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPV 590
           RKESRG+HAREDFK            + +     + +WRKH+L WV    G I L YRPV
Sbjct: 587 RKESRGAHAREDFKVRLDEYDYSKPLENQEKKPIEQHWRKHTLAWVCSEEGDIDLKYRPV 646

Query: 591 HTELLCGGVDYSKIAPKARVY 611
               L   V+   + P  R Y
Sbjct: 647 IDHTLDNEVE--TVPPAIRSY 665


>gi|156377009|ref|XP_001630650.1| predicted protein [Nematostella vectensis]
 gi|156217675|gb|EDO38587.1| predicted protein [Nematostella vectensis]
          Length = 645

 Score =  758 bits (1957), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/627 (61%), Positives = 468/627 (74%), Gaps = 20/627 (3%)

Query: 3   NSSNLKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGG 62
           + + L   Y  VDH+YD VVVGAGGAGLRA  G++++GFKTACITK+FPTRSHTVAAQGG
Sbjct: 21  SKTELAREYPVVDHTYDAVVVGAGGAGLRAAFGLSQEGFKTACITKLFPTRSHTVAAQGG 80

Query: 63  IAASLANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAG 122
           I A+L NM PD W+WH+YDT+KGSDWLGD DAI Y+  EAP++V ELE+YG+PFSR E G
Sbjct: 81  INAALGNMEPDDWRWHMYDTVKGSDWLGDQDAIHYMTEEAPKAVIELENYGMPFSRTEEG 140

Query: 123 KIYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLII 182
           KIYQR FGG   +YG+G    R CA ADRTGH++LHTLYGQ+L+ + E+F+EYFALDL++
Sbjct: 141 KIYQRAFGGQSYDYGKGGQAHRCCAVADRTGHSLLHTLYGQSLRYDCEYFVEYFALDLLM 200

Query: 183 NSEGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGL 242
           + +G CVGV+A  LE G +HRF AK  VLATGGYGRAYFS TSAHTCTGDG  MV RAGL
Sbjct: 201 D-KGKCVGVIALCLEDGSLHRFRAKNTVLATGGYGRAYFSCTSAHTCTGDGTAMVTRAGL 259

Query: 243 PLQDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSR 302
           P +DMEFVQFHPTGIYGAGCLITEG+RGEGGYL+NS+GERFMERYAP+AKDLASRDVVSR
Sbjct: 260 PNEDMEFVQFHPTGIYGAGCLITEGSRGEGGYLINSEGERFMERYAPTAKDLASRDVVSR 319

Query: 303 CMMMEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPT 362
            M +EIREGRGVG  KDH++L L+HL    L+ RLPGISE+A IFAGVDVTRDPIPV+PT
Sbjct: 320 SMTIEIREGRGVGPMKDHVYLQLSHLPAETLKTRLPGISETAMIFAGVDVTRDPIPVLPT 379

Query: 363 VHYNMGGIPTNYWGEV------LDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLI 416
           VHYNMGG+PTN+ G+V         +    +    GL A GE+ CASVHGANRLG+NSL+
Sbjct: 380 VHYNMGGVPTNFKGQVGHLSFISGVSLSFRDEIVDGLWAAGESACASVHGANRLGANSLL 439

Query: 417 DLVVFGRAAVIRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRA 476
           DLVVFGRA     ++       +P L  S+ +  +   D +R+A+G  PTA LR  MQR 
Sbjct: 440 DLVVFGRACANFIAKENKPGETLPDLPPSAGEASVANLDAVRYANGSTPTAELRTDMQRT 499

Query: 477 MQLDAGVFRTQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIAT 536
           MQ  A VFRT   L +GC+ +  L+ ++ DLK++DRS++WNSDLVE+LELQNLM+NA+ T
Sbjct: 500 MQNHAAVFRTGPVLEEGCKKMDELYQKLKDLKLYDRSMVWNSDLVESLELQNLMLNALMT 559

Query: 537 VYSAEARKESRGSHAREDFK------------DGEFGGRDDVNWRKHSLCWVDWNTGKIK 584
           + SAEARKESRG+HARED+K            DG+     D +WRKH+L WVD  TGK  
Sbjct: 560 IKSAEARKESRGAHAREDYKDRIDEFDYSKPLDGQIKKPFDKHWRKHTLAWVDETTGKTT 619

Query: 585 LDYRPVHTELLCGGVDYSKIAPKARVY 611
           LDYR V  E L    D   + P  R Y
Sbjct: 620 LDYRGVIDETL-DQKDCKTVPPAVRSY 645


>gi|189184862|ref|YP_001938647.1| succinate dehydrogenase flavoprotein subunit [Orientia
           tsutsugamushi str. Ikeda]
 gi|189181633|dbj|BAG41413.1| succinate dehydrogenase flavoprotein subunit [Orientia
           tsutsugamushi str. Ikeda]
          Length = 595

 Score =  758 bits (1957), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/608 (63%), Positives = 461/608 (75%), Gaps = 19/608 (3%)

Query: 9   SSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLA 68
            +Y  ++H +DVVVVGAGGAGLRA +GMAE G + ACITK+FPTRSHTVAAQGGI+A+L 
Sbjct: 2   KAYKIINHEFDVVVVGAGGAGLRAIVGMAESGLRAACITKLFPTRSHTVAAQGGISAALG 61

Query: 69  NMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRP 128
           N+ PD WQWH YDTIKGSDWLGD DAI Y+  EAP ++ ELEHYGVPFSR   GKIYQRP
Sbjct: 62  NIQPDKWQWHAYDTIKGSDWLGDQDAIAYMCKEAPAAIIELEHYGVPFSRTTDGKIYQRP 121

Query: 129 FGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCC 188
           FGG    +G+G    RTCAAADRTGHAILHTLY QALK+ A+FFIEY ALDLI+++ G C
Sbjct: 122 FGGMTTEFGDGAAAVRTCAAADRTGHAILHTLYQQALKHKAKFFIEYIALDLIMDN-GAC 180

Query: 189 VGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDME 248
            G+VAW L+ G IH F + +VVLATGGYGRAYFSATSAH+CTGDG  M ARAG+ LQDME
Sbjct: 181 KGIVAWNLDDGTIHCFRSHIVVLATGGYGRAYFSATSAHSCTGDGNAMCARAGIALQDME 240

Query: 249 FVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEI 308
           FVQFHPTGIYGAGCLITEGARGEGGYLVNS+GERFMERYAPSAKDLASRDVV+R M MEI
Sbjct: 241 FVQFHPTGIYGAGCLITEGARGEGGYLVNSEGERFMERYAPSAKDLASRDVVARAMTMEI 300

Query: 309 REGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMG 368
             GRGVG  KDHI L+LNHLD   +Q+RLPGISE+A IFAGVDVT+ PIPVIPTVHYNMG
Sbjct: 301 NAGRGVGIYKDHIFLHLNHLDSKTIQQRLPGISETAMIFAGVDVTKQPIPVIPTVHYNMG 360

Query: 369 GIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIR 428
           GIPTNY G+V+           PGLMAIGEA C SVHGANRLGSNSL+DL++FGRAA  +
Sbjct: 361 GIPTNYHGQVVTKTENGDMEIVPGLMAIGEAACVSVHGANRLGSNSLLDLIIFGRAAANK 420

Query: 429 ASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQD 488
           A E+I  S+    L  +  D I++RFD+ R  +G++P A LR  MQRAMQ  AGVFR+ D
Sbjct: 421 AKEIIAISTKHQPLGNNIVDAIIERFDQTRFLNGNMPIAELRLTMQRAMQNYAGVFRSYD 480

Query: 489 SLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRG 548
            L++G + +   ++   D+K+ D SLIWN+DLVE +ELQNL+  A  T++ A  R+ESRG
Sbjct: 481 KLTEGMKIIKQNFNSRTDIKLTDHSLIWNTDLVEAIELQNLLYQAAITMFCAANRQESRG 540

Query: 549 SHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYR-----PVHTELLCGGVDYSK 603
           +HARED+ +     RDD NW KH+L  +D   G + +DYR     P   E++        
Sbjct: 541 AHAREDYPN-----RDDDNWLKHTLATID-EEGNVDIDYRNVVLDPKDDEMMA------- 587

Query: 604 IAPKARVY 611
           I PK RVY
Sbjct: 588 IVPKKRVY 595


>gi|323450812|gb|EGB06691.1| hypothetical protein AURANDRAFT_37947 [Aureococcus anophagefferens]
          Length = 629

 Score =  757 bits (1954), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/617 (61%), Positives = 464/617 (75%), Gaps = 12/617 (1%)

Query: 1   MKNSSNLKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQ 60
           +   S LK  YT VDHSYDV VVGAGGAGLRA +G AE GFKTAC+TK+FPTRSHTVAAQ
Sbjct: 19  LSTVSGLKGDYTVVDHSYDVCVVGAGGAGLRAAMGAAEAGFKTACVTKLFPTRSHTVAAQ 78

Query: 61  GGIAASLANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNE 120
           GGI A+L NM+ D W+WH+YDT+KGSDWLGD DAI Y+  EAPQ+V ELE +G+PFSR +
Sbjct: 79  GGINAALGNMSEDDWKWHMYDTVKGSDWLGDQDAIHYMCREAPQAVLELESFGLPFSRTD 138

Query: 121 AGKIYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDL 180
            GKIYQR FGG   +YG+G    R CAAADRTGHA+LHTLYG++L  +  +F+EYFALDL
Sbjct: 139 DGKIYQRAFGGQSLDYGKGGQAYRCCAAADRTGHAMLHTLYGRSLAFDTTYFLEYFALDL 198

Query: 181 IINSEGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARA 240
           I++ EG CVG+VA  +E G +HR +A   VLATGGYGRAYFS TSAHTCTGDG  M  RA
Sbjct: 199 IMDDEGSCVGIVAINMEDGTLHRINASNTVLATGGYGRAYFSCTSAHTCTGDGNAMALRA 258

Query: 241 GLPLQDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVV 300
           GL  +D EFVQFHPTGIYGAGCLITEG RGEGG L NS+GERFMERYAPSAKDLASRDVV
Sbjct: 259 GLAAEDPEFVQFHPTGIYGAGCLITEGCRGEGGILRNSEGERFMERYAPSAKDLASRDVV 318

Query: 301 SRCMMMEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVI 360
           SR M MEIREGRGVGK  DH +L+L+HL   +L ERLPGISE+A IFAGVDVT++PIPV+
Sbjct: 319 SRAMTMEIREGRGVGKDADHCYLHLDHLPAELLAERLPGISETAAIFAGVDVTKEPIPVL 378

Query: 361 PTVHYNMGGIPTNYWGEVL------DANSKNPERFAPGLMAIGEAGCASVHGANRLGSNS 414
           PTVHYNMGGIPTN+ GEV+      D +  + +   PGL A GEA CASVHGANRLG+NS
Sbjct: 379 PTVHYNMGGIPTNHLGEVIRQVTGPDGSVIDHDEVVPGLFAAGEAACASVHGANRLGANS 438

Query: 415 LIDLVVFGRAAVIRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQ 474
           L+D+VVFGRA  +R +++ +  +P+P L   + ++ +   D +R + G  PTA +R+ MQ
Sbjct: 439 LLDIVVFGRACALRIADIAEPGAPVPPLPADAAEKTIADVDAIRFSSGPRPTADVRKDMQ 498

Query: 475 RAMQLDAGVFRTQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAI 534
           + MQ  A V+RT +SL++GC  +    +  AD+ V DRSLIWN+DL+ET+EL+NL+ NA 
Sbjct: 499 KTMQDHAAVYRTAESLAEGCEKIQKNVEAFADIGVTDRSLIWNTDLIETIELRNLLPNAA 558

Query: 535 ATVYSAEARKESRGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTEL 594
            T+++AEARKESRG+HARED  D     R D  W KH++C+ D  T K  + YRP+H E 
Sbjct: 559 TTMFAAEARKESRGAHAREDTPD-----RLDDEWMKHTMCYFDEATNKTTVTYRPIHYET 613

Query: 595 LCGGVDYSKIAPKARVY 611
           L    +   + P ARVY
Sbjct: 614 L-DADECPVVPPVARVY 629


>gi|19115231|ref|NP_594319.1| succinate dehydrogenase Sdh1 [Schizosaccharomyces pombe 972h-]
 gi|31076658|sp|Q9UTJ7|DHSA_SCHPO RecName: Full=Probable succinate dehydrogenase [ubiquinone]
           flavoprotein subunit, mitochondrial; AltName:
           Full=Flavoprotein subunit of complex II; Short=FP;
           Flags: Precursor
 gi|6448607|emb|CAB61213.1| succinate dehydrogenase Sdh1 [Schizosaccharomyces pombe]
          Length = 641

 Score =  756 bits (1951), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/608 (60%), Positives = 445/608 (73%), Gaps = 7/608 (1%)

Query: 4   SSNLKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGI 63
           S++    Y  +DH+YD +VVGAGGAGLRAT G+AE GF TACITK+FPTRSHTVAAQGGI
Sbjct: 41  STSESVKYPVIDHTYDAIVVGAGGAGLRATFGLAEAGFNTACITKLFPTRSHTVAAQGGI 100

Query: 64  AASLANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGK 123
            A+L NMT D W+WH YDT+KGSDWLGD DAI Y+  EAP++V ELEH+GVPFSR + GK
Sbjct: 101 NAALGNMTKDDWRWHFYDTVKGSDWLGDQDAIHYMTKEAPKAVLELEHFGVPFSRTKEGK 160

Query: 124 IYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIIN 183
           IYQR FGG    YG+G    R  A ADRTGH+ILHTLYGQ+LK+N  FFIEYFA+DLI+ 
Sbjct: 161 IYQRAFGGQSLEYGKGGQAYRCAAVADRTGHSILHTLYGQSLKHNTNFFIEYFAMDLIME 220

Query: 184 SEGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLP 243
             G C GV+A  LE G IHRF A   +LATGGYGRAYFS TSAHTCTGDG  MV+RAGLP
Sbjct: 221 G-GECRGVIAMNLEDGSIHRFRAHKTILATGGYGRAYFSCTSAHTCTGDGNAMVSRAGLP 279

Query: 244 LQDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRC 303
           LQD+EFVQFHPTGIYGAGCLITEG RGEGGYL+NSKGERFMERYAP+AKDLASRDVVSR 
Sbjct: 280 LQDLEFVQFHPTGIYGAGCLITEGCRGEGGYLLNSKGERFMERYAPTAKDLASRDVVSRA 339

Query: 304 MMMEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTV 363
           M +EIREGRGVG  KDH +L L+HL   +L+ERLPGISE+A IFAGVDVT++PIPV+PTV
Sbjct: 340 MTVEIREGRGVGPEKDHCYLQLSHLPAEILKERLPGISETAAIFAGVDVTKEPIPVLPTV 399

Query: 364 HYNMGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGR 423
           HYNMGGIPT + GEVL  +    ++  PGL A GEA C SVHG NRLG+NSL+D+VVFGR
Sbjct: 400 HYNMGGIPTRFTGEVLTIDENGKDKIVPGLYAAGEAACVSVHGGNRLGANSLLDIVVFGR 459

Query: 424 AAVIRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGV 483
           A  +   + ++ ++P   L   +    +   D++R + G   T+ +R  MQ+ MQ D  V
Sbjct: 460 ACALHIKDTLEPNTPHKPLAADAGLDSLKFLDQIRTSQGPKHTSEIRLDMQKTMQRDVSV 519

Query: 484 FRTQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEAR 543
           FR +++L +G +N++ +     D+ + DR LIWN+DLVE LEL+NL+  A+ T  +A  R
Sbjct: 520 FRMEETLQEGVKNIARVDGTYKDIGIRDRGLIWNTDLVEALELRNLLTCAVQTANAALNR 579

Query: 544 KESRGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSK 603
           KESRG+HARED+ +     RDD NW KH+L W       + L YR V T       +   
Sbjct: 580 KESRGAHAREDYPE-----RDDKNWIKHTLTWQHKTGDPVTLKYRAV-TRTTMDENEVKP 633

Query: 604 IAPKARVY 611
           + P  RVY
Sbjct: 634 VPPFKRVY 641


>gi|219113829|ref|XP_002186498.1| succinate dehydrogenase flavoprotein [Phaeodactylum tricornutum
           CCAP 1055/1]
 gi|209583348|gb|ACI65968.1| succinate dehydrogenase flavoprotein [Phaeodactylum tricornutum
           CCAP 1055/1]
          Length = 638

 Score =  755 bits (1950), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/620 (60%), Positives = 459/620 (74%), Gaps = 19/620 (3%)

Query: 1   MKNSSNLKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQ 60
           +  S +L   YT +DH+YD VVVGAGG+GLRA +G++E GFKTAC+TK+FPTRSHTVAAQ
Sbjct: 29  LSTSPHLIGDYTVIDHTYDAVVVGAGGSGLRAAMGLSEAGFKTACVTKLFPTRSHTVAAQ 88

Query: 61  GGIAASLANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNE 120
           GGI A+L NM  D W+WH+YDT+KGSDWLGD DAI Y+  EAP++V ELE +G+PFSR E
Sbjct: 89  GGINAALGNMGEDDWRWHMYDTVKGSDWLGDQDAIHYMCREAPKAVLELEEFGMPFSRTE 148

Query: 121 AGKIYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDL 180
            GKIYQR FGG   ++G+G    R  AAADRTGHA+LHTLYG++L  +  +FIEYFA+DL
Sbjct: 149 EGKIYQRAFGGQSLDFGKGGQAYRCAAAADRTGHAMLHTLYGRSLAFDTTYFIEYFAMDL 208

Query: 181 IINSEGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARA 240
           ++N +G CVGVVA  +E G IHR  AK  VLATGGYGR YFS TSAHTCTGDG  M  R 
Sbjct: 209 LMNDQGECVGVVALNMEDGTIHRIHAKNTVLATGGYGRTYFSCTSAHTCTGDGNAMAMRQ 268

Query: 241 GLPLQDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVV 300
           GL  QD EFVQFHPTGIYGAGCLITEG RGEGG L NS+GERFMERYAPSAKDLASRDVV
Sbjct: 269 GLSNQDNEFVQFHPTGIYGAGCLITEGCRGEGGILRNSEGERFMERYAPSAKDLASRDVV 328

Query: 301 SRCMMMEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVI 360
           SR M MEIREGRG G  KDHI+L+L+HL P +L ERLPGISE+A IFAGVDVT++PIPV+
Sbjct: 329 SRSMTMEIREGRGAGPKKDHIYLHLDHLPPDLLAERLPGISETAAIFAGVDVTKEPIPVL 388

Query: 361 PTVHYNMGGIPTNYWGEVL------DANSKNPERFAPGLMAIGEAGCASVHGANRLGSNS 414
           PTVHYNMGGIPTN++GEV+      D N    E   PGL A GE+ CASVHGANRLG+NS
Sbjct: 389 PTVHYNMGGIPTNHYGEVIRTKFDKDGNFSKDE-VVPGLFASGESACASVHGANRLGANS 447

Query: 415 LIDLVVFGRAAVIRASEMI---DKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALRE 471
           L+D+VVFGRA   R +E+    DK +  PS D+      +   D+LR+A+GH  TA +R 
Sbjct: 448 LLDIVVFGRACANRIAEIAKPGDKIADGPS-DVGFGS--IAELDKLRYAEGHATTADIRS 504

Query: 472 KMQRAMQLDAGVFRTQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMI 531
           +MQ  MQ  A V+RT  +L++G   +  + D+  D+ V D+SL+WN+DLVETLEL+NL+ 
Sbjct: 505 EMQSVMQEHAAVYRTTQTLAEGKTAIDGVVDKFKDIAVTDKSLVWNTDLVETLELRNLLA 564

Query: 532 NAIATVYSAEARKESRGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVH 591
            A  T+Y AE RKESRG+HA ED+       RDD NW KH+L + D +TG+ ++ YRP+H
Sbjct: 565 CASTTMYGAENRKESRGAHAHEDYPT-----RDDENWMKHTLSYFDESTGRTEIKYRPIH 619

Query: 592 TELLCGGVDYSKIAPKARVY 611
              L    +   + P ARVY
Sbjct: 620 YYTL-DEDECKTVPPVARVY 638


>gi|300122231|emb|CBK22804.2| Succinate dehydrogenase flavoprotein subunit (SDHA) [Blastocystis
           hominis]
          Length = 641

 Score =  755 bits (1949), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/616 (62%), Positives = 468/616 (75%), Gaps = 16/616 (2%)

Query: 2   KNSSNLKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQG 61
           K + +L ++Y  VDH YD VVVGAGGAGLRA +G++E GFKTA ITK+FPTRSHTVAAQG
Sbjct: 36  KVTKDLGTAYPIVDHEYDCVVVGAGGAGLRAAMGLSEYGFKTAVITKLFPTRSHTVAAQG 95

Query: 62  GIAASLANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEA 121
           G+ A+L NM  D W+WH YDT+KGSDWLGD DAI Y+  EAP++V ELE YG+PFSR E 
Sbjct: 96  GVNAALGNMHEDDWRWHFYDTVKGSDWLGDQDAIHYMCREAPRAVRELEAYGLPFSRCEN 155

Query: 122 GKIYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLI 181
           GKIYQR FGG  +NYGEG    RT AAADRTGHA+LHTLYG++L  N  +FIEY ALDLI
Sbjct: 156 GKIYQRAFGGQTKNYGEGGQAYRTAAAADRTGHAMLHTLYGRSLAYNTSYFIEYHALDLI 215

Query: 182 INSEGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAG 241
           +N + C VGV+A  LE G IHRF  K  ++ TGGYGR YFSATSAHTCTGDG  M  RAG
Sbjct: 216 MNGDEC-VGVMALCLEDGSIHRFHCKQTIITTGGYGRCYFSATSAHTCTGDGTAMALRAG 274

Query: 242 LPLQDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVS 301
           +PL+D EFVQFHPTGIYG GCL+TEG RGEGG L NS+GERFMERYAP+AKDLA RDVVS
Sbjct: 275 IPLEDPEFVQFHPTGIYGVGCLMTEGCRGEGGVLRNSEGERFMERYAPTAKDLACRDVVS 334

Query: 302 RCMMMEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIP 361
           R M MEIREGRGVGK KDHI+L+L+HL   +L ERLPGISE+A IFAGVDVT++P+PV+P
Sbjct: 335 RAMTMEIREGRGVGKLKDHIYLHLDHLPADLLAERLPGISETAMIFAGVDVTKEPVPVLP 394

Query: 362 TVHYNMGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVF 421
           TVHYNMGG+PTNY G+VL    ++ E+  PGL   GEA C SVHGANRLG+NSL+D+VVF
Sbjct: 395 TVHYNMGGLPTNYHGQVLKPTEQDTEKVVPGLWCAGEAACTSVHGANRLGANSLLDIVVF 454

Query: 422 GRAAVIRASEMI---DKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQ 478
           GRA     +E+    +  +P+P+    +C   ++  DRLR+A G +PTA LR +MQR MQ
Sbjct: 455 GRACANYINEISKPGEAKTPLPADAGKAC---LENLDRLRYAKGAIPTAQLRLRMQRTMQ 511

Query: 479 LDAGVFRTQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVY 538
             A VFRT+++L +GC+ ++ +  E+ D+ + DRS+IWN+DL+ETLELQNL+  A  T+ 
Sbjct: 512 DYAAVFRTEETLQEGCKRMNEVVKEIRDVGITDRSMIWNTDLIETLELQNLLEQAHCTMI 571

Query: 539 SAEARKESRGSHAREDFKDGEFGGRDDVNWRKHSLCWVD---WNTGKIKLDYRPVHTELL 595
           +AEARKESRG+HARED+K+     RDDVNW KH++ + D   + TG  KL YRPVH   L
Sbjct: 572 AAEARKESRGAHAREDYKE-----RDDVNWLKHTVAYHDDALFGTGTTKLMYRPVHMNTL 626

Query: 596 CGGVDYSKIAPKARVY 611
               +   I PKARVY
Sbjct: 627 -DENEVKPIPPKARVY 641


>gi|300121433|emb|CBK21813.2| Succinate dehydrogenase flavoprotein subunit (SDHA) [Blastocystis
           hominis]
 gi|300121860|emb|CBK22434.2| Succinate dehydrogenase flavoprotein subunit (SDHA) [Blastocystis
           hominis]
 gi|300175554|emb|CBK20865.2| Succinate dehydrogenase flavoprotein subunit (SDHA) [Blastocystis
           hominis]
          Length = 634

 Score =  754 bits (1948), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/616 (62%), Positives = 468/616 (75%), Gaps = 16/616 (2%)

Query: 2   KNSSNLKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQG 61
           K + +L ++Y  VDH YD VVVGAGGAGLRA +G++E GFKTA ITK+FPTRSHTVAAQG
Sbjct: 29  KVTKDLGTAYPIVDHEYDCVVVGAGGAGLRAAMGLSEYGFKTAVITKLFPTRSHTVAAQG 88

Query: 62  GIAASLANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEA 121
           G+ A+L NM  D W+WH YDT+KGSDWLGD DAI Y+  EAP++V ELE YG+PFSR E 
Sbjct: 89  GVNAALGNMHEDDWRWHFYDTVKGSDWLGDQDAIHYMCREAPRAVRELEAYGLPFSRCEN 148

Query: 122 GKIYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLI 181
           GKIYQR FGG  +NYGEG    RT AAADRTGHA+LHTLYG++L  N  +FIEY ALDLI
Sbjct: 149 GKIYQRAFGGQTKNYGEGGQAYRTAAAADRTGHAMLHTLYGRSLAYNTSYFIEYHALDLI 208

Query: 182 INSEGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAG 241
           +N + C VGV+A  LE G IHRF  K  ++ TGGYGR YFSATSAHTCTGDG  M  RAG
Sbjct: 209 MNGDEC-VGVMALCLEDGSIHRFHCKQTIITTGGYGRCYFSATSAHTCTGDGTAMALRAG 267

Query: 242 LPLQDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVS 301
           +PL+D EFVQFHPTGIYG GCL+TEG RGEGG L NS+GERFMERYAP+AKDLA RDVVS
Sbjct: 268 IPLEDPEFVQFHPTGIYGVGCLMTEGCRGEGGVLRNSEGERFMERYAPTAKDLACRDVVS 327

Query: 302 RCMMMEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIP 361
           R M MEIREGRGVGK KDHI+L+L+HL   +L ERLPGISE+A IFAGVDVT++P+PV+P
Sbjct: 328 RAMTMEIREGRGVGKLKDHIYLHLDHLPADLLAERLPGISETAMIFAGVDVTKEPVPVLP 387

Query: 362 TVHYNMGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVF 421
           TVHYNMGG+PTNY G+VL    ++ E+  PGL   GEA C SVHGANRLG+NSL+D+VVF
Sbjct: 388 TVHYNMGGLPTNYHGQVLKPTEQDTEKVVPGLWCAGEAACTSVHGANRLGANSLLDIVVF 447

Query: 422 GRAAVIRASEMI---DKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQ 478
           GRA     +E+    +  +P+P+    +C   ++  DRLR+A G +PTA LR +MQR MQ
Sbjct: 448 GRACANYINEISKPGEAKTPLPADAGKAC---LENLDRLRYAKGAIPTAQLRLRMQRTMQ 504

Query: 479 LDAGVFRTQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVY 538
             A VFRT+++L +GC+ ++ +  E+ D+ + DRS+IWN+DL+ETLELQNL+  A  T+ 
Sbjct: 505 DYAAVFRTEETLQEGCKRMNEVVKEIRDVGITDRSMIWNTDLIETLELQNLLEQAHCTMI 564

Query: 539 SAEARKESRGSHAREDFKDGEFGGRDDVNWRKHSLCWVD---WNTGKIKLDYRPVHTELL 595
           +AEARKESRG+HARED+K+     RDDVNW KH++ + D   + TG  KL YRPVH   L
Sbjct: 565 AAEARKESRGAHAREDYKE-----RDDVNWLKHTVAYHDDALFGTGTTKLMYRPVHMNTL 619

Query: 596 CGGVDYSKIAPKARVY 611
               +   I PKARVY
Sbjct: 620 -DENEVKPIPPKARVY 634


>gi|146412948|ref|XP_001482445.1| hypothetical protein PGUG_05465 [Meyerozyma guilliermondii ATCC
           6260]
 gi|146393209|gb|EDK41367.1| hypothetical protein PGUG_05465 [Meyerozyma guilliermondii ATCC
           6260]
          Length = 641

 Score =  754 bits (1947), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/608 (62%), Positives = 460/608 (75%), Gaps = 7/608 (1%)

Query: 4   SSNLKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGI 63
           S  +   Y  +DH YD VVVGAGGAGLRA  G+AE GFKTACI+K+FPTRSHTVAAQGGI
Sbjct: 41  SKYMSQKYHVIDHEYDCVVVGAGGAGLRAAFGLAEAGFKTACISKLFPTRSHTVAAQGGI 100

Query: 64  AASLANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGK 123
            A+L NM  D W WH+YDT+KGSDWLGD DAI Y+  EAPQS+YELE+YGVPFSRNE G+
Sbjct: 101 NAALGNMHKDDWHWHMYDTVKGSDWLGDQDAIHYMTKEAPQSIYELENYGVPFSRNEEGR 160

Query: 124 IYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIIN 183
           IYQR FGG  + YG+G    RTCA ADRTGHA+LH+LYGQ+L+++  FFIE+FA+DL++ 
Sbjct: 161 IYQRAFGGQSKEYGKGGQAYRTCAVADRTGHALLHSLYGQSLRHDTHFFIEFFAMDLLMQ 220

Query: 184 SEGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLP 243
            +G CVGV+A+  E G +HRF A   V+ATGGYGRAYFS TSAHTCTGDG  MV+RAGLP
Sbjct: 221 -DGACVGVIAYNEEDGTLHRFRAHRTVIATGGYGRAYFSCTSAHTCTGDGYAMVSRAGLP 279

Query: 244 LQDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRC 303
           L+D+EFVQFHP+GIYG+GCLITEGARGEGG+LVNS+GERFMERYAPSAKDLASRDVVSR 
Sbjct: 280 LEDLEFVQFHPSGIYGSGCLITEGARGEGGFLVNSEGERFMERYAPSAKDLASRDVVSRA 339

Query: 304 MMMEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTV 363
           + MEI EGRGVG  KDH++L L+H+  AVL+ERLPGISE+A IFAGVDVT++PIP++PTV
Sbjct: 340 ITMEINEGRGVGPHKDHMYLQLSHIPAAVLKERLPGISETAHIFAGVDVTKEPIPILPTV 399

Query: 364 HYNMGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGR 423
           HYNMGGIPT + GEVL  N K  +   PGL+A GEA CASVHGANRLG+NSL+DLVVFGR
Sbjct: 400 HYNMGGIPTKWNGEVLKKNEKGEDEVVPGLLACGEAACASVHGANRLGANSLLDLVVFGR 459

Query: 424 AAVIRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGV 483
           A      + +  ++P   +        ++  DRLR+A+G   TA LR +MQ+ MQ    V
Sbjct: 460 AVSHTIRDNLTPNTPHKPMPQDLGVESIENLDRLRNANGTHSTADLRLEMQKTMQKGCAV 519

Query: 484 FRTQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEAR 543
           FRTQ++L +G  ++  +  +  D+K  DRS+IWNSDLVETLELQNL+  A  T  SA AR
Sbjct: 520 FRTQETLDEGVEHILKVDKKFHDVKTTDRSMIWNSDLVETLELQNLLTCATQTAVSAAAR 579

Query: 544 KESRGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSK 603
           KESRG+HAR+D+ +     RDD NWRKH+L +      ++KLDYR V    L    D   
Sbjct: 580 KESRGAHARDDYPE-----RDDENWRKHTLSYQTGFGEEVKLDYRDVIRTTLDEN-DCKP 633

Query: 604 IAPKARVY 611
           + P  RVY
Sbjct: 634 VPPAKRVY 641


>gi|294657378|ref|XP_002770447.1| DEHA2E08888p [Debaryomyces hansenii CBS767]
 gi|199432648|emb|CAR65790.1| DEHA2E08888p [Debaryomyces hansenii]
          Length = 627

 Score =  754 bits (1946), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/605 (61%), Positives = 451/605 (74%), Gaps = 7/605 (1%)

Query: 7   LKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAAS 66
           L   Y  +DH YD +VVGAGGAGLRA  G++E G+KTACI+K+FPTRSHTVAAQGGI A+
Sbjct: 30  LSKDYHVIDHQYDCLVVGAGGAGLRAAYGLSEAGYKTACISKLFPTRSHTVAAQGGINAA 89

Query: 67  LANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQ 126
           L NM  D W WH+YDT+KGSDWLGD DAI Y+  EAP S+YELE+YGVPFSRNE G+IYQ
Sbjct: 90  LGNMHKDDWHWHMYDTVKGSDWLGDQDAIHYMTKEAPASIYELENYGVPFSRNEEGRIYQ 149

Query: 127 RPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEG 186
           R FGG  + +G+G    RTCA ADRTGH++LHTLYGQ+L+N+  FFIE+FA+DL++  +G
Sbjct: 150 RAFGGQAKEFGKGGQAYRTCAVADRTGHSLLHTLYGQSLRNDTHFFIEFFAMDLMMQ-DG 208

Query: 187 CCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQD 246
            C+GV+A+  E G IHRF A   ++ATGGYGR YFS TSAHTCTGDG  MV+RAGLPL+D
Sbjct: 209 ECIGVIAYNQEDGTIHRFQAHKTIIATGGYGRTYFSCTSAHTCTGDGFAMVSRAGLPLED 268

Query: 247 MEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMM 306
           MEFVQFHP+GIYG+GCLITEGARGEGG+L+NS+GERFMERYAP AKDLASRDVVSR M +
Sbjct: 269 MEFVQFHPSGIYGSGCLITEGARGEGGFLLNSEGERFMERYAPHAKDLASRDVVSRAMTL 328

Query: 307 EIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYN 366
           EI EGRGVGK KDHI+L L+HL P+VL+ERLPGISE+A IFAGVDVT++PIP++PTVHYN
Sbjct: 329 EINEGRGVGKEKDHIYLQLSHLPPSVLKERLPGISETAHIFAGVDVTKEPIPILPTVHYN 388

Query: 367 MGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAV 426
           MGGIPTNY  EVL   +   +   PGL A GEA CASVHGANRLG+NSL+DLVVFGRA  
Sbjct: 389 MGGIPTNYKTEVLKKGADGKDEIVPGLFACGEAACASVHGANRLGANSLLDLVVFGRAVG 448

Query: 427 IRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRT 486
              SE +   +P   LD       ++    LR ADG   TA++R +MQ+ MQ    VFRT
Sbjct: 449 HTISEQLTPGTPFKPLDEHMGKESIENLHHLRTADGSQTTASIRAEMQKTMQKGCAVFRT 508

Query: 487 QDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKES 546
           QD L     ++  +      +K  DRS+IWNSDLVET+ELQNL+  A  T YSA ARKES
Sbjct: 509 QDLLDQCVEDIDKIDKTFEHVKTTDRSMIWNSDLVETMELQNLLTCATQTAYSAAARKES 568

Query: 547 RGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAP 606
           RG+HAR+D+ +     RDD NWRKH+L +      K++LDYR V    L    D   + P
Sbjct: 569 RGAHARDDYPN-----RDDENWRKHTLSYQKNFGDKVELDYRDVVRTTL-DESDCKPVPP 622

Query: 607 KARVY 611
             RVY
Sbjct: 623 AVRVY 627


>gi|148284921|ref|YP_001249011.1| succinate dehydrogenase flavoprotein subunit [Orientia
           tsutsugamushi str. Boryong]
 gi|146740360|emb|CAM80793.1| Succinate dehydrogenase flavoprotein subunit [Orientia
           tsutsugamushi str. Boryong]
          Length = 595

 Score =  754 bits (1946), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/608 (63%), Positives = 461/608 (75%), Gaps = 19/608 (3%)

Query: 9   SSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLA 68
            +Y  ++H +DVVVVGAGGAGLRA +GMAE G + ACITK+FPTRSHTVAAQGGI+A+L 
Sbjct: 2   KAYKIINHEFDVVVVGAGGAGLRAIVGMAEAGLRAACITKLFPTRSHTVAAQGGISAALG 61

Query: 69  NMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRP 128
           N+ PD WQWH YDTIKGSDWLGD DAI Y+  EAP ++ ELEHYGVPFSR   GKIYQR 
Sbjct: 62  NIQPDKWQWHAYDTIKGSDWLGDQDAIAYMCREAPAAIIELEHYGVPFSRTADGKIYQRH 121

Query: 129 FGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCC 188
           FGG    +G+G    RTCAAADRTGHA+LHTLY QALK+ A+FFIEY ALDLI+++ G C
Sbjct: 122 FGGMTTEFGDGAAAMRTCAAADRTGHAMLHTLYQQALKHKAKFFIEYIALDLIMDN-GAC 180

Query: 189 VGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDME 248
            G+VAW L+ G IH F + +VVLATGGYGRAYFSATSAH+CTGDG  M ARAG+ LQDME
Sbjct: 181 NGIVAWNLDDGTIHCFRSHIVVLATGGYGRAYFSATSAHSCTGDGNAMCARAGIALQDME 240

Query: 249 FVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEI 308
           FVQFHPTGIYGAGCLITEGARGEGGYLVNS+GERFMERYAPSAKDLASRDVV+R M MEI
Sbjct: 241 FVQFHPTGIYGAGCLITEGARGEGGYLVNSEGERFMERYAPSAKDLASRDVVARAMTMEI 300

Query: 309 REGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMG 368
             GRGVG  KDHI L+LNHLD   +Q+RLPGISE+A IFAGVDVT+ PIPVIPTVHYNMG
Sbjct: 301 NAGRGVGIYKDHIFLHLNHLDSKTIQQRLPGISETAMIFAGVDVTKQPIPVIPTVHYNMG 360

Query: 369 GIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIR 428
           GIPTNY G+V+           PGLMAIGEA C SVHGANRLGSNSL+DL++FGRAA  +
Sbjct: 361 GIPTNYHGQVVTKTENGDMEIVPGLMAIGEAACVSVHGANRLGSNSLLDLIIFGRAAANK 420

Query: 429 ASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQD 488
           A E+I  S+    L  +  D I++RFD+ R  +G++P A LR  MQRAMQ  AGVFR+ D
Sbjct: 421 AKEIITTSTKHQPLGNNIFDAIIERFDQTRFLNGNMPIAELRLTMQRAMQNYAGVFRSYD 480

Query: 489 SLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRG 548
            L++G + +   ++   D+K+ D SLIWN+DLVE +ELQNL+  A  T++ A  R+ESRG
Sbjct: 481 KLTEGMKIIKQNFNSRTDIKLTDHSLIWNTDLVEAIELQNLLYQAAITMFCAANRQESRG 540

Query: 549 SHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYR-----PVHTELLCGGVDYSK 603
           +HARED+ +     RDD NW KH+L  +D   G + +DYR     P + E++        
Sbjct: 541 AHAREDYPN-----RDDDNWLKHTLATID-EEGNVDIDYRDVVLDPKNDEMM-------S 587

Query: 604 IAPKARVY 611
           I PK RVY
Sbjct: 588 IVPKKRVY 595


>gi|195124377|ref|XP_002006670.1| GI18459 [Drosophila mojavensis]
 gi|193911738|gb|EDW10605.1| GI18459 [Drosophila mojavensis]
          Length = 666

 Score =  754 bits (1946), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/621 (59%), Positives = 447/621 (71%), Gaps = 15/621 (2%)

Query: 3   NSSNLKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGG 62
           N   +   Y  VDH YD +VVGAGG+GLRA  G+  +GF+TA ITK+FPTRSHT+AAQGG
Sbjct: 49  NPDAISKQYPIVDHEYDAIVVGAGGSGLRAAFGLVAEGFRTAVITKLFPTRSHTIAAQGG 108

Query: 63  IAASLANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAG 122
           I A+L NM  D W+WH+YDT+KGSDWLGD DAI Y+  EAP++V ELE+YG+PFSR + G
Sbjct: 109 INAALGNMEEDDWKWHMYDTVKGSDWLGDQDAIHYMTREAPKAVIELENYGMPFSRTQDG 168

Query: 123 KIYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLII 182
           KIYQR FGG    +G+G    R CA ADRTGH++LHTLYGQ+L  +  +F+EYFALDLI 
Sbjct: 169 KIYQRAFGGQSLKFGKGGQAHRCCAVADRTGHSLLHTLYGQSLSYDCNYFVEYFALDLIF 228

Query: 183 NSEGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGL 242
            ++ C  GV+A  LE G +HRF AK  V+ATGGYGRA+FS TSAHTCTGDG  +VAR GL
Sbjct: 229 ENDEC-RGVLALNLEDGSLHRFRAKNTVIATGGYGRAFFSCTSAHTCTGDGTALVARQGL 287

Query: 243 PLQDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSR 302
           P +D+EFVQFHPTGIYGAGCLITEG RGEGGYL+NSKGERFMERYAP AKDLASRDVVSR
Sbjct: 288 PSEDLEFVQFHPTGIYGAGCLITEGCRGEGGYLINSKGERFMERYAPVAKDLASRDVVSR 347

Query: 303 CMMMEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPT 362
            + +E+ EGRGVG  KDH+ L L+HL P  L ERLPGISE+A IFAGVDVTR+PIPV+PT
Sbjct: 348 SITIEVMEGRGVGPEKDHVFLQLHHLPPKQLAERLPGISETAMIFAGVDVTREPIPVLPT 407

Query: 363 VHYNMGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFG 422
           VHYNMGGIPTNY G+VL  +    ++   GL A GEA C+SVHGANRLG+NSL+DLVVFG
Sbjct: 408 VHYNMGGIPTNYRGQVLTIDENGKDKIVRGLYAAGEAACSSVHGANRLGANSLLDLVVFG 467

Query: 423 RAAVIRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAG 482
           RA     +E        P L  ++ +  +   D+LRHA+G + TA LR KMQR MQ  A 
Sbjct: 468 RACAKTIAEENKPGEKAPELKDNAGEFSVANLDKLRHANGSITTADLRLKMQRCMQNHAA 527

Query: 483 VFRTQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEA 542
           VFR    L  G   +  ++ +  D+KV D+SL+WNSDL+ETLELQNL+ NA  T+  AEA
Sbjct: 528 VFRDGPILQKGVSEMKEIYKQFKDIKVIDKSLVWNSDLIETLELQNLLANAQMTIVGAEA 587

Query: 543 RKESRGSHAREDFKD------------GEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPV 590
           RKESRG+HAREDFKD             +     D +WRKH+L WV  + G ++L YRPV
Sbjct: 588 RKESRGAHAREDFKDRIDEYDYSKPLESQQKKPIDQHWRKHTLAWVCSDDGDVELKYRPV 647

Query: 591 HTELLCGGVDYSKIAPKARVY 611
             + L   V+   + P  R Y
Sbjct: 648 IDQTLDNEVE--TVPPAIRSY 666


>gi|164656601|ref|XP_001729428.1| hypothetical protein MGL_3463 [Malassezia globosa CBS 7966]
 gi|159103319|gb|EDP42214.1| hypothetical protein MGL_3463 [Malassezia globosa CBS 7966]
          Length = 657

 Score =  753 bits (1945), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/606 (62%), Positives = 453/606 (74%), Gaps = 7/606 (1%)

Query: 6   NLKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAA 65
           +L   Y  ++H YD +VVGAGGAGLRA  G+AE G  TACITK+FPTRSHTVAAQGGI A
Sbjct: 59  DLTKGYPVIEHEYDAIVVGAGGAGLRAAFGLAEGGLNTACITKLFPTRSHTVAAQGGINA 118

Query: 66  SLANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIY 125
           +L NMT D W+WH+YDT+KGSDWLGD DAI Y+  EAP +V ELEHYG+PFSR + GKIY
Sbjct: 119 ALGNMTEDDWRWHMYDTVKGSDWLGDQDAIHYMCREAPNTVLELEHYGLPFSRTKEGKIY 178

Query: 126 QRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSE 185
           QR FGG   +YG+G    R  AAADRTGHA+LHTLYGQ+L++N  +FIEYFA DLI+  +
Sbjct: 179 QRAFGGQSLHYGKGGQAYRCAAAADRTGHAMLHTLYGQSLRHNTTYFIEYFAQDLIME-D 237

Query: 186 GCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQ 245
           G CVGV+A  LE G IHRF A   VLATGGYG+AYFSATSAHTCTGDG  MV+RAGLPLQ
Sbjct: 238 GECVGVMALNLEDGTIHRFRAHRTVLATGGYGKAYFSATSAHTCTGDGLAMVSRAGLPLQ 297

Query: 246 DMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMM 305
           D+EFVQFHPTGIYGAGCLITEG+RGEGGYL+NS+GERFMERYAP+AKDLASRDVVSR M 
Sbjct: 298 DLEFVQFHPTGIYGAGCLITEGSRGEGGYLLNSEGERFMERYAPTAKDLASRDVVSRSMT 357

Query: 306 MEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHY 365
           MEIR+GRGVG  KDHI+L L+HL  +VL ERLPGISE+A IFAGVDVT++PIPV+PTVHY
Sbjct: 358 MEIRDGRGVGPMKDHIYLQLSHLPASVLHERLPGISETASIFAGVDVTKEPIPVLPTVHY 417

Query: 366 NMGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAA 425
            MGGIPT Y GEVL  +    ++  PGL A GE  C SVHGANRLG+NSL+D+VVFGRA 
Sbjct: 418 TMGGIPTRYTGEVLTQDENGNDKVVPGLYAAGETACVSVHGANRLGANSLLDIVVFGRAC 477

Query: 426 VIRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFR 485
                E ++   P   L   +  + ++  D +R ADG   TA +R +MQR MQ DA VFR
Sbjct: 478 ASHIRENLEPGKPHKELKGDNGQQAINDLDAIRTADGPRTTADIRLEMQRVMQSDAAVFR 537

Query: 486 TQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKE 545
           TQ +L +G   +  +  E   + V DR +IWN+DL ETLEL+NL+ +A  T++SAEARKE
Sbjct: 538 TQKTLEEGVEKIDKVVSEFPKVAVKDRGMIWNTDLTETLELRNLLSSAAQTMHSAEARKE 597

Query: 546 SRGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIA 605
           SRG+HAREDF +     RDD NW +H+L W D  +GK+ L YR V ++ L    +   + 
Sbjct: 598 SRGAHAREDFTE-----RDDENWMRHTLSWFDEESGKVSLKYRNVISDTL-DESECKSVP 651

Query: 606 PKARVY 611
           P  R Y
Sbjct: 652 PFKRTY 657


>gi|6322416|ref|NP_012490.1| hypothetical protein YJL045W [Saccharomyces cerevisiae S288c]
 gi|1352266|sp|P47052|DHSX_YEAST RecName: Full=Succinate dehydrogenase [ubiquinone] flavoprotein
           subunit 2, mitochondrial; AltName: Full=Flavoprotein
           subunit of complex II; Short=FP; AltName: Full=SDH1b;
           Flags: Precursor
 gi|1008175|emb|CAA89336.1| unnamed protein product [Saccharomyces cerevisiae]
 gi|190409455|gb|EDV12720.1| succinate dehydrogenase flavoprotein subunit, mitochondrial
           precursor [Saccharomyces cerevisiae RM11-1a]
 gi|285812857|tpg|DAA08755.1| TPA: hypothetical protein YJL045W [Saccharomyces cerevisiae S288c]
 gi|323337089|gb|EGA78345.1| YJL045W-like protein [Saccharomyces cerevisiae Vin13]
          Length = 634

 Score =  752 bits (1941), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/607 (61%), Positives = 459/607 (75%), Gaps = 11/607 (1%)

Query: 1   MKNSSNLKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQ 60
           +K+ S   + Y  +DH YD VVVGAGGAGLRA  G+AE G+KTAC++K+FPTRSHTVAAQ
Sbjct: 30  VKSESKPPAKYHIIDHEYDCVVVGAGGAGLRAAFGLAEAGYKTACLSKLFPTRSHTVAAQ 89

Query: 61  GGIAASLANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNE 120
           GGI A+L NM PD W+ H+YDT+KGSDWLGD DAI Y+  EAP+SV ELEHYG+PFSR E
Sbjct: 90  GGINAALGNMHPDDWKSHMYDTVKGSDWLGDQDAIHYMTREAPKSVIELEHYGMPFSRTE 149

Query: 121 AGKIYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDL 180
            G+IYQR FGG  +++G+G    RTCA ADRTGHA+LHTLYGQALKNN  FFIEYFA+DL
Sbjct: 150 DGRIYQRAFGGQSKDFGKGGQAYRTCAVADRTGHAMLHTLYGQALKNNTHFFIEYFAMDL 209

Query: 181 IINSEGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARA 240
           + ++ G  VGV+A+  E G IHRF A   V+ATGGYGRAYFS TSAHTCTGDG  MV+RA
Sbjct: 210 LTHN-GEVVGVIAYNQEDGTIHRFRAHKTVIATGGYGRAYFSCTSAHTCTGDGNAMVSRA 268

Query: 241 GLPLQDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVV 300
           G PL+D+EFVQFHP+GIYG+GCLITEGARGEGG+L+NS+GERFMERYAP+AKDLASRDVV
Sbjct: 269 GFPLEDLEFVQFHPSGIYGSGCLITEGARGEGGFLLNSEGERFMERYAPTAKDLASRDVV 328

Query: 301 SRCMMMEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVI 360
           SR + MEIR GRGVGK+KDHI L L+HL P VL+ERLPGISE+A +FAGVDVT++PIPV+
Sbjct: 329 SRAITMEIRAGRGVGKNKDHILLQLSHLPPEVLKERLPGISETAAVFAGVDVTQEPIPVL 388

Query: 361 PTVHYNMGGIPTNYWGEVLDANSKNPE-RFAPGLMAIGEAGCASVHGANRLGSNSLIDLV 419
           PTVHYNMGGIPT + GE L  + +  E +  PGLMA GEA C SVHGANRLG+NSL+DLV
Sbjct: 389 PTVHYNMGGIPTKWTGEALTIDEETGEDKVIPGLMACGEAACVSVHGANRLGANSLLDLV 448

Query: 420 VFGRAAVIRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQL 479
           VFGRA     ++ +    P   L  +     +   D++R+A G + T+ +R  MQR MQ 
Sbjct: 449 VFGRAVANTIADTLQPGLPHKPLASNIGHESIANLDKVRNARGSLKTSQIRLNMQRTMQK 508

Query: 480 DAGVFRTQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYS 539
           D  VFRTQD+L +G RN++ +     D+ V D+S+IWNSDLVETLELQNL+  A  T  S
Sbjct: 509 DVSVFRTQDTLDEGVRNITEVDKTFEDVHVSDKSMIWNSDLVETLELQNLLTCATQTAVS 568

Query: 540 AEARKESRGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGV 599
           A  RKESRG+HARED     +  RDDVNWRKH+L W    +  +K+ YR V    +   +
Sbjct: 569 ASKRKESRGAHARED-----YAKRDDVNWRKHTLSWQKGTSTPVKIKYRNV----IAHTL 619

Query: 600 DYSKIAP 606
           D ++ AP
Sbjct: 620 DENECAP 626


>gi|254580251|ref|XP_002496111.1| ZYRO0C10736p [Zygosaccharomyces rouxii]
 gi|238939002|emb|CAR27178.1| ZYRO0C10736p [Zygosaccharomyces rouxii]
          Length = 644

 Score =  751 bits (1940), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/602 (62%), Positives = 454/602 (75%), Gaps = 8/602 (1%)

Query: 11  YTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLANM 70
           Y  VDH YD +VVGAGGAGLRA  G+AE G+KTACI+K+FPTRSHTVAAQGGI A+L NM
Sbjct: 50  YHIVDHEYDCLVVGAGGAGLRAAFGLAEAGYKTACISKLFPTRSHTVAAQGGINAALGNM 109

Query: 71  TPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRPFG 130
            PD W+WH+YDT+KGSDWLGD D+I Y+  EAP+S+ ELEHYGVPFSR E+G+IYQR FG
Sbjct: 110 HPDDWKWHMYDTVKGSDWLGDQDSIHYMTREAPKSIIELEHYGVPFSRTESGRIYQRAFG 169

Query: 131 GHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCCVG 190
           G  ++ G+G    RTCA ADRTGHA+LHTLYGQAL++N  FFIEYFALDL+ ++ G  VG
Sbjct: 170 GQSRDRGKGGQAYRTCAVADRTGHALLHTLYGQALRHNTHFFIEYFALDLLTHN-GEVVG 228

Query: 191 VVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDMEFV 250
            +A+  E G IHR  A   ++ATGGYGR YFS TSAHTCTGDG  MVARAG PLQD+EFV
Sbjct: 229 AMAYNQEDGTIHRMRAHKTIIATGGYGRTYFSCTSAHTCTGDGNAMVARAGFPLQDLEFV 288

Query: 251 QFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEIRE 310
           QFHP+GIYG+GCLITEGARGEGG+L+NS+GERFMERYAP+AKDLASRDVVSR + MEIRE
Sbjct: 289 QFHPSGIYGSGCLITEGARGEGGFLLNSEGERFMERYAPTAKDLASRDVVSRSITMEIRE 348

Query: 311 GRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMGGI 370
           GRGVGK KDHI+L L+HL P+VLQERLPGISE+A IF+GVDVT+ PIPV+PTVHYNMGGI
Sbjct: 349 GRGVGKEKDHIYLQLSHLPPSVLQERLPGISETAAIFSGVDVTKQPIPVLPTVHYNMGGI 408

Query: 371 PTNYWGEVLDANSKNPE-RFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIRA 429
           PT + G  L  + +  E +  PGLMA GEA C SVHGANRLG+NSL+DLVVFGRA     
Sbjct: 409 PTKWNGNALTIDPETGEDKEIPGLMACGEAACVSVHGANRLGANSLLDLVVFGRAVAHTV 468

Query: 430 SEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQDS 489
           S+ +    P   L        +   D++R+A G  PTA +R  MQ+AMQ D  VFRTQ++
Sbjct: 469 SDELQPGLPHKPLPTDLGRESIANLDKIRNATGSRPTADIRLAMQKAMQKDVSVFRTQET 528

Query: 490 LSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRGS 549
           L +G +N+  +   + D++  DRS+IWN+D+VETLELQNL+ NA  T  SA  RKESRG+
Sbjct: 529 LDEGVKNVLAIDKTLEDVRTTDRSMIWNTDMVETLELQNLLTNATQTASSAANRKESRGA 588

Query: 550 HAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPKAR 609
           HARED+ D     RDD NW KH+L W   +   +K+ YR V ++ L    + S + P  R
Sbjct: 589 HAREDYPD-----RDDANWMKHTLSWQTKSGDDVKIKYRNVASQTL-DESEVSSVPPAIR 642

Query: 610 VY 611
            Y
Sbjct: 643 SY 644


>gi|115647100|ref|XP_801853.2| PREDICTED: similar to flavoprotein subunit of complex II isoform 3,
           partial [Strongylocentrotus purpuratus]
 gi|115924280|ref|XP_001191729.1| PREDICTED: similar to flavoprotein subunit of complex II, partial
           [Strongylocentrotus purpuratus]
          Length = 708

 Score =  751 bits (1940), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/620 (60%), Positives = 470/620 (75%), Gaps = 14/620 (2%)

Query: 4   SSNLKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGI 63
           +S +   Y  VDH++D VVVGAGGAGLRA  G+A +GFKTACITK+FPTRSHTVAAQGGI
Sbjct: 91  TSQVSRDYPVVDHTFDAVVVGAGGAGLRAAFGLAHEGFKTACITKLFPTRSHTVAAQGGI 150

Query: 64  AASLANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGK 123
            A+L NM PD+W+WH+YDT+KGSDWLGD DAI Y+  EAP++V ELE+YG+PFSR E GK
Sbjct: 151 NAALGNMEPDNWRWHMYDTVKGSDWLGDQDAIHYMTEEAPKAVIELENYGMPFSRTEEGK 210

Query: 124 IYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIIN 183
           IYQR FGG   +YG+G    R CA ADRTGH++LHTLYGQ+L+ +  +FIEYFALDLI+ 
Sbjct: 211 IYQRAFGGQSYDYGKGGQAHRCCAVADRTGHSLLHTLYGQSLRYDTSYFIEYFALDLIM- 269

Query: 184 SEGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLP 243
            +G C GVVA  +E G IHR  AK  VLATGGYGRAYFS TSAH+CTGDG  M+ RAGL 
Sbjct: 270 EDGECRGVVALCMEDGSIHRIRAKNTVLATGGYGRAYFSCTSAHSCTGDGTAMLTRAGLA 329

Query: 244 LQDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRC 303
            +DMEFVQFHPTGIYGAGCLITEG RGEGGYL+NS+GERFMERYAP+AKDLASRDVVSR 
Sbjct: 330 NEDMEFVQFHPTGIYGAGCLITEGCRGEGGYLLNSEGERFMERYAPTAKDLASRDVVSRS 389

Query: 304 MMMEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTV 363
           M +EIREGRG G  KDH++L L+HL P  L  RLPGISE+A+IFAGVDVTRDP+PV+PTV
Sbjct: 390 MTIEIREGRGCGPDKDHVYLQLSHLPPEQLAMRLPGISETAQIFAGVDVTRDPVPVLPTV 449

Query: 364 HYNMGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGR 423
           HYNMGG+PTNY G+V+  + +N +   PGL + GEA CASVHGANRLG+NSL+DLVVFGR
Sbjct: 450 HYNMGGVPTNYKGQVIQYSDENGDTIVPGLYSCGEAACASVHGANRLGANSLLDLVVFGR 509

Query: 424 AAVIRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGV 483
           A     +E       IP +  ++ +  +   D+LR+ADG +  A LR KMQR MQ +A V
Sbjct: 510 ACAHTITEENRPGEKIPDIKANAGEVSVANLDKLRYADGDIKAADLRLKMQRTMQNNAAV 569

Query: 484 FRTQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEAR 543
           FRT ++LS+G   +  ++  + ++K+ DR ++WN+DLVE LELQNL++N++ T++SAEAR
Sbjct: 570 FRTGETLSEGIDLIDDVYKNLDNIKLFDRGIVWNTDLVEALELQNLLLNSVQTMHSAEAR 629

Query: 544 KESRGSHAREDFKD------------GEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVH 591
           KESRG+HAREDFKD            G+     + +WRKH++  +D +TG++KL+YRPV 
Sbjct: 630 KESRGAHAREDFKDRIDEYDFKKPLEGQEKKPVEEHWRKHTMSHMDEHTGEVKLEYRPVI 689

Query: 592 TELLCGGVDYSKIAPKARVY 611
            E L    D + + P  R Y
Sbjct: 690 DETL-DQQDCATVPPAVRSY 708


>gi|320590094|gb|EFX02539.1| succinate flavoprotein subunit [Grosmannia clavigera kw1407]
          Length = 1624

 Score =  751 bits (1939), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/611 (60%), Positives = 446/611 (72%), Gaps = 13/611 (2%)

Query: 4    SSNLKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGI 63
            S  L + Y  +DH YD +VVGAGG+GLRA  G+AE GF TACI+K+FPTRSHTVAAQGGI
Sbjct: 1024 SPFLSNKYPVIDHEYDALVVGAGGSGLRAAFGLAEAGFNTACISKLFPTRSHTVAAQGGI 1083

Query: 64   AASLANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGK 123
             A+L NM  D W+WH+YDT+KGSDWLGD DAI Y+  EAP S+ ELE+YG PFSR + GK
Sbjct: 1084 NAALGNMHEDDWRWHMYDTVKGSDWLGDQDAIHYMTREAPASIIELENYGCPFSRTDEGK 1143

Query: 124  IYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIIN 183
            IYQR FGG  +N+G+G    R CAAADRTGHA+LHTLYGQ+L +N  FFIE+FA+DLI+ 
Sbjct: 1144 IYQRAFGGQSRNFGKGGQAYRCCAAADRTGHALLHTLYGQSLAHNTNFFIEFFAIDLIME 1203

Query: 184  SEGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLP 243
             +G C GV+A+  E G +HRF A   VLATGGYGRAYFS TSAHTCTGDG  MVARAGLP
Sbjct: 1204 -DGECRGVLAYNQEDGTLHRFLANSTVLATGGYGRAYFSCTSAHTCTGDGMAMVARAGLP 1262

Query: 244  LQDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRC 303
             QD+EFVQFHPTGIYGAGCLITEGARGEGGYL+NS+G+RFMERYAP  KDLAS DVVSR 
Sbjct: 1263 NQDLEFVQFHPTGIYGAGCLITEGARGEGGYLLNSEGKRFMERYAPRPKDLASGDVVSRS 1322

Query: 304  MMMEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTV 363
            + +EIREGRGVG  KDH++L L+HL   VL ERLPGISE+A IF+GVDV + PIP++PTV
Sbjct: 1323 ITVEIREGRGVGPEKDHMYLQLSHLPAEVLAERLPGISETASIFSGVDVRKQPIPILPTV 1382

Query: 364  HYNMGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGR 423
            HYNMGGIPTNY G+VL  +    ++   GL A GEA C SVHGANRLG+NSL+DLVVFGR
Sbjct: 1383 HYNMGGIPTNYTGQVLTVDEAGKDKPVQGLFACGEAACVSVHGANRLGANSLLDLVVFGR 1442

Query: 424  AAVIRASEMIDKSSPIPSLDISSCD---RIMDRFDRLRHADGHVPTAALREKMQRAMQLD 480
            A    +  + D+S+P   L     D     ++  D LR+ADG   TA +R  MQ+ MQ D
Sbjct: 1443 AV---SHTIRDQSTPGQKLKPLRADAGADAIEVLDELRNADGPKSTAEIRLAMQKTMQKD 1499

Query: 481  AGVFRTQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSA 540
              VFR QDSL +G  N+S +     D+ + DRS+IWNSDLVETLEL+NL+  A+ T  SA
Sbjct: 1500 VSVFRQQDSLDEGVVNISKVDQTFKDVGIKDRSMIWNSDLVETLELRNLLTCAVQTAVSA 1559

Query: 541  EARKESRGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVD 600
              RKESRG+HARED+ D     RDD NW KH+L +     G + L YR V +  L    +
Sbjct: 1560 SNRKESRGAHAREDYPD-----RDDKNWMKHTLSFQKKPHGPVDLKYRAVISTTLDEN-E 1613

Query: 601  YSKIAPKARVY 611
               + P  RVY
Sbjct: 1614 CKPVPPFKRVY 1624


>gi|151945041|gb|EDN63292.1| conserved protein [Saccharomyces cerevisiae YJM789]
          Length = 632

 Score =  751 bits (1939), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/603 (62%), Positives = 457/603 (75%), Gaps = 11/603 (1%)

Query: 5   SNLKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIA 64
           S   + Y  +DH YD VVVGAGGAGLRA  G+AE G+KTAC++K+FPTRSHTVAAQGGI 
Sbjct: 32  SESPAKYHIIDHEYDCVVVGAGGAGLRAAFGLAEAGYKTACLSKLFPTRSHTVAAQGGIN 91

Query: 65  ASLANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKI 124
           A+L NM PD W+ H+YDT+KGSDWLGD DAI Y+  EAP+SV ELEHYG+PFSR E G+I
Sbjct: 92  AALGNMHPDDWKSHMYDTVKGSDWLGDQDAIHYMTREAPKSVIELEHYGMPFSRTEDGRI 151

Query: 125 YQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINS 184
           YQR FGG  +++G+G    RTCA ADRTGHA+LHTLYGQALKNN  FFIEYFA+DL+ ++
Sbjct: 152 YQRAFGGQSKDFGKGGQAYRTCAVADRTGHAMLHTLYGQALKNNTHFFIEYFAMDLLTHN 211

Query: 185 EGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPL 244
            G  VGV+A+  E G IHRF A   V+ATGGYGRAYFS TSAHTCTGDG  MV+RAG PL
Sbjct: 212 -GEVVGVIAYNQEDGTIHRFRAHKTVIATGGYGRAYFSCTSAHTCTGDGNAMVSRAGFPL 270

Query: 245 QDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCM 304
           +D+EFVQFHP+GIYG+GCLITEGARGEGG+L+NS+GERFMERYAP+AKDLASRDVVSR +
Sbjct: 271 EDLEFVQFHPSGIYGSGCLITEGARGEGGFLLNSEGERFMERYAPTAKDLASRDVVSRAI 330

Query: 305 MMEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVH 364
            MEIR GRGVGK+KDHI L L+HL P VL+ERLPGISE+A +FAGVDVT++PIPV+PTVH
Sbjct: 331 TMEIRAGRGVGKNKDHILLQLSHLPPEVLKERLPGISETAAVFAGVDVTQEPIPVLPTVH 390

Query: 365 YNMGGIPTNYWGEVLDANSKNPE-RFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGR 423
           YNMGGIPT + GE L  + +  E +  PGLMA GEA C SVHGANRLG+NSL+DLVVFGR
Sbjct: 391 YNMGGIPTKWTGEALTIDEETGEDKVIPGLMACGEAACVSVHGANRLGANSLLDLVVFGR 450

Query: 424 AAVIRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGV 483
           A     ++ +    P   L  +     +   D++R+A G + T+ +R  MQR MQ D  V
Sbjct: 451 AVANTIADTLQPGLPHKPLASNIGHESIANLDKVRNARGSLKTSQIRLNMQRTMQKDVSV 510

Query: 484 FRTQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEAR 543
           FRTQD+L +G RN++ + +   D+ V D+S+IWNSDLVETLELQNL+  A  T  SA  R
Sbjct: 511 FRTQDTLDEGVRNITEVDETFEDVHVSDKSMIWNSDLVETLELQNLLTCATQTAVSASKR 570

Query: 544 KESRGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSK 603
           KESRG+HARED     +  RDDVNWRKH+L W    +  +K+ YR V    +   +D ++
Sbjct: 571 KESRGAHARED-----YAKRDDVNWRKHTLSWQKGTSTPVKIKYRNV----IAHTLDENE 621

Query: 604 IAP 606
            AP
Sbjct: 622 CAP 624


>gi|323354461|gb|EGA86300.1| YJL045W-like protein [Saccharomyces cerevisiae VL3]
          Length = 634

 Score =  750 bits (1936), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/607 (61%), Positives = 458/607 (75%), Gaps = 11/607 (1%)

Query: 1   MKNSSNLKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQ 60
           +K+ S   + Y  +DH YD VVVGAGGAGLRA  G+AE G+KTAC++K+FPTRSHTVAAQ
Sbjct: 30  VKSESKPPAKYHIIDHEYDCVVVGAGGAGLRAAFGLAEAGYKTACLSKLFPTRSHTVAAQ 89

Query: 61  GGIAASLANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNE 120
           GGI A+L NM PD W+ H+YDT+KGSDWLGD DAI Y+  EAP+SV ELEHYG+PFSR E
Sbjct: 90  GGINAALGNMHPDDWKSHMYDTVKGSDWLGDQDAIHYMTREAPKSVIELEHYGMPFSRTE 149

Query: 121 AGKIYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDL 180
            G+IYQR FGG  +++G+G    RTCA ADRTGHA+LHTLYGQAL NN  FFIEYFA+DL
Sbjct: 150 DGRIYQRAFGGQSKDFGKGGQAYRTCAVADRTGHAMLHTLYGQALXNNTHFFIEYFAMDL 209

Query: 181 IINSEGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARA 240
           + ++ G  VGV+A+  E G IHRF A   V+ATGGYGRAYFS TSAHTCTGDG  MV+RA
Sbjct: 210 LTHN-GEVVGVIAYNQEDGTIHRFRAHKTVIATGGYGRAYFSCTSAHTCTGDGNAMVSRA 268

Query: 241 GLPLQDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVV 300
           G PL+D+EFVQFHP+GIYG+GCLITEGARGEGG+L+NS+GERFMERYAP+AKDLASRDVV
Sbjct: 269 GFPLEDLEFVQFHPSGIYGSGCLITEGARGEGGFLLNSEGERFMERYAPTAKDLASRDVV 328

Query: 301 SRCMMMEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVI 360
           SR + MEIR GRGVGK+KDHI L L+HL P VL+ERLPGISE+A +FAGVDVT++PIPV+
Sbjct: 329 SRAITMEIRAGRGVGKNKDHILLQLSHLPPEVLKERLPGISETAAVFAGVDVTQEPIPVL 388

Query: 361 PTVHYNMGGIPTNYWGEVLDANSKNPE-RFAPGLMAIGEAGCASVHGANRLGSNSLIDLV 419
           PTVHYNMGGIPT + GE L  + +  E +  PGLMA GEA C SVHGANRLG+NSL+DLV
Sbjct: 389 PTVHYNMGGIPTKWTGEALTIDEETGEDKVIPGLMACGEAACVSVHGANRLGANSLLDLV 448

Query: 420 VFGRAAVIRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQL 479
           VFGRA     ++ +    P   L  +     +   D++R+A G + T+ +R  MQR MQ 
Sbjct: 449 VFGRAVANTIADTLQPGLPHKPLASNIGHESIANLDKVRNARGSLKTSQIRLNMQRTMQK 508

Query: 480 DAGVFRTQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYS 539
           D  VFRTQD+L +G RN++ +     D+ V D+S+IWNSDLVETLELQNL+  A  T  S
Sbjct: 509 DVSVFRTQDTLDEGVRNITEVDKTFEDVHVSDKSMIWNSDLVETLELQNLLTCATQTAVS 568

Query: 540 AEARKESRGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGV 599
           A  RKESRG+HARED     +  RDDVNWRKH+L W    +  +K+ YR V    +   +
Sbjct: 569 ASKRKESRGAHARED-----YAKRDDVNWRKHTLSWQKGTSTPVKIKYRNV----IAHTL 619

Query: 600 DYSKIAP 606
           D ++ AP
Sbjct: 620 DENECAP 626


>gi|256271057|gb|EEU06158.1| YJL045W-like protein [Saccharomyces cerevisiae JAY291]
          Length = 632

 Score =  749 bits (1935), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/603 (62%), Positives = 456/603 (75%), Gaps = 11/603 (1%)

Query: 5   SNLKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIA 64
           S   + Y  +DH YD VVVGAGGAGLRA  G+AE G+KTAC++K+FPTRSHTVAAQGGI 
Sbjct: 32  SESPAKYHIIDHEYDCVVVGAGGAGLRAAFGLAEAGYKTACLSKLFPTRSHTVAAQGGIN 91

Query: 65  ASLANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKI 124
           A+L NM PD W+ H+YDT+KGSDWLGD DAI Y+  EAP+SV ELEHYG+PFSR E G+I
Sbjct: 92  AALGNMHPDDWKSHMYDTVKGSDWLGDQDAIHYMTREAPKSVIELEHYGMPFSRTEDGRI 151

Query: 125 YQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINS 184
           YQR FGG  +++G+G    RTCA ADRTGHA+LHTLYGQALKNN  FFIEYFA+DL+ ++
Sbjct: 152 YQRAFGGQSKDFGKGGQAYRTCAVADRTGHAMLHTLYGQALKNNTHFFIEYFAMDLLTHN 211

Query: 185 EGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPL 244
            G  VGV+A+  E G IHRF A   V+ATGGYGRAYFS TSAHTCTGDG  MV+RAG PL
Sbjct: 212 -GEVVGVIAYNQEDGTIHRFRAHKTVIATGGYGRAYFSCTSAHTCTGDGNAMVSRAGFPL 270

Query: 245 QDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCM 304
           +D+EFVQFHP+GIYG+GCLITEGARGEGG+L+NS+GERFMERYAP+AKDLASRDVVSR +
Sbjct: 271 EDLEFVQFHPSGIYGSGCLITEGARGEGGFLLNSEGERFMERYAPTAKDLASRDVVSRAI 330

Query: 305 MMEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVH 364
            MEIR GRGVGK+KDHI L L+HL P VL+ERLPGISE+A +FAGVDVT++PIPV+PTVH
Sbjct: 331 TMEIRAGRGVGKNKDHILLQLSHLPPEVLKERLPGISETAAVFAGVDVTQEPIPVLPTVH 390

Query: 365 YNMGGIPTNYWGEVLDANSKNPE-RFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGR 423
           YNMGGIPT + GE L  + +  E +  PGLMA GEA C SVHGANRLG+NSL+DLVVFGR
Sbjct: 391 YNMGGIPTKWTGEALTIDEETGEDKVIPGLMACGEAACVSVHGANRLGANSLLDLVVFGR 450

Query: 424 AAVIRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGV 483
           A     ++ +    P   L  +     +   D++R+A G + T+ +R  MQR MQ D  V
Sbjct: 451 AVANTIADTLQPGLPHKPLASNIGHESIANLDKVRNARGSLKTSQIRLNMQRTMQKDVSV 510

Query: 484 FRTQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEAR 543
           FRTQD+L +G RN++ +     D+ V D+S+IWNSDLVETLELQNL+  A  T  SA  R
Sbjct: 511 FRTQDTLDEGVRNITEVDKTFEDVHVSDKSMIWNSDLVETLELQNLLTCATQTAVSASKR 570

Query: 544 KESRGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSK 603
           KESRG+HARED     +  RDDVNWRKH+L W    +  +K+ YR V    +   +D ++
Sbjct: 571 KESRGAHARED-----YAKRDDVNWRKHTLSWQKGTSTPVKIKYRNV----IAHTLDENE 621

Query: 604 IAP 606
            AP
Sbjct: 622 CAP 624


>gi|323308414|gb|EGA61659.1| YJL045W-like protein [Saccharomyces cerevisiae FostersO]
          Length = 634

 Score =  749 bits (1933), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/607 (61%), Positives = 458/607 (75%), Gaps = 11/607 (1%)

Query: 1   MKNSSNLKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQ 60
           +K+ S   + Y  +DH YD VVVGAGGAGLRA  G+AE G+KTAC++K+FPTRSHTVAAQ
Sbjct: 30  VKSESKXPAKYHIIDHEYDCVVVGAGGAGLRAAFGLAEAGYKTACLSKLFPTRSHTVAAQ 89

Query: 61  GGIAASLANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNE 120
           GGI A+L NM PD W+ H+YDT+KGSDWLGD DAI Y+  EAP+SV ELEHYG+PFSR E
Sbjct: 90  GGINAALGNMHPDDWKSHMYDTVKGSDWLGDQDAIHYMTREAPKSVIELEHYGMPFSRTE 149

Query: 121 AGKIYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDL 180
            G+IYQR FGG  +++G+G    RTCA ADRTGHA+LHTLYGQALKNN  FFIEYFA+DL
Sbjct: 150 DGRIYQRAFGGQSKDFGKGGQAYRTCAVADRTGHAMLHTLYGQALKNNTHFFIEYFAMDL 209

Query: 181 IINSEGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARA 240
           + ++ G  VGV+A+  E G IHRF A   V+ATGGYGRAYFS TSAHTCTGDG  MV+RA
Sbjct: 210 LTHN-GEVVGVIAYNQEDGTIHRFRAHKTVIATGGYGRAYFSCTSAHTCTGDGNAMVSRA 268

Query: 241 GLPLQDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVV 300
           G PL+D+EFVQFHP+GIYG+GCLITEGARGEGG+L+NS+GERFMERYAP+AKDLASRDVV
Sbjct: 269 GFPLEDLEFVQFHPSGIYGSGCLITEGARGEGGFLLNSEGERFMERYAPTAKDLASRDVV 328

Query: 301 SRCMMMEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVI 360
           SR + MEIR GRGVGK+KDHI L L+HL P VL+ERLPGISE+A +FAGVDVT++PIPV+
Sbjct: 329 SRAITMEIRAGRGVGKNKDHILLQLSHLPPEVLKERLPGISETAAVFAGVDVTQEPIPVL 388

Query: 361 PTVHYNMGGIPTNYWGEVLDANSKNPE-RFAPGLMAIGEAGCASVHGANRLGSNSLIDLV 419
           PTVHYNMGGIPT + GE L  + +  E +  PGLMA GEA   SVHGANRLG+NSL+DLV
Sbjct: 389 PTVHYNMGGIPTKWTGEALTIDEETGEDKVIPGLMACGEAAXVSVHGANRLGANSLLDLV 448

Query: 420 VFGRAAVIRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQL 479
           VFGRA     ++ +    P   L  +     +   D++R+A G + T+ +R  MQR MQ 
Sbjct: 449 VFGRAVANTIADTLQPGLPHKPLASNIGHESIANLDKVRNARGSLKTSQIRLNMQRTMQK 508

Query: 480 DAGVFRTQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYS 539
           D  VFRTQD+L +G RN++ +     D+ V D+S+IWNSDLVETLELQNL+  A  T  S
Sbjct: 509 DVSVFRTQDTLDEGVRNITEVDKTFEDVHVSDKSMIWNSDLVETLELQNLLTCATQTAVS 568

Query: 540 AEARKESRGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGV 599
           A  RKESRG+HARED     +  RDDVNWRKH+L W    +  +K+ YR V    +   +
Sbjct: 569 ASKRKESRGAHARED-----YAKRDDVNWRKHTLSWQKGTSTPVKIKYRNV----IAHTL 619

Query: 600 DYSKIAP 606
           D ++ AP
Sbjct: 620 DENECAP 626


>gi|255730585|ref|XP_002550217.1| succinate dehydrogenase flavoprotein subunit, mitochondrial
           precursor [Candida tropicalis MYA-3404]
 gi|240132174|gb|EER31732.1| succinate dehydrogenase flavoprotein subunit, mitochondrial
           precursor [Candida tropicalis MYA-3404]
          Length = 639

 Score =  749 bits (1933), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/611 (61%), Positives = 452/611 (73%), Gaps = 7/611 (1%)

Query: 1   MKNSSNLKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQ 60
           +  S  L+  Y  +DH YD +VVGAGGAGLRA  G+AE G+KTACI+K+FPTRSHTVAAQ
Sbjct: 36  LNTSKYLQQKYVVIDHEYDCIVVGAGGAGLRAAFGLAESGYKTACISKLFPTRSHTVAAQ 95

Query: 61  GGIAASLANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNE 120
           GGI A+L NM  D W WH YDT+KGSDWLGD DAI Y+  EAP S+YELEHYGVPFSRNE
Sbjct: 96  GGINAALGNMHRDDWHWHFYDTVKGSDWLGDQDAIHYMTKEAPDSIYELEHYGVPFSRNE 155

Query: 121 AGKIYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDL 180
            G+IYQR FGG  + +G+G    RTCA ADRTGHA+LH+LYGQAL++N  FFIE+FA+DL
Sbjct: 156 EGRIYQRAFGGQTKEFGKGGQAYRTCAVADRTGHALLHSLYGQALRHNCHFFIEFFAMDL 215

Query: 181 IINSEGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARA 240
           ++  +G CVGV+A+  E G +HRF A   V+ATGGYGRAYFS TSAHTCTGDG  M ARA
Sbjct: 216 LMQ-DGECVGVIAYNQEDGTLHRFRAHKTVIATGGYGRAYFSCTSAHTCTGDGYAMAARA 274

Query: 241 GLPLQDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVV 300
           GLPLQD+EF+QFHP+GIYG+GCLITEGARGEGG+LVNS+GERFMERYAPSAKDLA RDVV
Sbjct: 275 GLPLQDLEFIQFHPSGIYGSGCLITEGARGEGGFLVNSEGERFMERYAPSAKDLACRDVV 334

Query: 301 SRCMMMEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVI 360
           SR + MEI EGRGVG  KDH++L LNHL  AVL+ERLPGISE+A IFAGVDVT++PIP++
Sbjct: 335 SRAITMEINEGRGVGPEKDHMYLQLNHLPAAVLKERLPGISETAHIFAGVDVTKEPIPIL 394

Query: 361 PTVHYNMGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVV 420
           PTVHYNMGGIPTN+ GEVL       +   PGL+A GEA CASVHGANRLG+NSL+DLVV
Sbjct: 395 PTVHYNMGGIPTNWKGEVLKMGPDGKDEVVPGLLACGEAACASVHGANRLGANSLLDLVV 454

Query: 421 FGRAAVIRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLD 480
           FGRA      + +  ++P+         + ++    LR A G  PTA +R  MQ+ MQ  
Sbjct: 455 FGRAVSHTIRDTLTPNAPLHPSPADLGKQSIENLHHLRTAAGTKPTAEIRLDMQKTMQSG 514

Query: 481 AGVFRTQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSA 540
             VFRT+++L+    +++ +     D+K  DRS+IWNSDLVET+ELQNL+  A  T  SA
Sbjct: 515 CAVFRTEETLNKCVDHMTKVNKSFEDIKTTDRSMIWNSDLVETMELQNLLTCATQTAVSA 574

Query: 541 EARKESRGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVD 600
            ARKESRGSH+RED+ D     RDDVNW KH+L +       +KLDYR V    L  G D
Sbjct: 575 AARKESRGSHSREDYPD-----RDDVNWWKHTLSYQKDVNDPVKLDYRDVIKTTLDDG-D 628

Query: 601 YSKIAPKARVY 611
              + P  R Y
Sbjct: 629 CKPVPPTVRRY 639


>gi|224010078|ref|XP_002293997.1| succinate dehydrogenase flavoprotein subunit [Thalassiosira
           pseudonana CCMP1335]
 gi|220970669|gb|EED89006.1| succinate dehydrogenase flavoprotein subunit [Thalassiosira
           pseudonana CCMP1335]
          Length = 637

 Score =  748 bits (1931), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/616 (59%), Positives = 454/616 (73%), Gaps = 17/616 (2%)

Query: 4   SSNLKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGI 63
           S++    YT VDH+YD +V+GAGG+GLRA +G++E GFKTAC++K+FPTRSHTVAAQGGI
Sbjct: 31  STSTTGDYTIVDHTYDALVIGAGGSGLRAAMGLSEAGFKTACVSKLFPTRSHTVAAQGGI 90

Query: 64  AASLANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGK 123
            A+L NM PD W+WH+YDT+KGSDWLGD DAI Y+  EAP++V ELE +G+PFSR E GK
Sbjct: 91  NAALGNMGPDDWRWHMYDTVKGSDWLGDQDAIHYMCREAPKAVLELEEFGLPFSRTEEGK 150

Query: 124 IYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIIN 183
           IYQR FGG   ++G+G    R CAAADRTGHA+LHTLYG++L  +  +FIEYFA+DL++ 
Sbjct: 151 IYQRAFGGQSLDFGKGGQAHRCCAAADRTGHAMLHTLYGRSLAFDTTYFIEYFAMDLLMT 210

Query: 184 SEGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLP 243
            +G CVG +A  +E G +HR  AK  VLATGGYGR YFS TSAHTCTGDG  M  RAGL 
Sbjct: 211 PDGQCVGAMALNMEDGTLHRIKAKNTVLATGGYGRTYFSCTSAHTCTGDGNAMAMRAGLA 270

Query: 244 LQDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRC 303
            QD EFVQFHPTGIYGAGCLITEG RGEGG L NS+GERFMERYAPSAKDLASRDVVSR 
Sbjct: 271 NQDAEFVQFHPTGIYGAGCLITEGCRGEGGILRNSEGERFMERYAPSAKDLASRDVVSRA 330

Query: 304 MMMEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTV 363
           M MEIREGRGVG  KDH +L+L+HL   +L ERLPGISE+A IFAGVDVT++PIPV+PTV
Sbjct: 331 MTMEIREGRGVGPKKDHCYLHLDHLPAELLAERLPGISETAAIFAGVDVTKEPIPVLPTV 390

Query: 364 HYNMGGIPTNYWGEVLDAN-----SKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDL 418
           HYNMGGIPTN+ GEV+  +     S N +   PGL A GEA CASVHGANRLG+NSL+D+
Sbjct: 391 HYNMGGIPTNHLGEVIRTDFNADGSFNSDVVVPGLFAAGEAACASVHGANRLGANSLLDI 450

Query: 419 VVFGRAAVIRASEMIDKSSPIPSLDISSCDRIMD---RFDRLRHADGHVPTAALREKMQR 475
           VVFGRA   R +E+   + P  ++  +  D  MD     D+LR A G  PT+ +R +MQ 
Sbjct: 451 VVFGRACANRIAEI---AKPGDAIADAPADVGMDSVAELDKLRFATGSTPTSVIRGEMQH 507

Query: 476 AMQLDAGVFRTQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIA 535
            MQ  A V+RT++ L++G + +  +     D+ V D+SLIWN+DLVETLEL+NL+  A  
Sbjct: 508 LMQDKAAVYRTEELLAEGKKEIDEVVQSFNDVHVTDKSLIWNTDLVETLELRNLLGCAAT 567

Query: 536 TVYSAEARKESRGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELL 595
           T++SAE RKESRG+HA E++ D     R D  W KH+L + D   GK K+ YRP+H   L
Sbjct: 568 TMHSAENRKESRGAHAHENYPD-----RLDDEWMKHTLAYFDEKEGKTKIGYRPIHYYTL 622

Query: 596 CGGVDYSKIAPKARVY 611
               +   + P ARVY
Sbjct: 623 -DEEECKTVPPVARVY 637


>gi|321262262|ref|XP_003195850.1| succinate dehydrogenase flavoprotein subunit precursor
           [Cryptococcus gattii WM276]
 gi|317462324|gb|ADV24063.1| succinate dehydrogenase flavoprotein subunit precursor, putative
           [Cryptococcus gattii WM276]
          Length = 637

 Score =  748 bits (1931), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/605 (62%), Positives = 453/605 (74%), Gaps = 8/605 (1%)

Query: 8   KSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASL 67
           K  Y  +DH +D VVVGAGGAGLRA  G+AE G KTACITK+FPTRSHTVAAQGG+ A+L
Sbjct: 40  KKGYPIIDHEFDAVVVGAGGAGLRAAFGLAEGGLKTACITKLFPTRSHTVAAQGGVNAAL 99

Query: 68  ANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQR 127
            NMT D W+WH+YDT+KGSDWLGD DAI Y+  EAP +V ELEHYGVPFSR + GKIYQR
Sbjct: 100 GNMTEDDWRWHMYDTVKGSDWLGDQDAIHYMCREAPHTVIELEHYGVPFSRTKEGKIYQR 159

Query: 128 PFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGC 187
            FGG    YG+G    R  AAADRTGHAILHTLYGQ+L++N  FFIEYFALDL++  +G 
Sbjct: 160 AFGGQSLKYGKGGQAYRCAAAADRTGHAILHTLYGQSLRHNTNFFIEYFALDLLMQ-DGE 218

Query: 188 CVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDM 247
           CVGV+A  +E G +HRF +   VLATGGYGRAYFS TSAHTC+GDG  M  RAGLPLQD+
Sbjct: 219 CVGVLAINMEDGTLHRFRSHKTVLATGGYGRAYFSCTSAHTCSGDGNAMAVRAGLPLQDL 278

Query: 248 EFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMME 307
           EFVQFHPTGIYGAGCLITEG+RGEGGYL+NS+GERFMERYAP+AKDLASRDVVSR M +E
Sbjct: 279 EFVQFHPTGIYGAGCLITEGSRGEGGYLINSEGERFMERYAPTAKDLASRDVVSRSMTLE 338

Query: 308 IREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNM 367
           IREGRGVG  KDHI L L+HL   VL ERLPGISE+A IFAGVDVT++PIPV+PTVHYNM
Sbjct: 339 IREGRGVGPEKDHIFLQLSHLPAEVLHERLPGISETAAIFAGVDVTKEPIPVLPTVHYNM 398

Query: 368 GGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVI 427
           GGIPT Y GEVL  + +  ++  PGL A GEA C SVHGANRLG+NSL+D+VVFGRA   
Sbjct: 399 GGIPTKYTGEVLTVDEQGNDKVVPGLYAAGEAACVSVHGANRLGANSLLDIVVFGRACAN 458

Query: 428 RASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQ 487
              E +  ++P   +D     + +D  D++R+A G +PT+ +R  MQ+ MQ DA VFRTQ
Sbjct: 459 HIKETLSPNTPHKPMDPELGKKSIDELDKIRNASGPLPTSQIRLNMQKTMQTDAAVFRTQ 518

Query: 488 DSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESR 547
           +SL +G   +  ++     + + DRS+IWNSDL+ETLEL+N+M NA+ TV SA ARKESR
Sbjct: 519 ESLDEGVAKMRDVYKSYDQVGIKDRSMIWNSDLIETLELRNIMQNAMQTVVSAAARKESR 578

Query: 548 GSHAREDFKDGEFGGRDDVNWRKHSLCWV-DWNTGKIKLDYRPVHTELLCGGVDYSKIAP 606
           G+HAREDF D     R+D  W KH+L +  D N+  ++L YR V    L    +   + P
Sbjct: 579 GAHAREDFPD-----RNDEEWMKHTLSFQHDPNSPDVELKYRGVIANTL-DEAECKPVPP 632

Query: 607 KARVY 611
             R Y
Sbjct: 633 FKRTY 637


>gi|58698483|ref|ZP_00373389.1| succinate dehydrogenase, flavoprotein subunit [Wolbachia
           endosymbiont of Drosophila ananassae]
 gi|58534998|gb|EAL59091.1| succinate dehydrogenase, flavoprotein subunit [Wolbachia
           endosymbiont of Drosophila ananassae]
          Length = 569

 Score =  748 bits (1931), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/578 (62%), Positives = 439/578 (75%), Gaps = 11/578 (1%)

Query: 36  MAEKGFKTACITKVFPTRSHTVAAQGGIAASLANMTPDSWQWHLYDTIKGSDWLGDVDAI 95
           MA   F  ACI+K+FPTRSHTVAAQGGI+A+L N+  D W+WH YDTIKGSDWLGD DAI
Sbjct: 1   MAATNFSVACISKIFPTRSHTVAAQGGISAALGNIGEDDWRWHAYDTIKGSDWLGDQDAI 60

Query: 96  QYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRPFGGHMQNYGEGPPVQRTCAAADRTGHA 155
           +Y+   A ++V ELE++GVPFSR E GKIYQR FGG   ++G+G   QRTCAAAD+TGHA
Sbjct: 61  EYMCKNAAKAVIELENFGVPFSRTEDGKIYQRSFGGMTTHFGKGKSAQRTCAAADKTGHA 120

Query: 156 ILHTLYGQALKNNAEFFIEYFALDLIINSEGCCVGVVAWQLETGEIHRFSAKLVVLATGG 215
           ILHTLY Q LK NAEFF+EYF +DLI++SE CC GV+AW L  G +HRF A  VVLATGG
Sbjct: 121 ILHTLYQQCLKFNAEFFVEYFVIDLIMDSETCC-GVLAWSLCDGTLHRFRAHRVVLATGG 179

Query: 216 YGRAYFSATSAHTCTGDGAGMVARAGLPLQDMEFVQFHPTGIYGAGCLITEGARGEGGYL 275
           YGR YFSATSAHTCTGDG GMV RAGLPL+DMEFVQFHPTGIYG+GCL+TEG RGEGGYL
Sbjct: 180 YGRVYFSATSAHTCTGDGNGMVVRAGLPLEDMEFVQFHPTGIYGSGCLMTEGCRGEGGYL 239

Query: 276 VNSKGERFMERYAPSAKDLASRDVVSRCMMMEIREGRGVGKSKDHIHLYLNHLDPAVLQE 335
           VNS+GE+FMERYAP AKDLASRDVVSR + +EIREGRGVG  KD+++L + HLDP V++ 
Sbjct: 240 VNSQGEKFMERYAPKAKDLASRDVVSRAITIEIREGRGVGPKKDYMYLTIAHLDPEVIKL 299

Query: 336 RLPGISESARIFAGVDVTRDPIPVIPTVHYNMGGIPTNYWGEVLDANSKNPERFAPGLMA 395
           RLPGISE+AR FAGVDVT+DPIPVIPTVHYNMGGIPTNY+GEV+    +  E    GL A
Sbjct: 300 RLPGISETARTFAGVDVTKDPIPVIPTVHYNMGGIPTNYYGEVITLK-QGKEEVVDGLFA 358

Query: 396 IGEAGCASVHGANRLGSNSLIDLVVFGRAAVIRASEMIDKSSPIPSLDISSCDRIMDRFD 455
           IGEA C SVHGANRLGSNSL+DLVVFGRAA +RA E +   +P   L     D I+DRF+
Sbjct: 359 IGEAACVSVHGANRLGSNSLLDLVVFGRAAALRAKEKLKSGTPHKKLHSDCTDWIVDRFN 418

Query: 456 RLRHADGHVPTAALREKMQRAMQLDAGVFRTQDSLSDGCRNLSCLWDEMADLKVHDRSLI 515
           ++R A G +  A +R +MQ  MQ  A VFR  + L +G + +  +   M D+ + D S++
Sbjct: 419 KMRFASGGLKVAKIRSEMQNTMQKYASVFRVAEVLEEGKKAIKKVAKMMPDISLEDHSMM 478

Query: 516 WNSDLVETLELQNLMINAIATVYSAEARKESRGSHAREDFKDGEFGGRDDVNWRKHSLCW 575
           WNSDLVE LEL N++  A+ T+  A  R+ESRG+HAREDF +     RDD NW KH++ W
Sbjct: 479 WNSDLVEALELANMIPQAVITMECAANREESRGAHAREDFPE-----RDDKNWMKHTIAW 533

Query: 576 VDWNTGKI--KLDYRPVHTELLCGGVDYSKIAPKARVY 611
           ++   G+I  K+DY+ V  + L G +D+  IAP+ RVY
Sbjct: 534 LEEKKGQINVKIDYKKVAEKTLSGEIDF--IAPEKRVY 569


>gi|255718165|ref|XP_002555363.1| KLTH0G07480p [Lachancea thermotolerans]
 gi|238936747|emb|CAR24926.1| KLTH0G07480p [Lachancea thermotolerans]
          Length = 637

 Score =  748 bits (1930), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/613 (61%), Positives = 455/613 (74%), Gaps = 13/613 (2%)

Query: 2   KNSSNLKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQG 61
           +NS+     Y  VDH YD +VVGAGGAGLRA  G+AE G+KTACI+K+FPTRSHTVAAQG
Sbjct: 35  QNSAPFGGQYQVVDHEYDCLVVGAGGAGLRAAFGLAEAGYKTACISKLFPTRSHTVAAQG 94

Query: 62  GIAASLANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEA 121
           GI A+L NM  D+W+WH+YDT+KGSDWLGD D+I Y+  EA  S+ ELEH+GVPFSR E 
Sbjct: 95  GINAALGNMHKDNWKWHMYDTVKGSDWLGDQDSIHYMTREAADSIIELEHFGVPFSRTEE 154

Query: 122 GKIYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLI 181
           G+IYQR FGG  +  G+G    RTCA ADRTGHA+LHTLYGQAL++N  FFIEYFALDL+
Sbjct: 155 GRIYQRAFGGQTKENGKGGQAYRTCAVADRTGHALLHTLYGQALRHNTHFFIEYFALDLL 214

Query: 182 INSEGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAG 241
           +++ G  VGV+A+  E G IHRF A   V+ATGGYGRAYFS TSAHTCTGDG  MV+RAG
Sbjct: 215 VHN-GEVVGVIAYNQEDGTIHRFRAHKTVIATGGYGRAYFSCTSAHTCTGDGNAMVSRAG 273

Query: 242 LPLQDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVS 301
            PLQD+EFVQFHP+GIYG+GCLITEGARGEGG+LVNS+GERFMERYAP+AKDLA RDVVS
Sbjct: 274 FPLQDLEFVQFHPSGIYGSGCLITEGARGEGGFLVNSEGERFMERYAPTAKDLACRDVVS 333

Query: 302 RCMMMEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIP 361
           R + MEIREGRGVG  KDH++L LNHL  +VL+ERLPGISE+A IFAGVDVT++PIP++P
Sbjct: 334 RAITMEIREGRGVGPEKDHMYLQLNHLPASVLKERLPGISETAAIFAGVDVTKEPIPILP 393

Query: 362 TVHYNMGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVF 421
           TVHYNMGGIPT + GE L  + +  ++  PGLMA GEA C SVHGANRLG+NSL+DLVVF
Sbjct: 394 TVHYNMGGIPTKWTGEALTVDEEGNDQVIPGLMACGEAACVSVHGANRLGANSLLDLVVF 453

Query: 422 GRAAVIRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDA 481
           GRA     ++ +    P   L        +   D+LR+A G  PT+ +R  MQ+AMQ D 
Sbjct: 454 GRAVAHTVADTLQPGLPHKPLPSDLGKESIANLDKLRNATGSKPTSQIRLAMQKAMQADV 513

Query: 482 GVFRTQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAE 541
            VFRTQ+SL +G RN+  + +   D+   DRS+IWNSD+VETLELQNL+ NA  T  SA 
Sbjct: 514 SVFRTQESLDEGVRNVGAIDESFEDVGTTDRSMIWNSDMVETLELQNLLSNARQTAVSAA 573

Query: 542 ARKESRGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDY 601
            RKESRG+HARED+ +     RDD  W KH+L W     G ++L YR V    +   +D 
Sbjct: 574 NRKESRGAHAREDYPE-----RDDKEWMKHTLSWQKHPQGNVELGYRSV----IATTLDE 624

Query: 602 SK---IAPKARVY 611
           S+   + P  R Y
Sbjct: 625 SECPPVLPTVRAY 637


>gi|332285736|ref|YP_004417647.1| succinate dehydrogenase flavoprotein subunit [Pusillimonas sp.
           T7-7]
 gi|330429689|gb|AEC21023.1| succinate dehydrogenase flavoprotein subunit [Pusillimonas sp.
           T7-7]
          Length = 598

 Score =  747 bits (1928), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 380/604 (62%), Positives = 450/604 (74%), Gaps = 10/604 (1%)

Query: 9   SSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLA 68
            SY    H YDVVVVGAGGAGLRATLG+A KG   AC+TKVFPTRSHTVAAQGGIAA+L 
Sbjct: 4   QSYKVQTHEYDVVVVGAGGAGLRATLGLAAKGLSAACVTKVFPTRSHTVAAQGGIAAALG 63

Query: 69  NMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRP 128
           NM  D W++H YDT+KG DWLGD DAI+Y+  EA  +V ELEH+GVPFSR   GKIYQRP
Sbjct: 64  NMGEDHWRYHFYDTVKGGDWLGDQDAIEYMCREAIPAVIELEHFGVPFSRTGDGKIYQRP 123

Query: 129 FGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIIN-SEGC 187
           FGG   +YGEG   QR+CAAADRTGHAILHTLY QALK+NA+FF+EYF  DL+ + ++G 
Sbjct: 124 FGGMTTHYGEGI-AQRSCAAADRTGHAILHTLYTQALKHNAKFFVEYFTTDLVRDPADGR 182

Query: 188 CVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDM 247
            VGV+A  L  G +H F    ++LATGGYGRAYFS T AHT TGDG GM  RAGL LQD+
Sbjct: 183 IVGVLAIDLNNGSLHFFRGHAIMLATGGYGRAYFSCTGAHTQTGDGGGMALRAGLALQDL 242

Query: 248 EFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMME 307
           EFVQFHPTGIYGAGCLITEG RGEGG+L NS GE FM+RYAP+ KDLASRDVVSR M ME
Sbjct: 243 EFVQFHPTGIYGAGCLITEGVRGEGGFLTNSDGEPFMKRYAPNVKDLASRDVVSRAMTME 302

Query: 308 IREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNM 367
           IREGRG+G   D+IHL L HL    L ERLPGISE+ARIFAGVDVTRDPIPV+PTVHYNM
Sbjct: 303 IREGRGLGDHADYIHLNLAHLGADTLHERLPGISETARIFAGVDVTRDPIPVLPTVHYNM 362

Query: 368 GGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVI 427
           GGIPTNY GEV+     +P+   PGL AIGE+ C SVHGANRLG+NSL+D+VVFGRAA  
Sbjct: 363 GGIPTNYHGEVVQKVGNDPDVVVPGLFAIGESACVSVHGANRLGTNSLLDIVVFGRAAAN 422

Query: 428 RASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQ 487
           R +E++   +    L     +  + R D+LR+A+G  PTA LR +MQ+ MQ DA VFRT 
Sbjct: 423 RCAEIVKPDALHRDLPSDVLEPALARLDQLRYANGATPTAQLRLQMQKTMQADAAVFRTA 482

Query: 488 DSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESR 547
           ++L  GCR +  +  + AD++V DRSL+WN+DL+ETLEL NL+  A+ T++SA  R E+R
Sbjct: 483 ETLEQGCRKIDQINAQFADIRVTDRSLVWNTDLIETLELANLLEQAVGTMHSAAQRTETR 542

Query: 548 GSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPK 607
           G HAREDF +     RDDVNW KH+L  VD N G    D+RPVH+  L   V+   + P 
Sbjct: 543 GGHAREDFPE-----RDDVNWMKHTLVSVDEN-GACSFDHRPVHSNTLTDEVE--TVPPA 594

Query: 608 ARVY 611
            RVY
Sbjct: 595 KRVY 598


>gi|281209282|gb|EFA83455.1| succinate dehydrogenase [Polysphondylium pallidum PN500]
          Length = 1442

 Score =  746 bits (1927), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/603 (61%), Positives = 456/603 (75%), Gaps = 8/603 (1%)

Query: 10   SYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLAN 69
            +Y  +DH+YD +V+GAGGAGLRA LG+ EKG KTACI+K+FPTRSHTVAAQGGI A+L N
Sbjct: 847  AYPVIDHTYDALVIGAGGAGLRAALGLTEKGLKTACISKLFPTRSHTVAAQGGINAALGN 906

Query: 70   MTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRPF 129
               D W+WH YDT+KGSDWLGD DAI Y+  EA  +V ELE YGVPFSR + G+IYQR F
Sbjct: 907  ADVDDWRWHAYDTVKGSDWLGDQDAIHYMCREAVPTVLELEQYGVPFSRMDDGRIYQRAF 966

Query: 130  GGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCCV 189
            GG  +NYG+G    R CAAADRTGHA+LHTLYGQ+LK++ +FFIEYF  DLI+  +G C 
Sbjct: 967  GGQSKNYGKGGQATRCCAAADRTGHALLHTLYGQSLKHDTKFFIEYFVTDLIM-EDGECR 1025

Query: 190  GVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDMEF 249
            GV+A+ +E G IHRF +   VLATGGYGRAYFSATSAHTCTGDG  MV RAGLP QD+EF
Sbjct: 1026 GVIAYCMEDGTIHRFRSHATVLATGGYGRAYFSATSAHTCTGDGNAMVIRAGLPCQDLEF 1085

Query: 250  VQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEIR 309
            VQFHPTGIYG+GCLITEGARGEGGYL+NS+GERFM RYAPS  DLASRDVVSR + ME+R
Sbjct: 1086 VQFHPTGIYGSGCLITEGARGEGGYLLNSEGERFMPRYAPSVADLASRDVVSRSITMEVR 1145

Query: 310  EGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMGG 369
            EGRGVG  KDH  L L HL P +++ERLPGI E+A IFAGVD+T++PIP+IPTVHYNMGG
Sbjct: 1146 EGRGVGPEKDHALLNLTHLSPEIIEERLPGIRETAMIFAGVDITKEPIPIIPTVHYNMGG 1205

Query: 370  IPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIRA 429
            IPTNY GEV+  ++   +    GL A GEA C SVHGANRLG+NSL+D+VVFGRA     
Sbjct: 1206 IPTNYKGEVVTKSADGKDHIVKGLYAAGEAACVSVHGANRLGANSLLDIVVFGRACANTI 1265

Query: 430  SEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQDS 489
            ++ + K++P   L  ++ +  +   D++R ADG   TA LR +MQ+ MQ +A VFR  D 
Sbjct: 1266 ADTLPKNTPHKPLPKNAGEESIANLDKVRFADGSRSTAELRLEMQKIMQRNAAVFRDGDV 1325

Query: 490  LSDGCRNLSCLWDEMA-DLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRG 548
            L +G + +      +  DLK  DR++IWNSDLVE+LELQNLM  A+ T++SAEARKESRG
Sbjct: 1326 LKEGVQKIDQFAKSLKNDLKTTDRNMIWNSDLVESLELQNLMTQAVLTMHSAEARKESRG 1385

Query: 549  SHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPKA 608
            +HARED+K+     RDD NW KH+L ++D ++GK+ LDYRPV  E L    ++  +    
Sbjct: 1386 AHAREDYKE-----RDDKNWMKHTLSYLDVDSGKVTLDYRPVIMETL-DEKEFPTVQTAK 1439

Query: 609  RVY 611
            RVY
Sbjct: 1440 RVY 1442


>gi|68480232|ref|XP_715925.1| hypothetical protein CaO19.8070 [Candida albicans SC5314]
 gi|68480345|ref|XP_715875.1| hypothetical protein CaO19.440 [Candida albicans SC5314]
 gi|46437518|gb|EAK96863.1| hypothetical protein CaO19.440 [Candida albicans SC5314]
 gi|46437570|gb|EAK96914.1| hypothetical protein CaO19.8070 [Candida albicans SC5314]
          Length = 638

 Score =  746 bits (1926), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/605 (61%), Positives = 454/605 (75%), Gaps = 7/605 (1%)

Query: 7   LKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAAS 66
           L+  Y  +DH YD VVVGAGGAGLRA  G+AE GFKTACI+K+FPTRSHTVAAQGGI A+
Sbjct: 41  LQQKYVVIDHEYDCVVVGAGGAGLRAAFGLAESGFKTACISKLFPTRSHTVAAQGGINAA 100

Query: 67  LANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQ 126
           L NM  D W WH YDT+KGSDWLGD DAI Y+  EAP S+YELEH+GVPFSRN+ G+IYQ
Sbjct: 101 LGNMHKDDWHWHFYDTVKGSDWLGDQDAIHYMTKEAPDSIYELEHFGVPFSRNDEGRIYQ 160

Query: 127 RPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEG 186
           R FGG  + +G+G    RTCA ADRTGHA+LH+LYGQAL+++  FFIE+FA+DL++  +G
Sbjct: 161 RAFGGQTKEFGKGGQAYRTCAVADRTGHALLHSLYGQALRHDCHFFIEFFAMDLLMQ-DG 219

Query: 187 CCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQD 246
            CVGV+A+  E G IHRF +   V+ATGGYGRAYFS TSAHTCTGDG  M +RAGLPLQD
Sbjct: 220 ECVGVIAYNQEDGTIHRFRSHKTVIATGGYGRAYFSCTSAHTCTGDGYAMASRAGLPLQD 279

Query: 247 MEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMM 306
           +EF+QFHP+GIYG+GCLITEGARGEGG+LVNS+GERFMERYAP+AKDLA RDVVSR + M
Sbjct: 280 LEFIQFHPSGIYGSGCLITEGARGEGGFLVNSEGERFMERYAPTAKDLACRDVVSRAITM 339

Query: 307 EIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYN 366
           EI EGRGVG  KDH++L L+HL  AVL++RLPGISE+A IFAGVDVT++PIP++PTVHYN
Sbjct: 340 EINEGRGVGSEKDHMYLQLSHLPAAVLKQRLPGISETAHIFAGVDVTKEPIPILPTVHYN 399

Query: 367 MGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAV 426
           MGGIPTN+ GEVL   +   +   PGL+A GEA CASVHGANRLG+NSL+DLVVFGRA  
Sbjct: 400 MGGIPTNWQGEVLKKGTDGKDEVVPGLLACGEAACASVHGANRLGANSLLDLVVFGRAVS 459

Query: 427 IRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRT 486
               + +   +P+ +         ++   RLR+A+G   TA +R  MQ+ MQ    VFRT
Sbjct: 460 HTIRDNLTPGAPLHASPADLGKASIENLHRLRNAEGTKSTAEIRLDMQKTMQKGCAVFRT 519

Query: 487 QDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKES 546
           +++L +   N++ +    A++K  DRS+IWNSDLVET+ELQNL+  A  T  SA ARKES
Sbjct: 520 EETLEECVDNINEVDKSFANVKTTDRSMIWNSDLVETMELQNLLTCATQTAASALARKES 579

Query: 547 RGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAP 606
           RGSH+RED+ D     RDDVNW KH+L + +    K+KLDYR V    L    D   + P
Sbjct: 580 RGSHSREDYPD-----RDDVNWWKHTLSYQNSVGSKVKLDYRDVIKTTL-DTTDCQPVPP 633

Query: 607 KARVY 611
             R Y
Sbjct: 634 AVRKY 638


>gi|189204217|ref|XP_001938444.1| succinate dehydrogenase flavoprotein subunit, mitochondrial
           precursor [Pyrenophora tritici-repentis Pt-1C-BFP]
 gi|330907576|ref|XP_003295854.1| hypothetical protein PTT_03506 [Pyrenophora teres f. teres 0-1]
 gi|187985543|gb|EDU51031.1| succinate dehydrogenase flavoprotein subunit, mitochondrial
           precursor [Pyrenophora tritici-repentis Pt-1C-BFP]
 gi|311332457|gb|EFQ96052.1| hypothetical protein PTT_03506 [Pyrenophora teres f. teres 0-1]
          Length = 647

 Score =  746 bits (1926), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/590 (64%), Positives = 446/590 (75%), Gaps = 12/590 (2%)

Query: 4   SSNLKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGI 63
           S  + S Y  +DH YD +VVGAGGAGLRA  G+AE GF TACI+K+FPTRSHTVAAQGGI
Sbjct: 47  SGFISSKYPVIDHEYDAIVVGAGGAGLRAAFGLAEAGFNTACISKLFPTRSHTVAAQGGI 106

Query: 64  AASLANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGK 123
            A+L NM  D W+WH+YDT+KGSDWLGD DAI Y+  EAPQSV ELE+YG PFSR + GK
Sbjct: 107 NAALGNMHEDDWRWHMYDTVKGSDWLGDQDAIHYMTREAPQSVIELENYGCPFSRTDDGK 166

Query: 124 IYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIIN 183
           IYQR FGG  Q YG+G    R CAAADRTGHA+LHTLYGQ+L++N ++FIE+FA DLI+ 
Sbjct: 167 IYQRAFGGQSQKYGKGGQAYRCCAAADRTGHALLHTLYGQSLRHNTKYFIEFFATDLIME 226

Query: 184 SEGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLP 243
            +G C GVVA+  E G IHRF AK  VLATGGYGRAYFS TSAHTCTGDG  MVARAGLP
Sbjct: 227 -DGVCKGVVAYNQEDGTIHRFIAKNTVLATGGYGRAYFSCTSAHTCTGDGMAMVARAGLP 285

Query: 244 LQDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRC 303
            QD+EFVQFHPTGIYGAGCLITEG+RGEGGYL+NS+GERFMERYAP+AKDLASRDVVSR 
Sbjct: 286 NQDLEFVQFHPTGIYGAGCLITEGSRGEGGYLLNSEGERFMERYAPTAKDLASRDVVSRS 345

Query: 304 MMMEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTV 363
           M +EIREGRGVG  KDHI+L L+HL   VL ERLPGISE+A IFAGVDVT+ PIPV+PTV
Sbjct: 346 MTLEIREGRGVGPEKDHIYLQLSHLPAEVLHERLPGISETAAIFAGVDVTKQPIPVLPTV 405

Query: 364 HYNMGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGR 423
           HYNMGGIPT Y GEV+  +++  ++  PGL A GEA   SVHGANRLG+NSL+DLVVFGR
Sbjct: 406 HYNMGGIPTKYTGEVITQDAQGNDQVVPGLFACGEAASVSVHGANRLGANSLLDLVVFGR 465

Query: 424 AAVIRASEMIDKSSPIPSLDISSCDRIMDR---FDRLRHADGHVPTAALREKMQRAMQLD 480
           A    +  + D  SP  + D    D   D     D++R++DG   TA +R +MQ+ MQ D
Sbjct: 466 AV---SHTIRDNFSPGQTADPVQADAGADSIAVLDKIRNSDGAKSTAEIRLQMQKVMQTD 522

Query: 481 AGVFRTQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSA 540
             VFRTQ SL +G + +  +  + A++ + DRS+IWNSDLVETLEL+NL+  A+ T  SA
Sbjct: 523 VAVFRTQQSLDEGVKKIHDVDADFANVGIKDRSMIWNSDLVETLELRNLLTCAVQTAESA 582

Query: 541 EARKESRGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPV 590
             RKESRG+HAREDF D     RDD  W KH+L W     GK +L YR V
Sbjct: 583 ANRKESRGAHAREDFPD-----RDDEKWMKHTLSWQKQPHGKTELGYRSV 627


>gi|254574132|ref|XP_002494175.1| Flavoprotein subunit of succinate dehydrogenase (Sdh1p, Sdh2p,
           Sdh3p, Sdh4p) [Pichia pastoris GS115]
 gi|238033974|emb|CAY71996.1| Flavoprotein subunit of succinate dehydrogenase (Sdh1p, Sdh2p,
           Sdh3p, Sdh4p) [Pichia pastoris GS115]
 gi|328354006|emb|CCA40403.1| succinate dehydrogenase (ubiquinone) flavoprotein subunit [Pichia
           pastoris CBS 7435]
          Length = 637

 Score =  746 bits (1925), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/605 (61%), Positives = 454/605 (75%), Gaps = 7/605 (1%)

Query: 7   LKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAAS 66
           +   Y  +DH YD VVVGAGGAGLRA  G+A++GFKTACI+K+FPTRSHTVAAQGGI A+
Sbjct: 40  MAKDYHIIDHEYDCVVVGAGGAGLRAAFGLAKEGFKTACISKLFPTRSHTVAAQGGINAA 99

Query: 67  LANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQ 126
           L NM  D W WH+YDT+KGSDWLGD DAI Y+  EAP S+ ELEHYGVPFSR E G+IYQ
Sbjct: 100 LGNMHKDDWHWHMYDTVKGSDWLGDQDAIHYMTREAPDSIIELEHYGVPFSRTEEGRIYQ 159

Query: 127 RPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEG 186
           R FGG  + YG+G    RTCA ADRTGHA+LHTLYGQ+L++N  FFIE+FA+DL+++ +G
Sbjct: 160 RAFGGQSKEYGKGGQAYRTCAVADRTGHALLHTLYGQSLRHNTHFFIEFFAMDLLMH-DG 218

Query: 187 CCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQD 246
            CVG +A+  E G IHRF A   ++ATGGYGRAYFS TSAHTCTGDG GMV+RAGLPL+D
Sbjct: 219 KCVGCIAYNQEDGTIHRFKAHKTIIATGGYGRAYFSCTSAHTCTGDGFGMVSRAGLPLED 278

Query: 247 MEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMM 306
           +EF+QFHP+GIYG+GCLITEGARGEGG+LVNS+GERFMERYAP+AKDLA RDVVSR + M
Sbjct: 279 LEFIQFHPSGIYGSGCLITEGARGEGGFLVNSEGERFMERYAPTAKDLACRDVVSRAITM 338

Query: 307 EIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYN 366
           EI EGRGVG  KDH++L L+HL  +VL ERLPGISE+A IFAGVDVT++PIP++PTVHYN
Sbjct: 339 EINEGRGVGPLKDHMYLQLSHLPASVLHERLPGISETAHIFAGVDVTKEPIPILPTVHYN 398

Query: 367 MGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAV 426
           MGG+PT + GE L  +    ++   GL+A GEAGCASVHGANRLG+NSL+DLVVFGRA  
Sbjct: 399 MGGVPTKWSGEALTLDEDGNDKVVEGLLACGEAGCASVHGANRLGANSLLDLVVFGRAVA 458

Query: 427 IRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRT 486
               + +  ++P   L        +   DR+R ADG + TA LR +MQR MQ    VFRT
Sbjct: 459 HTIRDCLTPNTPHKELPADIGFESIANLDRVRTADGDISTADLRLEMQRTMQKHISVFRT 518

Query: 487 QDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKES 546
           QD + +G + ++ +  + A++K  DRS+IWNSDLVETLELQNL+  A  T  SA  RKES
Sbjct: 519 QDIMDEGVKQINEIDKKFANIKTTDRSMIWNSDLVETLELQNLLTCATQTAKSASVRKES 578

Query: 547 RGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAP 606
           RG+HAR+DF +     RDD NW KHSL W   +   ++L+YR V TE L    +   + P
Sbjct: 579 RGAHARDDFPE-----RDDENWMKHSLSWQHKSGSPVELNYRNVITETL-DEAECKPVPP 632

Query: 607 KARVY 611
             R Y
Sbjct: 633 TVRAY 637


>gi|312215802|emb|CBX95754.1| similar to succinate dehydrogenase flavoprotein subunit
           [Leptosphaeria maculans]
          Length = 647

 Score =  746 bits (1925), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/590 (63%), Positives = 444/590 (75%), Gaps = 12/590 (2%)

Query: 4   SSNLKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGI 63
           S  +   Y  +DH YD +VVGAGGAGLRA  G+AE GF TACI+K+FPTRSHTVAAQGGI
Sbjct: 47  SGFISQKYPVIDHEYDAIVVGAGGAGLRAAFGLAEAGFNTACISKLFPTRSHTVAAQGGI 106

Query: 64  AASLANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGK 123
            A+L NM  D W+WH+YDT+KGSDWLGD DAI Y+  EAPQSV ELE+YG PFSR + GK
Sbjct: 107 NAALGNMHEDDWRWHMYDTVKGSDWLGDQDAIHYMTREAPQSVIELENYGCPFSRTDDGK 166

Query: 124 IYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIIN 183
           IYQR FGG  Q YG+G    R CAAADRTGHA+LHTLYGQ+L++N ++FIEYFA DLI+ 
Sbjct: 167 IYQRAFGGQSQKYGKGGQAYRCCAAADRTGHALLHTLYGQSLRHNTKYFIEYFATDLIME 226

Query: 184 SEGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLP 243
            +G C GV+A+  E G IHRF AK  VLATGGYGRAYFS TSAHTCTGDG  MVARAGLP
Sbjct: 227 -DGVCKGVIAYNQEDGTIHRFIAKNTVLATGGYGRAYFSCTSAHTCTGDGMAMVARAGLP 285

Query: 244 LQDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRC 303
            QD+EFVQFHPTGIYGAGCLITEG+RGEGGYL+NS+GERFMERYAP+AKDLASRDVVSR 
Sbjct: 286 NQDLEFVQFHPTGIYGAGCLITEGSRGEGGYLLNSEGERFMERYAPTAKDLASRDVVSRS 345

Query: 304 MMMEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTV 363
           M +EIREGRGVG  KDHI+L L+HL   VL ERLPGISE+A IFAGVDVT+ PIPV+PTV
Sbjct: 346 MTLEIREGRGVGPEKDHIYLQLSHLPAEVLHERLPGISETAAIFAGVDVTKQPIPVLPTV 405

Query: 364 HYNMGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGR 423
           HYNMGGIPT Y GEV+  +    ++  PGL A GEA   SVHGANRLG+NSL+DL+VFGR
Sbjct: 406 HYNMGGIPTKYTGEVITQDESGNDQVVPGLFACGEAASVSVHGANRLGANSLLDLIVFGR 465

Query: 424 AAVIRASEMIDKSSPIPSLDISSCDRIMDR---FDRLRHADGHVPTAALREKMQRAMQLD 480
           A    +  + D  SP    D  + D   D     D++R ++G   TA +R +MQ+ MQ D
Sbjct: 466 AV---SHTIRDNFSPGQKADPVAADAGADSIAVLDQIRTSEGAKSTAEVRLQMQKVMQTD 522

Query: 481 AGVFRTQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSA 540
             VFRTQ+SL +G + +  +  + AD+ + DRS+IWNSDLVETLEL+NL+  A+ T  SA
Sbjct: 523 VAVFRTQESLDEGVQKIHDVDSQFADIGIKDRSMIWNSDLVETLELRNLLTCAVQTAESA 582

Query: 541 EARKESRGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPV 590
             RKESRG+HAREDF D     RDD NW KH+L W     G+ KL YR V
Sbjct: 583 ANRKESRGAHAREDFPD-----RDDENWMKHTLSWQKKPHGETKLGYRKV 627


>gi|241948887|ref|XP_002417166.1| flavoprotein subunit of mitochondrial complex II, putative;
           succinate dehydrogenase (ubiquinone) flavoprotein
           subunit, mitochondrail precursor, putative [Candida
           dubliniensis CD36]
 gi|223640504|emb|CAX44758.1| flavoprotein subunit of mitochondrial complex II, putative [Candida
           dubliniensis CD36]
          Length = 638

 Score =  745 bits (1924), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/608 (61%), Positives = 457/608 (75%), Gaps = 13/608 (2%)

Query: 7   LKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAAS 66
           L+  Y  +DH YD VVVGAGGAGLRA  G+AE GFKTACI+K+FPTRSHTVAAQGGI A+
Sbjct: 41  LQQKYVVIDHEYDCVVVGAGGAGLRAAFGLAESGFKTACISKLFPTRSHTVAAQGGINAA 100

Query: 67  LANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQ 126
           L NM  D W WH YDT+KGSDWLGD DAI Y+  EAP S+YELEH+GVPFSRN+ G+IYQ
Sbjct: 101 LGNMHKDDWHWHFYDTVKGSDWLGDQDAIHYMTKEAPDSIYELEHFGVPFSRNDEGRIYQ 160

Query: 127 RPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEG 186
           R FGG  + +G+G    RTCA ADRTGHA+LH+LYGQAL+++  FFIE+FA+DL++  +G
Sbjct: 161 RAFGGQTKEFGKGGQAYRTCAVADRTGHALLHSLYGQALRHDCHFFIEFFAMDLLMQ-DG 219

Query: 187 CCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQD 246
            CVGV+A+  E G IHRF +   V+ATGGYGRAYFS TSAHTCTGDG  M +RAGLPLQD
Sbjct: 220 ECVGVIAYNQEDGTIHRFRSHKTVIATGGYGRAYFSCTSAHTCTGDGYAMASRAGLPLQD 279

Query: 247 MEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMM 306
           +EF+QFHP+GIYG+GCLITEGARGEGG+LVNS+GERFMERYAPSAKDLA RDVVSR + M
Sbjct: 280 LEFIQFHPSGIYGSGCLITEGARGEGGFLVNSEGERFMERYAPSAKDLACRDVVSRAITM 339

Query: 307 EIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYN 366
           EI EGRGVG  KDH++L L+HL  +VL++RLPGISE+A IFAGVDVT++PIP++PTVHYN
Sbjct: 340 EINEGRGVGTEKDHMYLQLSHLPASVLKQRLPGISETAHIFAGVDVTKEPIPILPTVHYN 399

Query: 367 MGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAV 426
           MGGIPTN+ GEVL  + +  ++  PGL+A GEA CASVHGANRLG+NSL+DLVVFGRA  
Sbjct: 400 MGGIPTNWQGEVLKKDHEGKDKVVPGLLACGEAACASVHGANRLGANSLLDLVVFGRAV- 458

Query: 427 IRASEMIDKSSPIPSLDISSCD---RIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGV 483
             +  + D  +P  SL  S  D     ++   RLR ADG   TA +R  MQ+ MQ    V
Sbjct: 459 --SHTIRDNLTPGTSLHASPADLGKTSIENLHRLRTADGTRSTAEIRLDMQKTMQRGCAV 516

Query: 484 FRTQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEAR 543
           FRT+++L     +++ +    AD++  DRS+IWNSDLVET+ELQNL+  A  T  SA AR
Sbjct: 517 FRTEETLEKCVNHINDVDKSFADVRTTDRSMIWNSDLVETMELQNLLTCATQTAASALAR 576

Query: 544 KESRGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSK 603
           KESRGSH+RED+ D     RDDVNW KH+L + +    ++KLDYR V    L    D   
Sbjct: 577 KESRGSHSREDYPD-----RDDVNWWKHTLSYQNNVGSEVKLDYRDVIKTTL-DTTDCQP 630

Query: 604 IAPKARVY 611
           I P  R Y
Sbjct: 631 IPPAVRKY 638


>gi|145611728|ref|XP_369076.2| hypothetical protein MGG_00168 [Magnaporthe oryzae 70-15]
 gi|145018981|gb|EDK03260.1| hypothetical protein MGG_00168 [Magnaporthe oryzae 70-15]
          Length = 642

 Score =  745 bits (1924), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/615 (62%), Positives = 455/615 (73%), Gaps = 21/615 (3%)

Query: 4   SSNLKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGI 63
           S ++   Y  +DH YD +VVGAGGAGLRA  G+AE GF TACI+K+FPTRSHTVAAQGGI
Sbjct: 42  SPHVSGKYPVIDHEYDAIVVGAGGAGLRAAFGLAEAGFNTACISKLFPTRSHTVAAQGGI 101

Query: 64  AASLANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGK 123
            A+L NM  D W+WH+YDT+KGSDWLGD DAI Y+  EAP S+ ELE+YG PFSR E GK
Sbjct: 102 NAALGNMHEDDWRWHMYDTVKGSDWLGDQDAIHYMTREAPASIIELENYGCPFSRTEDGK 161

Query: 124 IYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIIN 183
           IYQR FGG  Q YG+G    R CAAADRTGHA+LHTLYGQ+L++N  +FIEYFA+DLI+ 
Sbjct: 162 IYQRAFGGQSQKYGKGGQAYRCCAAADRTGHALLHTLYGQSLRHNTNYFIEYFAMDLIMQ 221

Query: 184 SEGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLP 243
            +G CVGVVA+  E G +HRF AK  VLATGGYGRAYFS TSAHTCTGDG  MVARAGLP
Sbjct: 222 -DGECVGVVAYNQEDGTLHRFFAKNTVLATGGYGRAYFSCTSAHTCTGDGMAMVARAGLP 280

Query: 244 LQDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRC 303
            QD+EFVQFHPTGIYGAGCLITEG+RGEGGYL+NS+GERFMERYAP+AKDLASRDVVSR 
Sbjct: 281 NQDLEFVQFHPTGIYGAGCLITEGSRGEGGYLLNSEGERFMERYAPTAKDLASRDVVSRS 340

Query: 304 MMMEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTV 363
           M MEIREGRGVG  KDHI+L L+HL   VL ERLPGISE+A IF+GVDVT+ PIPV+PTV
Sbjct: 341 MTMEIREGRGVGPEKDHIYLQLSHLPAEVLAERLPGISETAAIFSGVDVTKQPIPVLPTV 400

Query: 364 HYNMGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGR 423
           HYNMGGIPT Y GEV+  +    ++  PGL A GEA C SVHGANRLG+NSL+DLVVFGR
Sbjct: 401 HYNMGGIPTRYTGEVITVDESGKDKVVPGLFACGEAACVSVHGANRLGANSLLDLVVFGR 460

Query: 424 AAVIRASEMIDKSSPIPSLDISSCD---RIMDRFDRLRHADGHVPTAALREKMQRAMQLD 480
           A    +  + D  SP      ++ D     ++  D++R ADG   TA +R  MQ+AMQ D
Sbjct: 461 AV---SHTIRDNFSPGQKHTPAAADAGAESIEVLDQVRTADGPKSTAEVRLAMQKAMQTD 517

Query: 481 AGVFRTQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSA 540
             VFRTQ+SL +G R ++ +    + +   DRS+IWNSDLVETLEL+NL+  A  T  SA
Sbjct: 518 VSVFRTQESLDEGVRKVNEVDQMFSQVGTKDRSMIWNSDLVETLELRNLLTCATQTAVSA 577

Query: 541 EARKESRGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPV--HT--ELLC 596
            ARKESRG+HARED+ D     RDD NW KH+L +     GK++L YR V  HT  E  C
Sbjct: 578 AARKESRGAHAREDYPD-----RDDDNWMKHTLSYQKKPHGKVELSYRGVIGHTLDEKEC 632

Query: 597 GGVDYSKIAPKARVY 611
             V      P  RVY
Sbjct: 633 AAV-----PPFKRVY 642


>gi|17137288|ref|NP_477210.1| succinate dehydrogenase A, isoform A [Drosophila melanogaster]
 gi|24655642|ref|NP_725881.1| succinate dehydrogenase A, isoform B [Drosophila melanogaster]
 gi|24655647|ref|NP_725882.1| succinate dehydrogenase A, isoform C [Drosophila melanogaster]
 gi|13124721|sp|Q94523|DHSA_DROME RecName: Full=Succinate dehydrogenase [ubiquinone] flavoprotein
           subunit, mitochondrial; AltName: Full=Flavoprotein
           subunit of complex II; Short=FP; AltName: Full=Succinyl
           coenzyme A synthetase flavoprotein subunit; Flags:
           Precursor
 gi|10727451|gb|AAG22257.1| succinate dehydrogenase A, isoform A [Drosophila melanogaster]
 gi|15291255|gb|AAK92896.1| GH13919p [Drosophila melanogaster]
 gi|21645167|gb|AAM70849.1| succinate dehydrogenase A, isoform B [Drosophila melanogaster]
 gi|23240219|gb|AAN16127.1| succinate dehydrogenase A, isoform C [Drosophila melanogaster]
 gi|220945436|gb|ACL85261.1| Scs-fp-PA [synthetic construct]
 gi|220955190|gb|ACL90138.1| Scs-fp-PA [synthetic construct]
 gi|256000861|gb|ACU51771.1| RE33070p [Drosophila melanogaster]
          Length = 661

 Score =  745 bits (1924), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/621 (60%), Positives = 450/621 (72%), Gaps = 15/621 (2%)

Query: 3   NSSNLKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGG 62
           N   +   Y  VDH+YD +VVGAGGAGLRA  G+  +GF+TA ITK+FPTRSHT+AAQGG
Sbjct: 44  NPDKISKQYPVVDHAYDAIVVGAGGAGLRAAFGLVAEGFRTAVITKLFPTRSHTIAAQGG 103

Query: 63  IAASLANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAG 122
           I A+L NM  D W+WH+YDT+KGSDWLGD DAI Y+  EAP++V ELE+YG+PFSR + G
Sbjct: 104 INAALGNMEEDDWKWHMYDTVKGSDWLGDQDAIHYMTREAPKAVIELENYGMPFSRTQDG 163

Query: 123 KIYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLII 182
           KIYQR FGG    +G+G    R CA ADRTGH++LHTLYGQ+L  +  +F+EYFALDLI 
Sbjct: 164 KIYQRAFGGQSLKFGKGGQAHRCCAVADRTGHSLLHTLYGQSLSYDCNYFVEYFALDLIF 223

Query: 183 NSEGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGL 242
             +G C GV+A  LE G +HRF AK  V+ATGGYGRA+FS TSAHTCTGDG  MVAR GL
Sbjct: 224 -EDGECRGVLALNLEDGTLHRFRAKNTVIATGGYGRAFFSCTSAHTCTGDGTAMVARQGL 282

Query: 243 PLQDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSR 302
           P QD+EFVQFHPTGIYGAGCLITEG RGEGGYL+N  GERFMERYAP AKDLASRDVVSR
Sbjct: 283 PSQDLEFVQFHPTGIYGAGCLITEGCRGEGGYLINGNGERFMERYAPVAKDLASRDVVSR 342

Query: 303 CMMMEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPT 362
            M +EI EGRG G  KDH++L L+HL P  L ERLPGISE+A IFAGVDVTR+PIPV+PT
Sbjct: 343 SMTIEIMEGRGAGPEKDHVYLQLHHLPPKQLAERLPGISETAMIFAGVDVTREPIPVLPT 402

Query: 363 VHYNMGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFG 422
           VHYNMGG+PTNY G+V+  +    +   PGL A GEA  +SVHGANRLG+NSL+DLVVFG
Sbjct: 403 VHYNMGGVPTNYRGQVITIDKDGKDVIVPGLYAAGEAASSSVHGANRLGANSLLDLVVFG 462

Query: 423 RAAVIRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAG 482
           RA     +E+    +P P+L  ++ +  +   D+LRHA+G + TA LR KMQ+ MQ  A 
Sbjct: 463 RACAKTIAELNKPGAPAPTLKENAGEASVANLDKLRHANGQITTADLRLKMQKTMQHHAA 522

Query: 483 VFRTQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEA 542
           VFR    L DG   +  ++ +  D+KV DRSLIWNSDLVETLELQNL+ NA  T+ SAEA
Sbjct: 523 VFRDGPILQDGVNKMKEIYKQFKDIKVVDRSLIWNSDLVETLELQNLLANAQMTIVSAEA 582

Query: 543 RKESRGSHAREDFK------------DGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPV 590
           RKESRG+HAREDFK            DG+     D +WRKH+L WV  + G I LDYR V
Sbjct: 583 RKESRGAHAREDFKVREDEYDFSKPLDGQQKKPMDQHWRKHTLSWVCNDNGDITLDYRNV 642

Query: 591 HTELLCGGVDYSKIAPKARVY 611
               L   V  S + P  R Y
Sbjct: 643 IDTTLDNEV--STVPPAIRSY 661


>gi|260815177|ref|XP_002602350.1| hypothetical protein BRAFLDRAFT_128477 [Branchiostoma floridae]
 gi|229287659|gb|EEN58362.1| hypothetical protein BRAFLDRAFT_128477 [Branchiostoma floridae]
          Length = 668

 Score =  745 bits (1923), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/618 (62%), Positives = 464/618 (75%), Gaps = 21/618 (3%)

Query: 9   SSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLA 68
           ++Y  VDH+YD VVVGAGGAGLRA  G+A +GFKTACITK+FPTRSHTVAAQGGI A+L 
Sbjct: 57  NNYPVVDHTYDAVVVGAGGAGLRAAFGLASEGFKTACITKLFPTRSHTVAAQGGINAALG 116

Query: 69  NMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRP 128
           NM PD+W+WH+YDT+KGSDWLGD DAI Y+  EAPQ+V ELE+ G+PFSR E GKIYQR 
Sbjct: 117 NMEPDNWRWHMYDTVKGSDWLGDQDAIHYMTEEAPQAVIELENMGMPFSRTEDGKIYQRA 176

Query: 129 FGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCC 188
           FGG   +YG+G    R C  ADRTGH++LHTLYGQ+L+ + E+F+EYFALDLI+  +G C
Sbjct: 177 FGGQSYDYGKGGQAHRCCCVADRTGHSLLHTLYGQSLRYDTEYFVEYFALDLIMK-DGEC 235

Query: 189 VGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDME 248
           +GV+A  +E G IHRF AK  VLATGGYGRAYFS TSAHT TGDG  MV RAGL  QDME
Sbjct: 236 IGVIAINMEDGTIHRFHAKNTVLATGGYGRAYFSCTSAHTNTGDGTAMVTRAGLANQDME 295

Query: 249 FVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEI 308
           FVQFHPTGIYGAGCLITEG RGEGGYL+NS+GERFMERYAP+AKDLASRDVVSR M +EI
Sbjct: 296 FVQFHPTGIYGAGCLITEGCRGEGGYLINSEGERFMERYAPTAKDLASRDVVSRSMTIEI 355

Query: 309 REGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMG 368
           REGRG G  KDH++L L+HL P  L  RLPGISE+A IFAGVDVTR+PIPV+PTVHYNMG
Sbjct: 356 REGRGCGPEKDHVYLQLHHLPPEQLAARLPGISETAMIFAGVDVTREPIPVLPTVHYNMG 415

Query: 369 GIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIR 428
           G+PTNY G+V+  +S+  +   PGL A GEA CASVHGANRLG+NSL+DLVVFGRA    
Sbjct: 416 GVPTNYKGQVVQHDSEKGDYIVPGLYACGEAACASVHGANRLGANSLLDLVVFGRAC--- 472

Query: 429 ASEMIDKSSP---IPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFR 485
           A  + D++ P   I  L   + +  +   D +R+A+G VPTA LR +MQ+ MQ  A VFR
Sbjct: 473 AHTIRDENKPGEAIADLPKHAGEESVANLDAVRYANGSVPTADLRLQMQKTMQAHAAVFR 532

Query: 486 TQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKE 545
           T D L +GC  +S L ++M D+K  DR ++WN+DL+ETLELQNLM+NA  T++SAE RKE
Sbjct: 533 TGDVLKEGCDKISELVNKMDDIKTFDRGVVWNTDLIETLELQNLMLNAAQTMFSAENRKE 592

Query: 546 SRGSHAREDFKD--GEFGGRDDVN----------WRKHSLCWVDWNTGKIKLDYRPVHTE 593
           SRG+HAREDFKD   E+     V+          WRKH+LC +D +   + L YRPV  E
Sbjct: 593 SRGAHAREDFKDRIDEYDYSKPVDGQKARPAADHWRKHTLCKMD-DGKTVDLSYRPVIDE 651

Query: 594 LLCGGVDYSKIAPKARVY 611
            L    D   + P  R Y
Sbjct: 652 TL-DEQDCKHVPPAIRSY 668


>gi|194881336|ref|XP_001974804.1| GG20911 [Drosophila erecta]
 gi|190657991|gb|EDV55204.1| GG20911 [Drosophila erecta]
          Length = 661

 Score =  745 bits (1923), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/621 (60%), Positives = 450/621 (72%), Gaps = 15/621 (2%)

Query: 3   NSSNLKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGG 62
           N   +   Y  VDH+YD +VVGAGGAGLRA  G+  +GF+TA ITK+FPTRSHT+AAQGG
Sbjct: 44  NPDKISKQYPVVDHAYDAIVVGAGGAGLRAAFGLVAEGFRTAVITKLFPTRSHTIAAQGG 103

Query: 63  IAASLANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAG 122
           I A+L NM  D W+WH+YDT+KGSDWLGD DAI Y+  EAP++V ELE+YG+PFSR + G
Sbjct: 104 INAALGNMEEDDWKWHMYDTVKGSDWLGDQDAIHYMTREAPKAVIELENYGMPFSRTQDG 163

Query: 123 KIYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLII 182
           KIYQR FGG    +G+G    R CA ADRTGH++LHTLYGQ+L  +  +F+EYFALDLI 
Sbjct: 164 KIYQRAFGGQSLKFGKGGQAHRCCAVADRTGHSLLHTLYGQSLSYDCNYFVEYFALDLIF 223

Query: 183 NSEGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGL 242
             +G C GV+A  LE G +HRF AK  V+ATGGYGRA+FS TSAHTCTGDG  MVAR GL
Sbjct: 224 -EDGECRGVLALNLEDGTLHRFRAKNTVIATGGYGRAFFSCTSAHTCTGDGTAMVARQGL 282

Query: 243 PLQDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSR 302
           P QD+EFVQFHPTGIYGAGCLITEG RGEGGYL+N  GERFMERYAP AKDLASRDVVSR
Sbjct: 283 PSQDLEFVQFHPTGIYGAGCLITEGCRGEGGYLINGNGERFMERYAPVAKDLASRDVVSR 342

Query: 303 CMMMEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPT 362
            M +EI EGRG G  KDH++L L+HL P  L ERLPGISE+A IFAGVDVTR+PIPV+PT
Sbjct: 343 SMTIEIMEGRGAGPEKDHVYLQLHHLPPKQLAERLPGISETAMIFAGVDVTREPIPVLPT 402

Query: 363 VHYNMGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFG 422
           VHYNMGG+PTNY G+V+  +    +   PGL A GE+  +SVHGANRLG+NSL+DLVVFG
Sbjct: 403 VHYNMGGVPTNYRGQVITIDKDGKDVIVPGLYAAGESASSSVHGANRLGANSLLDLVVFG 462

Query: 423 RAAVIRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAG 482
           RA     +E+    +P P+L  ++ +  +   D+LRHA+G + TA LR KMQ+ MQ  A 
Sbjct: 463 RACAKTIAELNKPGAPAPTLKENAGEASVANLDKLRHANGQITTADLRLKMQKTMQHHAA 522

Query: 483 VFRTQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEA 542
           VFR    L DG   +  ++ +  D+KV DRSLIWNSDLVETLELQNL+ NA  T+ SAEA
Sbjct: 523 VFRDGPILQDGVNKMKEIYKQFKDIKVVDRSLIWNSDLVETLELQNLLANAQMTIVSAEA 582

Query: 543 RKESRGSHAREDFK------------DGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPV 590
           RKESRG+HAREDFK            DG+     D +WRKH+L WV  + G I LDYR V
Sbjct: 583 RKESRGAHAREDFKVREDEYDFSKPLDGQQKKPMDQHWRKHTLSWVCNDNGDITLDYRNV 642

Query: 591 HTELLCGGVDYSKIAPKARVY 611
               L   V  S + P  R Y
Sbjct: 643 IDTTLDSEV--STVPPAIRSY 661


>gi|323347727|gb|EGA81991.1| Sdh1p [Saccharomyces cerevisiae Lalvin QA23]
          Length = 640

 Score =  744 bits (1920), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/602 (61%), Positives = 447/602 (74%), Gaps = 8/602 (1%)

Query: 11  YTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLANM 70
           Y  +DH YD VV+GAGGAGLRA  G+AE G+KTACI+K+FPTRSHTVAAQGGI A+L NM
Sbjct: 46  YHIIDHEYDCVVIGAGGAGLRAAFGLAEAGYKTACISKLFPTRSHTVAAQGGINAALGNM 105

Query: 71  TPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRPFG 130
             D+W+WH+YDT+KGSDWLGD D+I Y+  EAP+S+ ELEHYGVPFSR E GKIYQR FG
Sbjct: 106 HKDNWKWHMYDTVKGSDWLGDQDSIHYMTREAPKSIIELEHYGVPFSRTENGKIYQRAFG 165

Query: 131 GHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCCVG 190
           G  + YG+G    RTCA ADRTGHA+LHTLYGQAL+ +  FFIEYFALDL+ ++ G  VG
Sbjct: 166 GQTKEYGKGAQAYRTCAVADRTGHALLHTLYGQALRXDTHFFIEYFALDLLTHN-GEVVG 224

Query: 191 VVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDMEFV 250
           V+A+  E G IHRF A   ++ATGGYGRAYFS TSAHTCTGDG  MV+RAG PLQD+EFV
Sbjct: 225 VIAYNQEDGTIHRFRAHKTIIATGGYGRAYFSCTSAHTCTGDGNAMVSRAGFPLQDLEFV 284

Query: 251 QFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEIRE 310
           QFHP+GIYG+GCLITEGARGEGG+LVNS+GERFMERYAP+AKDLA RDVVSR + MEIRE
Sbjct: 285 QFHPSGIYGSGCLITEGARGEGGFLVNSEGERFMERYAPTAKDLACRDVVSRAITMEIRE 344

Query: 311 GRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMGGI 370
           GRGVGK KDH++L L+HL P VL+ERLPGISE+A IFAGVDVT++PIP+IPTVHYNMGGI
Sbjct: 345 GRGVGKKKDHMYLQLSHLPPEVLKERLPGISETAAIFAGVDVTKEPIPIIPTVHYNMGGI 404

Query: 371 PTNYWGEVLDANSKNPE-RFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIRA 429
           PT + GE L  + +  E +  PGLMA GEA C SVHGANRLG+NSL+DLVVFGRA     
Sbjct: 405 PTKWNGEALTIDEETGEDKVIPGLMACGEAACVSVHGANRLGANSLLDLVVFGRAVAHTV 464

Query: 430 SEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQDS 489
           ++ +    P   L        +   D+LR+A+G   TA +R  M++ MQ D  VFRTQ S
Sbjct: 465 ADTLQPGLPHKPLPSDLGKESIANLDKLRNANGSRSTAEIRMNMKQTMQKDVSVFRTQSS 524

Query: 490 LSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRGS 549
           L +G RN++ +     D+K  DRS+IWNSDLVETLELQNL+  A  T  SA  RKESRG+
Sbjct: 525 LDEGVRNITAVEKTFDDVKTTDRSMIWNSDLVETLELQNLLTCASQTAVSAANRKESRGA 584

Query: 550 HAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPKAR 609
           HARED+ +     RDD +W KH+L W       + L YR V    L    +   + P  R
Sbjct: 585 HAREDYPN-----RDDEHWMKHTLSWQKDVAAPVTLKYRRVXDHTL-DEKECPSVPPTVR 638

Query: 610 VY 611
            Y
Sbjct: 639 AY 640


>gi|126273727|ref|XP_001387286.1| succinate dehydrogenase [Scheffersomyces stipitis CBS 6054]
 gi|126213156|gb|EAZ63263.1| succinate dehydrogenase [Pichia stipitis CBS 6054]
          Length = 641

 Score =  744 bits (1920), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/605 (61%), Positives = 452/605 (74%), Gaps = 7/605 (1%)

Query: 7   LKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAAS 66
           +   Y  +DH YD VVVGAGGAGLRA  G+AE GFKTACI+K+FPTRSHTVAAQGGI A+
Sbjct: 44  MSQKYHVIDHEYDCVVVGAGGAGLRAAFGLAEAGFKTACISKLFPTRSHTVAAQGGINAA 103

Query: 67  LANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQ 126
           L NM  D W WH+YDT+KGSDWLGD DAI Y+  EAPQS+YELE+YGVPFSRNE G+IYQ
Sbjct: 104 LGNMHKDDWHWHMYDTVKGSDWLGDQDAIHYMTKEAPQSIYELENYGVPFSRNEEGRIYQ 163

Query: 127 RPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEG 186
           R FGG  + YG+G    RTCA ADRTGHA+LH+LYGQ+L+++  FFIE+FA+DL++  +G
Sbjct: 164 RAFGGQSKEYGKGGQAYRTCAVADRTGHALLHSLYGQSLRHDTHFFIEFFAMDLMMQ-DG 222

Query: 187 CCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQD 246
            C+GV+A+  E G +HRF A   V+ATGGYGRAYFS TSAHTCTGDG  MV+RAGLPL+D
Sbjct: 223 ECIGVMAYNQEDGTLHRFRAHKTVIATGGYGRAYFSCTSAHTCTGDGYAMVSRAGLPLED 282

Query: 247 MEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMM 306
           +EFVQFHP+GIYG+GCLITEGARGEGG+L+NS+GERFMERYAPSAKDLASRDVVSR + M
Sbjct: 283 LEFVQFHPSGIYGSGCLITEGARGEGGFLLNSEGERFMERYAPSAKDLASRDVVSRAITM 342

Query: 307 EIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYN 366
           EI EGRGVG  KDH++L L+H+  AVL+ERLPGISE+A IFAGVDVT++PIP++PTVHYN
Sbjct: 343 EINEGRGVGPKKDHMYLQLSHIPAAVLKERLPGISETAHIFAGVDVTKEPIPILPTVHYN 402

Query: 367 MGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAV 426
           MGGIPT + GEVL  N K  +   PGL+A GEA CASVHGANRLG+NSL+DLVVFGRA  
Sbjct: 403 MGGIPTKWNGEVLKKNEKGEDEVVPGLLACGEAACASVHGANRLGANSLLDLVVFGRAVS 462

Query: 427 IRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRT 486
               + +   +P            +   D+LR+A G   TA +R+ MQ  MQ    VFRT
Sbjct: 463 HTIRDSLTPGAPHKPAPKDIGYESIANLDKLRNATGSKTTAQIRDDMQHTMQRGCAVFRT 522

Query: 487 QDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKES 546
           Q++L     +++ +    AD+K  DRS+IWNSDLVETLELQNL+  A  T  SA ARKES
Sbjct: 523 QETLDKCVEHITEVDKSFADVKTTDRSMIWNSDLVETLELQNLLTCATQTAKSASARKES 582

Query: 547 RGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAP 606
           RG+HAR+D+       RDD NWR H+L +   +  ++KLDYR V  +      D   + P
Sbjct: 583 RGAHARDDYP-----SRDDENWRVHTLSYQTASGEEVKLDYRDV-IKTTMDENDCKPVPP 636

Query: 607 KARVY 611
             RVY
Sbjct: 637 AVRVY 641


>gi|323354039|gb|EGA85885.1| Sdh1p [Saccharomyces cerevisiae VL3]
          Length = 640

 Score =  743 bits (1919), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/606 (62%), Positives = 450/606 (74%), Gaps = 16/606 (2%)

Query: 11  YTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLANM 70
           Y  +DH YD VV+GAGGAGLRA  G+AE G+KTACI+K+FPTRSHTVAAQGGI A+L NM
Sbjct: 46  YHIIDHEYDCVVIGAGGAGLRAAFGLAEAGYKTACISKLFPTRSHTVAAQGGINAALGNM 105

Query: 71  TPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRPFG 130
             D+W+WH+YDT+KGSDWLGD D+I Y+  EAP+S+ ELEHYGVPFSR E GKIYQR FG
Sbjct: 106 HKDNWKWHMYDTVKGSDWLGDQDSIHYMTREAPKSIIELEHYGVPFSRTENGKIYQRAFG 165

Query: 131 GHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCCVG 190
           G  + YG+G    RTCA ADRTGHA+LHTLYGQAL+++  FFIEYFALDL+ ++ G  VG
Sbjct: 166 GQTKEYGKGAQAYRTCAVADRTGHALLHTLYGQALRHDTHFFIEYFALDLLTHN-GEVVG 224

Query: 191 VVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDMEFV 250
           V+A+  E G IHRF A   ++ATGGYGRAYFS TSAHTCTGDG  MV+RAG PLQD+EFV
Sbjct: 225 VIAYNQEDGTIHRFRAHKTIIATGGYGRAYFSCTSAHTCTGDGNAMVSRAGFPLQDLEFV 284

Query: 251 QFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEIRE 310
           QFHP+GIYG+GCLITEGARGEGG+LVNS+GERFMERYAP+AKDLA RDVVSR + MEIRE
Sbjct: 285 QFHPSGIYGSGCLITEGARGEGGFLVNSEGERFMERYAPTAKDLACRDVVSRAITMEIRE 344

Query: 311 GRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMGGI 370
           GRGVGK KDH++L L+HL P VL+ERLPGISE+A IFAGVDVT++PIP+IPTVHYNMGGI
Sbjct: 345 GRGVGKKKDHMYLQLSHLPPEVLKERLPGISETAAIFAGVDVTKEPIPIIPTVHYNMGGI 404

Query: 371 PTNYWGEVLDANSKNPE-RFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIRA 429
           PT + GE L  + +  E +  PGLMA GEA C SVHGANRLG+NSL+DLVVFGRA     
Sbjct: 405 PTKWNGEALTIDEETGEDKVIPGLMACGEAACVSVHGANRLGANSLLDLVVFGRAVAHTV 464

Query: 430 SEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQDS 489
           ++ +    P   L        +   D+LR+A+G   TA +R  M++ MQ D  VFRTQ S
Sbjct: 465 ADTLQPGLPHKPLPSDLGKESIANLDKLRNANGSRSTAEIRMNMKQTMQKDVSVFRTQSS 524

Query: 490 LSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRGS 549
           L +G RN++ +     D+K  DRS+IWNSDLVETLELQNL+  A  T  SA  RKESRG+
Sbjct: 525 LDEGVRNITAVEKTFDDVKTTDRSMIWNSDLVETLELQNLLTCASQTAVSAANRKESRGA 584

Query: 550 HAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPV--HT--ELLCGGVDYSKIA 605
           HARED+ +     RDD +W KH+L W       + L YR V  HT  E  C       + 
Sbjct: 585 HAREDYPN-----RDDEHWMKHTLSWQKDVAAPVTLKYRRVIDHTLDEKEC-----PSVP 634

Query: 606 PKARVY 611
           P  R Y
Sbjct: 635 PTVRAY 640


>gi|6322701|ref|NP_012774.1| Sdh1p [Saccharomyces cerevisiae S288c]
 gi|231993|sp|Q00711|DHSA_YEAST RecName: Full=Succinate dehydrogenase [ubiquinone] flavoprotein
           subunit, mitochondrial; AltName: Full=Flavoprotein
           subunit of complex II; Short=FP; Flags: Precursor
 gi|172551|gb|AAA35022.1| putative succinate dehydrogenase flavoprotein subunit
           [Saccharomyces cerevisiae]
 gi|172554|gb|AAA35024.1| succinate dehydrogenase flavoprotein [Saccharomyces cerevisiae]
 gi|172557|gb|AAA35026.1| succinate dehydrogenase [Saccharomyces cerevisiae]
 gi|407500|emb|CAA81506.1| unknown [Saccharomyces cerevisiae]
 gi|486254|emb|CAA81989.1| SDH1 [Saccharomyces cerevisiae]
 gi|151941660|gb|EDN60022.1| succinate dehydrogenase flavoprotein subunit [Saccharomyces
           cerevisiae YJM789]
 gi|285813118|tpg|DAA09015.1| TPA: Sdh1p [Saccharomyces cerevisiae S288c]
 gi|323308335|gb|EGA61581.1| Sdh1p [Saccharomyces cerevisiae FostersO]
 gi|1582556|prf||2118404T ORF
          Length = 640

 Score =  743 bits (1919), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/606 (62%), Positives = 450/606 (74%), Gaps = 16/606 (2%)

Query: 11  YTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLANM 70
           Y  +DH YD VV+GAGGAGLRA  G+AE G+KTACI+K+FPTRSHTVAAQGGI A+L NM
Sbjct: 46  YHIIDHEYDCVVIGAGGAGLRAAFGLAEAGYKTACISKLFPTRSHTVAAQGGINAALGNM 105

Query: 71  TPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRPFG 130
             D+W+WH+YDT+KGSDWLGD D+I Y+  EAP+S+ ELEHYGVPFSR E GKIYQR FG
Sbjct: 106 HKDNWKWHMYDTVKGSDWLGDQDSIHYMTREAPKSIIELEHYGVPFSRTENGKIYQRAFG 165

Query: 131 GHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCCVG 190
           G  + YG+G    RTCA ADRTGHA+LHTLYGQAL+++  FFIEYFALDL+ ++ G  VG
Sbjct: 166 GQTKEYGKGAQAYRTCAVADRTGHALLHTLYGQALRHDTHFFIEYFALDLLTHN-GEVVG 224

Query: 191 VVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDMEFV 250
           V+A+  E G IHRF A   ++ATGGYGRAYFS TSAHTCTGDG  MV+RAG PLQD+EFV
Sbjct: 225 VIAYNQEDGTIHRFRAHKTIIATGGYGRAYFSCTSAHTCTGDGNAMVSRAGFPLQDLEFV 284

Query: 251 QFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEIRE 310
           QFHP+GIYG+GCLITEGARGEGG+LVNS+GERFMERYAP+AKDLA RDVVSR + MEIRE
Sbjct: 285 QFHPSGIYGSGCLITEGARGEGGFLVNSEGERFMERYAPTAKDLACRDVVSRAITMEIRE 344

Query: 311 GRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMGGI 370
           GRGVGK KDH++L L+HL P VL+ERLPGISE+A IFAGVDVT++PIP+IPTVHYNMGGI
Sbjct: 345 GRGVGKKKDHMYLQLSHLPPEVLKERLPGISETAAIFAGVDVTKEPIPIIPTVHYNMGGI 404

Query: 371 PTNYWGEVLDANSKNPE-RFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIRA 429
           PT + GE L  + +  E +  PGLMA GEA C SVHGANRLG+NSL+DLVVFGRA     
Sbjct: 405 PTKWNGEALTIDEETGEDKVIPGLMACGEAACVSVHGANRLGANSLLDLVVFGRAVAHTV 464

Query: 430 SEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQDS 489
           ++ +    P   L        +   D+LR+A+G   TA +R  M++ MQ D  VFRTQ S
Sbjct: 465 ADTLQPGLPHKPLPSDLGKESIANLDKLRNANGSRSTAEIRMNMKQTMQKDVSVFRTQSS 524

Query: 490 LSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRGS 549
           L +G RN++ +     D+K  DRS+IWNSDLVETLELQNL+  A  T  SA  RKESRG+
Sbjct: 525 LDEGVRNITAVEKTFDDVKTTDRSMIWNSDLVETLELQNLLTCASQTAVSAANRKESRGA 584

Query: 550 HAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPV--HT--ELLCGGVDYSKIA 605
           HARED+ +     RDD +W KH+L W       + L YR V  HT  E  C       + 
Sbjct: 585 HAREDYPN-----RDDEHWMKHTLSWQKDVAAPVTLKYRRVIDHTLDEKEC-----PSVP 634

Query: 606 PKARVY 611
           P  R Y
Sbjct: 635 PTVRAY 640


>gi|158289891|ref|XP_311518.4| AGAP010429-PA [Anopheles gambiae str. PEST]
 gi|157018376|gb|EAA07202.4| AGAP010429-PA [Anopheles gambiae str. PEST]
          Length = 659

 Score =  743 bits (1919), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/621 (60%), Positives = 456/621 (73%), Gaps = 16/621 (2%)

Query: 3   NSSNLKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGG 62
           N   +   Y  VDH+YD VVVGAGGAGLRA  G+  +GFKTA ITK+FPTRSHTVAAQGG
Sbjct: 43  NPDAISREYPVVDHTYDAVVVGAGGAGLRAAFGLVAEGFKTAVITKLFPTRSHTVAAQGG 102

Query: 63  IAASLANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAG 122
           I A+L NM  D W+WH+YDT+KGSDWLGD DAI Y+  EAP++V ELE+YG+PFSR   G
Sbjct: 103 INAALGNMEEDDWKWHMYDTVKGSDWLGDQDAIHYMTREAPKAVIELENYGMPFSRTPDG 162

Query: 123 KIYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLII 182
           KIYQR FGG    YG+G    R C  ADRTGH++LHTLYGQ+L  +  +FIEYFA+DL++
Sbjct: 163 KIYQRAFGGQSLKYGKGGQAHRCCCVADRTGHSLLHTLYGQSLSYDCNYFIEYFAMDLLM 222

Query: 183 NSEGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGL 242
            + G CVGV+A  LE G IHRF AK  VLATGGYGRAYFS TSAHTCTGDG  MVARAGL
Sbjct: 223 QN-GECVGVIAMNLEDGSIHRFRAKNTVLATGGYGRAYFSCTSAHTCTGDGTAMVARAGL 281

Query: 243 PLQDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSR 302
           P +D+EFVQFHPTGIYGAGCLITEG RGEGGYL+NS+GERFMERYAP AKDLASRDVVSR
Sbjct: 282 PSEDLEFVQFHPTGIYGAGCLITEGCRGEGGYLINSQGERFMERYAPVAKDLASRDVVSR 341

Query: 303 CMMMEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPT 362
            M +EIREGRG G  KDH++L L+HL P  L +RLPGISE+A IFAGVDVTR+PIPV+PT
Sbjct: 342 SMTIEIREGRGCGPEKDHVYLQLHHLPPEQLAQRLPGISETAMIFAGVDVTREPIPVLPT 401

Query: 363 VHYNMGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFG 422
           VHYNMGG+PTNY G+VL       +R  PGL A GEA C+SVHGANRLG+NSL+DLVVFG
Sbjct: 402 VHYNMGGVPTNYKGQVL-TTQNGADRVVPGLYACGEAACSSVHGANRLGANSLLDLVVFG 460

Query: 423 RAAVIRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAG 482
           RA     +E       +  L  ++ +  +   D +R+ADG VPT+ LR  MQ+ MQ  A 
Sbjct: 461 RACAKTIAEENRPGEKVQDLKPNAGEASVANLDWVRNADGQVPTSTLRLNMQKTMQTHAA 520

Query: 483 VFRTQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEA 542
           VFR + +L +G R +  ++  + D+KV DRSL+WNSDLVETLELQNL++NA  T+ +AE 
Sbjct: 521 VFREEKTLQEGVRKMGDIYKTIKDVKVSDRSLVWNSDLVETLELQNLLLNANMTIVAAEN 580

Query: 543 RKESRGSHAREDFK------------DGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPV 590
           RKESRG+HARED+K            +G+     + +WRKH+L W+D  TG + +DYRPV
Sbjct: 581 RKESRGAHAREDYKQRVDEYDFSKPLEGQQKKPVEEHWRKHTLTWIDPATGNVTIDYRPV 640

Query: 591 HTELLCGGVDYSKIAPKARVY 611
             E L    + + + P  R Y
Sbjct: 641 IDETL--SEECATVPPAIRSY 659


>gi|259147693|emb|CAY80943.1| Sdh1p [Saccharomyces cerevisiae EC1118]
          Length = 640

 Score =  743 bits (1919), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/602 (61%), Positives = 447/602 (74%), Gaps = 8/602 (1%)

Query: 11  YTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLANM 70
           Y  +DH YD VV+GAGGAGLRA  G+AE G+KTACI+K+FPTRSHTVAAQGGI A+L NM
Sbjct: 46  YHIIDHEYDCVVIGAGGAGLRAAFGLAEAGYKTACISKLFPTRSHTVAAQGGINAALGNM 105

Query: 71  TPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRPFG 130
             D+W+WH+YDT+KGSDWLGD D+I Y+  EAP+S+ ELEHYGVPFSR E GKIYQR FG
Sbjct: 106 HKDNWKWHMYDTVKGSDWLGDQDSIHYMTREAPKSIIELEHYGVPFSRTENGKIYQRAFG 165

Query: 131 GHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCCVG 190
           G  + YG+G    RTCA ADRTGHA+LHTLYGQAL+ +  FFIEYFALDL+ ++ G  VG
Sbjct: 166 GQTKEYGKGAQAYRTCAVADRTGHALLHTLYGQALRYDTHFFIEYFALDLLTHN-GEVVG 224

Query: 191 VVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDMEFV 250
           V+A+  E G IHRF A   ++ATGGYGRAYFS TSAHTCTGDG  MV+RAG PLQD+EFV
Sbjct: 225 VIAYNQEDGTIHRFRAHKTIIATGGYGRAYFSCTSAHTCTGDGNAMVSRAGFPLQDLEFV 284

Query: 251 QFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEIRE 310
           QFHP+GIYG+GCLITEGARGEGG+LVNS+GERFMERYAP+AKDLA RDVVSR + MEIRE
Sbjct: 285 QFHPSGIYGSGCLITEGARGEGGFLVNSEGERFMERYAPTAKDLACRDVVSRAITMEIRE 344

Query: 311 GRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMGGI 370
           GRGVGK KDH++L L+HL P VL+ERLPGISE+A IFAGVDVT++PIP+IPTVHYNMGGI
Sbjct: 345 GRGVGKKKDHMYLQLSHLPPEVLKERLPGISETAAIFAGVDVTKEPIPIIPTVHYNMGGI 404

Query: 371 PTNYWGEVLDANSKNPE-RFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIRA 429
           PT + GE L  + +  E +  PGLMA GEA C SVHGANRLG+NSL+DLVVFGRA     
Sbjct: 405 PTKWNGEALTIDEETGEDKVIPGLMACGEAACVSVHGANRLGANSLLDLVVFGRAVAHTV 464

Query: 430 SEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQDS 489
           ++ +    P   L        +   D+LR+A+G   TA +R  M++ MQ D  VFRTQ S
Sbjct: 465 ADTLQPGLPHKPLPSDLGKESIANLDKLRNANGSRSTAEIRMNMKQTMQKDVSVFRTQSS 524

Query: 490 LSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRGS 549
           L +G RN++ +     D+K  DRS+IWNSDLVETLELQNL+  A  T  SA  RKESRG+
Sbjct: 525 LDEGVRNITAVEKTFDDVKTTDRSMIWNSDLVETLELQNLLTCASQTAVSAANRKESRGA 584

Query: 550 HAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPKAR 609
           HARED+ +     RDD +W KH+L W       + L YR V    L    +   + P  R
Sbjct: 585 HAREDYPN-----RDDEHWMKHTLSWQKDVAAPVTLKYRRVSDHTL-DEKECPSVPPTVR 638

Query: 610 VY 611
            Y
Sbjct: 639 AY 640


>gi|302692708|ref|XP_003036033.1| hypothetical protein SCHCODRAFT_74617 [Schizophyllum commune H4-8]
 gi|300109729|gb|EFJ01131.1| hypothetical protein SCHCODRAFT_74617 [Schizophyllum commune H4-8]
          Length = 639

 Score =  743 bits (1919), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/602 (62%), Positives = 457/602 (75%), Gaps = 8/602 (1%)

Query: 11  YTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLANM 70
           Y  ++H YD VVVGAGGAGLRA  G+AE GF TACITK+FPTRSHTVAAQGGI A+L NM
Sbjct: 45  YPLIEHEYDAVVVGAGGAGLRAAFGLAEAGFNTACITKLFPTRSHTVAAQGGINAALGNM 104

Query: 71  TPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRPFG 130
           T D W+WH+YDT+KGSDWLGD DAI Y+  EAP++V ELEH+GVPFSR + GKIYQR FG
Sbjct: 105 TEDDWRWHMYDTVKGSDWLGDQDAIHYMCREAPKTVIELEHFGVPFSRTKEGKIYQRAFG 164

Query: 131 GHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCCVG 190
           G    YG+G    R  AAADRTGHA+LHTLYGQ+L++N  FFIEYFALDLI+  +G CVG
Sbjct: 165 GQSLKYGKGGQAYRCAAAADRTGHALLHTLYGQSLRHNTNFFIEYFALDLIMQ-DGECVG 223

Query: 191 VVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDMEFV 250
           V+A  LE G +HRF +   VLATGGYGRAYFS TSAHTCTGDG  MVARAGLPLQD+EFV
Sbjct: 224 VIALNLEDGTLHRFRSHKTVLATGGYGRAYFSCTSAHTCTGDGNAMVARAGLPLQDLEFV 283

Query: 251 QFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEIRE 310
           QFHPTGIYGAGCLITEG+RGEGGYL+NS+GERFMERYAP+AKDLASRDVVSR M +EIRE
Sbjct: 284 QFHPTGIYGAGCLITEGSRGEGGYLLNSEGERFMERYAPTAKDLASRDVVSRSMTIEIRE 343

Query: 311 GRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMGGI 370
           GRGVG  KDH +L L+HL   +L ERLPGISE+A IF+GVDVT++PIPV+PTVHYNMGGI
Sbjct: 344 GRGVGPEKDHCYLQLSHLPAEILHERLPGISETAAIFSGVDVTKEPIPVLPTVHYNMGGI 403

Query: 371 PTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIRAS 430
           PT Y GEV+  +    ++  PGL A GEA C SVHGANRLG+NSL+D+VVFGRA      
Sbjct: 404 PTKYTGEVITVDENGKDKVVPGLYAAGEAACVSVHGANRLGANSLLDIVVFGRACAHHIE 463

Query: 431 EMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQDSL 490
           E +    P   +   +    ++  D++R ADG +PTA +R  +Q+AMQ DA VFRTQ+SL
Sbjct: 464 ETLTPGKPHKKIPDEAGIESIEFLDQIRKADGPIPTAKIRLDLQKAMQSDAAVFRTQESL 523

Query: 491 SDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRGSH 550
            +G + +  +++   D+ + DRS+IWNSDLVETLEL+NL+  A+ T+ SA ARKESRG+H
Sbjct: 524 DEGVQKVKQIYETYKDVGIKDRSMIWNSDLVETLELRNLLQCAVQTITSAAARKESRGAH 583

Query: 551 AREDFKDGEFGGRDDVNWRKHSLCWVDWNTGK-IKLDYRPVHTELLCGGVDYSKIAPKAR 609
           AREDF +     RDD +W KH+L + + +T   +KL YR V  + L    +   + P  R
Sbjct: 584 AREDFPE-----RDDESWMKHTLSFQNDSTKPDVKLSYRGVIDKTLDEN-ECKAVPPFKR 637

Query: 610 VY 611
           VY
Sbjct: 638 VY 639


>gi|46125967|ref|XP_387537.1| hypothetical protein FG07361.1 [Gibberella zeae PH-1]
          Length = 1755

 Score =  743 bits (1917), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/590 (63%), Positives = 444/590 (75%), Gaps = 12/590 (2%)

Query: 4    SSNLKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGI 63
            S  + + Y  +DH YD +VVGAGGAGLRA  G+AE GF TACI+K+FPTRSHTVAAQGGI
Sbjct: 1155 SPFVSNKYAVIDHEYDALVVGAGGAGLRAAFGLAEAGFNTACISKLFPTRSHTVAAQGGI 1214

Query: 64   AASLANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGK 123
             A+L NM  D W+WH+YDT+KGSDWLGD DAI Y+  EAP S+ ELE+YG PFSR E GK
Sbjct: 1215 NAALGNMHEDDWRWHMYDTVKGSDWLGDQDAIHYMTREAPASIIELENYGCPFSRTEDGK 1274

Query: 124  IYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIIN 183
            IYQR FGG  + YG+G    R CAAADRTGHA+LHTLYGQ+L++   +FIEYFALDLI+ 
Sbjct: 1275 IYQRAFGGQSKEYGKGGQAYRCCAAADRTGHALLHTLYGQSLRHKTNYFIEYFALDLIMQ 1334

Query: 184  SEGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLP 243
             +G C GV+A+  E G +HRF A   VLATGGYGRAYFS TSAHTCTGDG  MVARAGLP
Sbjct: 1335 -DGECRGVLAYNQEDGTLHRFLANHTVLATGGYGRAYFSCTSAHTCTGDGMAMVARAGLP 1393

Query: 244  LQDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRC 303
             QD+EFVQFHPTGIYGAGCLITEG+RGEGGYL+NS+GERFMERYAP+AKDLASRDVVSR 
Sbjct: 1394 NQDLEFVQFHPTGIYGAGCLITEGSRGEGGYLLNSEGERFMERYAPTAKDLASRDVVSRS 1453

Query: 304  MMMEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTV 363
            M MEIREGRGVG  KDHI+L L+HL   +L ERLPGISE+A IFAGVDV + PIPV+PTV
Sbjct: 1454 MTMEIREGRGVGAEKDHIYLQLSHLPAEILAERLPGISETAGIFAGVDVRKQPIPVLPTV 1513

Query: 364  HYNMGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGR 423
            HYNMGGIPT Y GEVL  + K  ++  PGL A GEA C SVHGANRLG+NSL+DLVVFGR
Sbjct: 1514 HYNMGGIPTRYTGEVLTVDEKGEDKVVPGLYACGEAACVSVHGANRLGANSLLDLVVFGR 1573

Query: 424  AAVIRASEMIDKSSPIPSLDISSCDRIMDR---FDRLRHADGHVPTAALREKMQRAMQLD 480
            A    +  + DK +P  +L  ++ D   D     D++R ADG   TA +R  MQ+AMQ +
Sbjct: 1574 AV---SHTIRDKFNPGDALKPTAADAASDHIETLDKVRTADGPKSTAEIRLAMQKAMQTE 1630

Query: 481  AGVFRTQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSA 540
              VFRTQ+SL +G R +  +    + + + DRS+IWNSDLVETLEL+NL+  AI T  SA
Sbjct: 1631 VSVFRTQESLDEGVRKMKEIDGMYSQVGMKDRSMIWNSDLVETLELRNLLTCAIQTAESA 1690

Query: 541  EARKESRGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPV 590
              RKESRG+HAREDF D     RDD NW KH+L +     GK+ L YR V
Sbjct: 1691 ANRKESRGAHAREDFPD-----RDDENWMKHTLSFQKQPHGKVDLSYRKV 1735


>gi|238879017|gb|EEQ42655.1| succinate dehydrogenase flavoprotein subunit, mitochondrial
           precursor [Candida albicans WO-1]
          Length = 638

 Score =  743 bits (1917), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/605 (60%), Positives = 453/605 (74%), Gaps = 7/605 (1%)

Query: 7   LKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAAS 66
           L+  Y  +DH YD VVVGAGGAGLRA  G+AE GFKTACI+K+FPTRSHTVAAQGGI A+
Sbjct: 41  LQQKYVVIDHEYDCVVVGAGGAGLRAAFGLAESGFKTACISKLFPTRSHTVAAQGGINAA 100

Query: 67  LANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQ 126
           L NM  D W WH YDT+KGSDWLGD DAI Y+  EAP S+YELEH+GVPFSRN+ G+IYQ
Sbjct: 101 LGNMHKDDWHWHFYDTVKGSDWLGDQDAIHYMTKEAPDSIYELEHFGVPFSRNDEGRIYQ 160

Query: 127 RPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEG 186
           R FGG  + +G+G    RTCA ADRTGHA+LH+LYGQAL+++  FFIE+FA+DL++  +G
Sbjct: 161 RAFGGQTKEFGKGGQAYRTCAVADRTGHALLHSLYGQALRHDCHFFIEFFAMDLLMQ-DG 219

Query: 187 CCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQD 246
            CVGV+A+  E G IHRF +   V+ATGGYGRAYFS TSAHTCTGDG  M +RAGLPLQD
Sbjct: 220 ECVGVIAYNQEDGTIHRFRSHKTVIATGGYGRAYFSCTSAHTCTGDGYAMASRAGLPLQD 279

Query: 247 MEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMM 306
           +EF+QFHP+GIYG+GCLITEGARGEGG+LVNS+GERFMERYAP+AKDLA RDVVSR + M
Sbjct: 280 LEFIQFHPSGIYGSGCLITEGARGEGGFLVNSEGERFMERYAPTAKDLACRDVVSRAITM 339

Query: 307 EIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYN 366
           EI EGRGVG  KDH++L L+HL  AVL++RLPGISE+A IFAGVDVT++PIP++PTVHYN
Sbjct: 340 EINEGRGVGSEKDHMYLQLSHLPAAVLKQRLPGISETAHIFAGVDVTKEPIPILPTVHYN 399

Query: 367 MGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAV 426
           MGGIPTN+ GEVL   +   +   PGL+A GEA CASVHGANRLG+NSL+DLVVFGRA  
Sbjct: 400 MGGIPTNWQGEVLKKGTDGKDEVVPGLLACGEAACASVHGANRLGANSLLDLVVFGRAVS 459

Query: 427 IRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRT 486
               + +   +P+ +         ++   RLR+A+G   TA +R  MQ+ MQ    VFRT
Sbjct: 460 HTIRDNLTPGAPLHASPADLGKASIENLHRLRNAEGTKSTAEIRLDMQKTMQKGCAVFRT 519

Query: 487 QDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKES 546
           +++L +   N++ +    A++K  DRS+IWNSDLVET+ELQNL+  A  T  SA ARKES
Sbjct: 520 EETLEECVDNINEVDKSFANVKTTDRSMIWNSDLVETMELQNLLTCATQTAASALARKES 579

Query: 547 RGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAP 606
           RGSH+RED+       RDDVNW KH+L + +    K+KLDYR V    L    D   + P
Sbjct: 580 RGSHSREDYP-----YRDDVNWWKHTLSYQNSVGSKVKLDYRDVIKTTL-DTTDCQPVPP 633

Query: 607 KARVY 611
             R Y
Sbjct: 634 AVRKY 638


>gi|190409691|gb|EDV12956.1| succinate dehydrogenase flavoprotein subunit [Saccharomyces
           cerevisiae RM11-1a]
 gi|323332720|gb|EGA74125.1| Sdh1p [Saccharomyces cerevisiae AWRI796]
          Length = 640

 Score =  742 bits (1916), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/606 (62%), Positives = 449/606 (74%), Gaps = 16/606 (2%)

Query: 11  YTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLANM 70
           Y  +DH YD VV+GAGGAGLRA  G+AE G+KTACI+K+FPTRSHTVAAQGGI A+L NM
Sbjct: 46  YHIIDHEYDCVVIGAGGAGLRAAFGLAEAGYKTACISKLFPTRSHTVAAQGGINAALGNM 105

Query: 71  TPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRPFG 130
             D+W+WH+YDT+KGSDWLGD D+I Y+  EAP+S+ ELEHYGVPFSR E GKIYQR FG
Sbjct: 106 HKDNWKWHMYDTVKGSDWLGDQDSIHYMTREAPKSIIELEHYGVPFSRTENGKIYQRAFG 165

Query: 131 GHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCCVG 190
           G  + YG+G    RTCA ADRTGHA+LHTLYGQAL+ +  FFIEYFALDL+ ++ G  VG
Sbjct: 166 GQTKEYGKGAQAYRTCAVADRTGHALLHTLYGQALRYDTHFFIEYFALDLLTHN-GEVVG 224

Query: 191 VVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDMEFV 250
           V+A+  E G IHRF A   ++ATGGYGRAYFS TSAHTCTGDG  MV+RAG PLQD+EFV
Sbjct: 225 VIAYNQEDGTIHRFRAHKTIIATGGYGRAYFSCTSAHTCTGDGNAMVSRAGFPLQDLEFV 284

Query: 251 QFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEIRE 310
           QFHP+GIYG+GCLITEGARGEGG+LVNS+GERFMERYAP+AKDLA RDVVSR + MEIRE
Sbjct: 285 QFHPSGIYGSGCLITEGARGEGGFLVNSEGERFMERYAPTAKDLACRDVVSRAITMEIRE 344

Query: 311 GRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMGGI 370
           GRGVGK KDH++L L+HL P VL+ERLPGISE+A IFAGVDVT++PIP+IPTVHYNMGGI
Sbjct: 345 GRGVGKKKDHMYLQLSHLPPEVLKERLPGISETAAIFAGVDVTKEPIPIIPTVHYNMGGI 404

Query: 371 PTNYWGEVLDANSKNPE-RFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIRA 429
           PT + GE L  + +  E +  PGLMA GEA C SVHGANRLG+NSL+DLVVFGRA     
Sbjct: 405 PTKWNGEALTIDEETGEDKVIPGLMACGEAACVSVHGANRLGANSLLDLVVFGRAVAHTV 464

Query: 430 SEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQDS 489
           ++ +    P   L        +   D+LR+A+G   TA +R  M++ MQ D  VFRTQ S
Sbjct: 465 ADTLQPGLPHKPLPSDLGKESIANLDKLRNANGSRSTAEIRMNMKQTMQKDVSVFRTQSS 524

Query: 490 LSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRGS 549
           L +G RN++ +     D+K  DRS+IWNSDLVETLELQNL+  A  T  SA  RKESRG+
Sbjct: 525 LDEGVRNITAVEKTFDDVKTTDRSMIWNSDLVETLELQNLLTCASQTAVSAANRKESRGA 584

Query: 550 HAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPV--HT--ELLCGGVDYSKIA 605
           HARED+ +     RDD +W KH+L W       + L YR V  HT  E  C       + 
Sbjct: 585 HAREDYPN-----RDDEHWMKHTLSWQKDVAAPVTLKYRRVIDHTLDEKEC-----PSVP 634

Query: 606 PKARVY 611
           P  R Y
Sbjct: 635 PTVRAY 640


>gi|195487156|ref|XP_002091790.1| GE13850 [Drosophila yakuba]
 gi|194177891|gb|EDW91502.1| GE13850 [Drosophila yakuba]
          Length = 661

 Score =  742 bits (1916), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/621 (60%), Positives = 450/621 (72%), Gaps = 15/621 (2%)

Query: 3   NSSNLKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGG 62
           N   +   Y  VDH+YD +VVGAGGAGLRA  G+  +GF+TA ITK+FPTRSHT+AAQGG
Sbjct: 44  NPDKISKQYPVVDHAYDAIVVGAGGAGLRAAFGLVAEGFRTAVITKLFPTRSHTIAAQGG 103

Query: 63  IAASLANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAG 122
           I A+L NM  D W+WH+YDT+KGSDWLGD DAI Y+  EAP++V ELE+YG+PFSR + G
Sbjct: 104 INAALGNMEEDDWKWHMYDTVKGSDWLGDQDAIHYMTREAPKAVIELENYGMPFSRTQDG 163

Query: 123 KIYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLII 182
           KIYQR FGG    +G+G    R CA ADRTGH++LHTLYGQ+L  +  +F+EYFALDLI 
Sbjct: 164 KIYQRAFGGQSLKFGKGGQAHRCCAVADRTGHSLLHTLYGQSLSYDCNYFVEYFALDLIF 223

Query: 183 NSEGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGL 242
             +G C GV+A  LE G +HRF AK  V+ATGGYGRA+FS TSAHTCTGDG  MVAR GL
Sbjct: 224 -EDGECRGVLALNLEDGTLHRFRAKNTVIATGGYGRAFFSCTSAHTCTGDGTAMVARQGL 282

Query: 243 PLQDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSR 302
           P QD+EFVQFHPTGIYGAGCLITEG RGEGGYL+N  GERFMERYAP AKDLASRDVVSR
Sbjct: 283 PSQDLEFVQFHPTGIYGAGCLITEGCRGEGGYLINGNGERFMERYAPVAKDLASRDVVSR 342

Query: 303 CMMMEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPT 362
            M +EI EGRG G  KDH++L L+HL P  L ERLPGISE+A IFAGVDVTR+PIPV+PT
Sbjct: 343 SMTIEIMEGRGAGPEKDHVYLQLHHLPPKQLAERLPGISETAMIFAGVDVTREPIPVLPT 402

Query: 363 VHYNMGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFG 422
           VHYNMGG+PTNY G+V+  +    +   PGL A GE+  +SVHGANRLG+NSL+DLVVFG
Sbjct: 403 VHYNMGGVPTNYRGQVITIDKDGKDVIVPGLYAAGESASSSVHGANRLGANSLLDLVVFG 462

Query: 423 RAAVIRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAG 482
           RA     +E+    +P P+L  ++ +  +   D+LRHA+G + TA LR KMQ+ MQ  A 
Sbjct: 463 RACAKTIAELNRPGAPAPTLKENAGEASVANLDKLRHANGQITTADLRLKMQKTMQHHAA 522

Query: 483 VFRTQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEA 542
           VFR    L DG   +  ++ +  D+KV DRSLIWNSDLVETLELQNL+ NA  T+ SAEA
Sbjct: 523 VFRDGPILQDGVNKMKEIYKQFKDIKVVDRSLIWNSDLVETLELQNLLANAQMTIVSAEA 582

Query: 543 RKESRGSHAREDFK------------DGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPV 590
           RKESRG+HAREDFK            +G+     D +WRKH+L WV  + G I LDYR V
Sbjct: 583 RKESRGAHAREDFKVREDEYDFSKPLEGQQKKPMDKHWRKHTLSWVCNDNGDITLDYRNV 642

Query: 591 HTELLCGGVDYSKIAPKARVY 611
               L   V  S + P  R Y
Sbjct: 643 IDTTLDNEV--STVPPAIRSY 661


>gi|327275201|ref|XP_003222362.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein
           subunit, mitochondrial-like [Anolis carolinensis]
          Length = 664

 Score =  742 bits (1915), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/622 (59%), Positives = 457/622 (73%), Gaps = 15/622 (2%)

Query: 2   KNSSNLKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQG 61
           K S ++ + Y  VDH +D VVVGAGGAGLRA  G++E GF TAC+TK+FPTRSHTVAAQG
Sbjct: 46  KVSDSISTQYPVVDHEFDAVVVGAGGAGLRAAFGLSEAGFNTACVTKLFPTRSHTVAAQG 105

Query: 62  GIAASLANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEA 121
           GI A+L NM  D+W+WH YDT+KGSDWLGD DAI Y+  +AP SV ELE+YG+PFSR E 
Sbjct: 106 GINAALGNMEEDNWRWHFYDTVKGSDWLGDQDAIHYMTEQAPASVIELENYGMPFSRTEE 165

Query: 122 GKIYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLI 181
           GKIYQR FGG    +G+G    R C  ADRTGH++LHTLYG++L+ +  +F+EYF LDL+
Sbjct: 166 GKIYQRAFGGQSLKFGKGGQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFVLDLL 225

Query: 182 INSEGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAG 241
           + +  CC GV+A  +E G IHR  AK  V+ATGGYGR YFS TSAHTCTGDG  M+ RAG
Sbjct: 226 MENGECC-GVIALCIEDGTIHRIRAKNTVIATGGYGRTYFSCTSAHTCTGDGTAMITRAG 284

Query: 242 LPLQDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVS 301
           LP QD+EFVQFHPTGIYGAGCLITEG RGEGG L+NS+GERFMERYAP AKDLASRDVVS
Sbjct: 285 LPCQDLEFVQFHPTGIYGAGCLITEGCRGEGGILINSEGERFMERYAPVAKDLASRDVVS 344

Query: 302 RCMMMEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIP 361
           R M +EIREGRG G  KDH++L L+HL P  L  RLPGISE+A IFAGVDVT++PIPV+P
Sbjct: 345 RSMTIEIREGRGCGPEKDHVYLQLHHLPPQQLATRLPGISETAMIFAGVDVTKEPIPVLP 404

Query: 362 TVHYNMGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVF 421
           TVHYNMGG+PTNY G+V+  +    ++  PGL A GEA CASVHGANRLG+NSL+DLVVF
Sbjct: 405 TVHYNMGGVPTNYKGQVI-THVNGKDQIVPGLYACGEAACASVHGANRLGANSLLDLVVF 463

Query: 422 GRAAVIRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDA 481
           GRA  +  +E      P+PS+  ++ +  +   D+LR A+G + T+ LR  MQ+ MQ  A
Sbjct: 464 GRACALSIAETCKPGEPVPSIKPNAGEESVANLDKLRFANGSIRTSELRLDMQKTMQSHA 523

Query: 482 GVFRTQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAE 541
            VFRT   L +GC  +S L+  M DLK  DR ++WN+DLVETLELQNLM+ A+ T+Y AE
Sbjct: 524 AVFRTGPVLQEGCEKVSSLYSSMDDLKTFDRGVVWNTDLVETLELQNLMLCALQTIYGAE 583

Query: 542 ARKESRGSHAREDFK------------DGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRP 589
           ARKE+RG+HARED+K            +G+     D +WRKH+L +VD  TGK+ L+YRP
Sbjct: 584 ARKETRGAHAREDYKVRIDEYDYSKPIEGQQEKPFDQHWRKHTLSYVDVKTGKVSLEYRP 643

Query: 590 VHTELLCGGVDYSKIAPKARVY 611
           V  + L    D + + P  R Y
Sbjct: 644 VIDQTL-NEEDCAAVPPAIRSY 664


>gi|256271089|gb|EEU06188.1| Sdh1p [Saccharomyces cerevisiae JAY291]
          Length = 640

 Score =  742 bits (1915), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/613 (61%), Positives = 451/613 (73%), Gaps = 16/613 (2%)

Query: 4   SSNLKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGI 63
           S +    Y  +DH YD VV+GAGGAGLRA  G+AE G+KTACI+K+FPTRSHTVAAQGGI
Sbjct: 39  SRSADGKYHIIDHEYDCVVIGAGGAGLRAAFGLAEAGYKTACISKLFPTRSHTVAAQGGI 98

Query: 64  AASLANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGK 123
            A+L NM  D+W+WH+YDT+KGSDWLGD D+I Y+  EAP+S+ ELEHYGVPFSR E GK
Sbjct: 99  NAALGNMHKDNWKWHMYDTVKGSDWLGDQDSIHYMTREAPKSIIELEHYGVPFSRTENGK 158

Query: 124 IYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIIN 183
           IYQR FGG  + YG+G    RTCA ADRTGHA+LHTLYGQAL+++  FFIEYFALDL+ +
Sbjct: 159 IYQRAFGGQTKEYGKGAQAYRTCAVADRTGHALLHTLYGQALRHDTHFFIEYFALDLLTH 218

Query: 184 SEGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLP 243
           + G  VGV+A+  E G IHRF A   ++ATGGYGRAYFS TSAHTCTGDG  MV+RAG P
Sbjct: 219 N-GEVVGVIAYNQEDGTIHRFRAHKTIIATGGYGRAYFSCTSAHTCTGDGNAMVSRAGFP 277

Query: 244 LQDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRC 303
           LQD+EFVQFHP+GIYG+GCLITEGARGEGG+LVNS+GERFMERYAP+AKDLA RDVVSR 
Sbjct: 278 LQDLEFVQFHPSGIYGSGCLITEGARGEGGFLVNSEGERFMERYAPTAKDLACRDVVSRA 337

Query: 304 MMMEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTV 363
           + MEIREGRGVGK KDH++L L+HL P VL+ERLPGISE+A IFAGVDVT++PIP+IPTV
Sbjct: 338 ITMEIREGRGVGKKKDHMYLQLSHLPPEVLKERLPGISETAAIFAGVDVTKEPIPIIPTV 397

Query: 364 HYNMGGIPTNYWGEVLDANSKNPE-RFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFG 422
           HYNMGGIPT + GE L  + +  E +  PGLMA GEA C SVHGANRLG+NSL+DLVVFG
Sbjct: 398 HYNMGGIPTKWNGEALTIDEETGEDKVIPGLMACGEAACVSVHGANRLGANSLLDLVVFG 457

Query: 423 RAAVIRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAG 482
           RA     ++ +    P   L        +   D+LR+A+G   TA +R  M++ MQ D  
Sbjct: 458 RAVAHTVADTLQPGLPHKPLPSDLGKESIANLDKLRNANGSRSTAEIRMNMKQTMQKDVS 517

Query: 483 VFRTQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEA 542
           VFRTQ SL +G RN+  +     D+K  DRS+IWNSDLVETLELQNL+  A  T  SA  
Sbjct: 518 VFRTQSSLDEGVRNIIAVEKTFDDVKTTDRSMIWNSDLVETLELQNLLTCASQTAVSAAN 577

Query: 543 RKESRGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPV--HT--ELLCGG 598
           RKESRG+HARED+ +     RDD +W KH+L W       + L YR V  HT  E  C  
Sbjct: 578 RKESRGAHAREDYPN-----RDDEHWMKHTLSWQKDVAAPVTLKYRRVIDHTLDEKEC-- 630

Query: 599 VDYSKIAPKARVY 611
                + P  R Y
Sbjct: 631 ---PSVPPTVRAY 640


>gi|170095721|ref|XP_001879081.1| predicted protein [Laccaria bicolor S238N-H82]
 gi|164646385|gb|EDR10631.1| predicted protein [Laccaria bicolor S238N-H82]
          Length = 639

 Score =  742 bits (1915), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/602 (62%), Positives = 451/602 (74%), Gaps = 8/602 (1%)

Query: 11  YTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLANM 70
           Y  ++H +D VVVGAGGAGLRA  G+AE GFKTACITK+FPTRSHTVAAQGGI A+L NM
Sbjct: 45  YPLIEHEFDAVVVGAGGAGLRAAFGLAEAGFKTACITKLFPTRSHTVAAQGGINAALGNM 104

Query: 71  TPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRPFG 130
           T D W+WH+YDT+KGSDWLGD DAI Y+  EAP +V ELEHYGVPFSR   GKIYQR FG
Sbjct: 105 TEDDWRWHMYDTVKGSDWLGDQDAIHYMCREAPHTVIELEHYGVPFSRTPEGKIYQRAFG 164

Query: 131 GHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCCVG 190
           G    YG+G    R  AAADRTGHA+LHTLYGQ+L++N  FFIEYFALDLI+  +G CVG
Sbjct: 165 GQSLKYGKGGQAYRCAAAADRTGHALLHTLYGQSLRHNTNFFIEYFALDLIMQ-DGECVG 223

Query: 191 VVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDMEFV 250
           V+A  +E G +HRF +   VLATGGYGRAYFS TSAHTC+GDG  MV RAGLPLQD+EFV
Sbjct: 224 VIALNMEDGTLHRFRSHKTVLATGGYGRAYFSCTSAHTCSGDGNAMVVRAGLPLQDLEFV 283

Query: 251 QFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEIRE 310
           QFHPTGIYGAGCLITEG+RGEGGYL+NS+GERFMERYAP+AKDLASRDVVSR M +EIRE
Sbjct: 284 QFHPTGIYGAGCLITEGSRGEGGYLLNSEGERFMERYAPTAKDLASRDVVSRSMTIEIRE 343

Query: 311 GRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMGGI 370
           GRGVG  KDHI+L L+HL   VL ERLPGISE+A IF+GVDVT+ PIPV+PTVHYNMGGI
Sbjct: 344 GRGVGPEKDHIYLQLSHLPAEVLHERLPGISETAAIFSGVDVTKGPIPVLPTVHYNMGGI 403

Query: 371 PTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIRAS 430
           PT Y GEVL  +    ++  PGL A GEA C SVHGANRLG+NSL+D+VVFGRA      
Sbjct: 404 PTKYTGEVLTVDKGGNDKIVPGLYAAGEAACVSVHGANRLGANSLLDIVVFGRAVAHHIR 463

Query: 431 EMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQDSL 490
           + +    P  ++   +    ++  D++R +DG  PTA +R  MQ+AMQ DA VFRTQ +L
Sbjct: 464 DTLTPGKPHKTIPDEAGIESIEFLDKIRRSDGPEPTAKIRLDMQKAMQTDAAVFRTQKTL 523

Query: 491 SDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRGSH 550
            +G   +  ++    ++ + DRS+IWNSDLVETLEL+N++  AI T+ SA ARKESRG+H
Sbjct: 524 DEGVEKVRSIYKNFDNVGIKDRSMIWNSDLVETLELRNILQCAIQTITSAAARKESRGAH 583

Query: 551 AREDFKDGEFGGRDDVNWRKHSLCWV-DWNTGKIKLDYRPVHTELLCGGVDYSKIAPKAR 609
           AREDF D     RDD NW KH+L +  D N+  ++L YR V  +      +   + P  R
Sbjct: 584 AREDFPD-----RDDENWMKHTLSFQHDVNSPDVELKYRKV-IDTTLDEAECKPVPPFKR 637

Query: 610 VY 611
           VY
Sbjct: 638 VY 639


>gi|50290633|ref|XP_447749.1| hypothetical protein [Candida glabrata CBS 138]
 gi|49527060|emb|CAG60696.1| unnamed protein product [Candida glabrata]
          Length = 710

 Score =  741 bits (1914), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/601 (61%), Positives = 445/601 (74%), Gaps = 7/601 (1%)

Query: 11  YTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLANM 70
           Y  +DH YD +VVGAGGAGLRA  G+AE GFKTACI+K+FPTRSHTVAAQGGI A+L NM
Sbjct: 117 YNVIDHEYDCLVVGAGGAGLRAAFGLAEAGFKTACISKLFPTRSHTVAAQGGINAALGNM 176

Query: 71  TPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRPFG 130
             D+W+WH+YDT+KGSDWLGD DAI Y+  EAP+S+ ELEHYG+PFSR E G+IYQR FG
Sbjct: 177 HKDNWKWHMYDTVKGSDWLGDQDAIHYMTREAPKSIIELEHYGMPFSRTEEGRIYQRAFG 236

Query: 131 GHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCCVG 190
           G  + +G+G    RTCA ADRTGHA+LHTLYGQAL ++  FFIE+FA+DL+ ++ G  VG
Sbjct: 237 GQSKEFGKGGQAYRTCAVADRTGHAMLHTLYGQALNHDCHFFIEFFAMDLLTHN-GEVVG 295

Query: 191 VVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDMEFV 250
           ++A+  E G IHRF A   VLATGGYGRAYFS TSAHTCTGDG  MV+RAG PLQD+EFV
Sbjct: 296 IIAYNQEDGTIHRFRAHKTVLATGGYGRAYFSCTSAHTCTGDGNAMVSRAGFPLQDLEFV 355

Query: 251 QFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEIRE 310
           QFHP+GIYG+GCLITEGARGEGG+L+NS+GERFMERYAP+AKDLASRDVVSR M MEIRE
Sbjct: 356 QFHPSGIYGSGCLITEGARGEGGFLLNSEGERFMERYAPTAKDLASRDVVSRAMTMEIRE 415

Query: 311 GRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMGGI 370
           GRGVGK KDHI L L+HL PAVL+ERLPGISE+A IFAGVDVT+ PIPV+PTVHYNMGGI
Sbjct: 416 GRGVGKHKDHIFLQLSHLPPAVLKERLPGISETAAIFAGVDVTKQPIPVLPTVHYNMGGI 475

Query: 371 PTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIRAS 430
           PT + GE L  +    ++  PGLMA GEA C SVHGANRLG+NSL+DLVVFGRA     +
Sbjct: 476 PTKWTGECLTIDENGEDKVIPGLMACGEAACVSVHGANRLGANSLLDLVVFGRAVANTVA 535

Query: 431 EMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQDSL 490
           + +   +P   L        +   D +R+A G   TA +R  MQ+ MQ D  VFR Q++L
Sbjct: 536 DTLQPGTPHKPLPADLGKESLASLDAIRNASGDKTTAQIRLNMQKTMQKDVSVFRMQETL 595

Query: 491 SDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRGSH 550
            +G +N++ +     D+ V D+S+IWNSDLVET+EL+NL+  A  T  SA  RKESRG+H
Sbjct: 596 DEGVKNITAVDKTFKDVHVTDKSMIWNSDLVETMELRNLLTCATQTAVSAAERKESRGAH 655

Query: 551 AREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPKARV 610
           ARED+       RDD NWRKH+L W       + + YR V    L    +   + P  R 
Sbjct: 656 AREDYPS-----RDDENWRKHTLSWQQHTGDPVSIKYRKVIATTL-DEAECPPVPPAVRS 709

Query: 611 Y 611
           Y
Sbjct: 710 Y 710


>gi|320580455|gb|EFW94677.1| Flavoprotein subunit of succinate dehydrogenase [Pichia angusta
           DL-1]
          Length = 636

 Score =  741 bits (1914), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/608 (61%), Positives = 455/608 (74%), Gaps = 7/608 (1%)

Query: 4   SSNLKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGI 63
           SS +   Y  +DH YD VV+GAGGAGLRA  G+ ++GFK ACI+K+FPTRSHTVAAQGGI
Sbjct: 36  SSAMAKEYHIIDHEYDAVVIGAGGAGLRAAFGLVQEGFKVACISKLFPTRSHTVAAQGGI 95

Query: 64  AASLANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGK 123
            A+L NM PD W+WH+YDT+KGSDWLGD DAI Y+  EAP S+ ELEHYG+PFSRN+ GK
Sbjct: 96  NAALGNMHPDEWRWHMYDTVKGSDWLGDQDAIHYMTREAPDSIIELEHYGLPFSRNKEGK 155

Query: 124 IYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIIN 183
           IYQR FGG  + +G+G    RTCA ADRTGHA+LHTLYGQ+L+ +  +FIE+FA+DL+++
Sbjct: 156 IYQRAFGGQSKEFGKGGQAYRTCAVADRTGHALLHTLYGQSLRYDTHYFIEFFAMDLLMH 215

Query: 184 SEGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLP 243
            +G CVG +A+  E G +HRF A   V+ATGGYGRAYFS TSAHTCTGDG  MV+RAGLP
Sbjct: 216 -DGRCVGCIAYNEEDGTLHRFKANNTVIATGGYGRAYFSCTSAHTCTGDGYAMVSRAGLP 274

Query: 244 LQDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRC 303
           L+D+EFVQFHP+GIYG+GCLITEGARGEGG+LVNS+GERFMERYAP+AKDLASRDVVSR 
Sbjct: 275 LEDLEFVQFHPSGIYGSGCLITEGARGEGGFLVNSEGERFMERYAPTAKDLASRDVVSRA 334

Query: 304 MMMEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTV 363
           + MEI  GRGVG  KDH+ L L+HL P+VL+ERLPGISE+A IFAGVDVT++PIP++PTV
Sbjct: 335 ITMEINAGRGVGPHKDHMFLQLSHLPPSVLKERLPGISETAHIFAGVDVTKEPIPILPTV 394

Query: 364 HYNMGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGR 423
           HYNMGGIPT Y GEVL  N K  +   PGL A GEA CASVHGANRLG+NSL+DLVVFGR
Sbjct: 395 HYNMGGIPTKYTGEVLTQNEKGEDVVVPGLFACGEAACASVHGANRLGANSLLDLVVFGR 454

Query: 424 AAVIRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGV 483
           A      +     +P+P L        +   DRLR+ADG V TA LR +MQ++MQ    V
Sbjct: 455 AVSHTIRDKFSPGAPLPELPNDIGHESVANLDRLRNADGDVTTAELRLEMQKSMQKHVAV 514

Query: 484 FRTQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEAR 543
           FR Q +L +G   +S +  +   +K  DRS+IWNSDLVETLELQNL+  A  T  +A AR
Sbjct: 515 FREQKTLDEGVEQMSKIDAKFDRIKTTDRSMIWNSDLVETLELQNLLTCARQTATAAAAR 574

Query: 544 KESRGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSK 603
           KESRG+HAR+D+ +     RDD NWRKH+L W + +   +KL YR V    L    +   
Sbjct: 575 KESRGAHARDDYPE-----RDDENWRKHTLSWQEGHGKDVKLGYRAVIATTL-DEAECKP 628

Query: 604 IAPKARVY 611
           + P  RVY
Sbjct: 629 VPPAKRVY 636


>gi|255729146|ref|XP_002549498.1| succinate dehydrogenase flavoprotein subunit, mitochondrial
           precursor [Candida tropicalis MYA-3404]
 gi|240132567|gb|EER32124.1| succinate dehydrogenase flavoprotein subunit, mitochondrial
           precursor [Candida tropicalis MYA-3404]
          Length = 613

 Score =  740 bits (1910), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/567 (63%), Positives = 434/567 (76%), Gaps = 6/567 (1%)

Query: 7   LKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAAS 66
           +   Y  +DH YD VV+GAGGAGLRA  G+  +GFKTACI+K+FPTRSHTVAAQGGI A+
Sbjct: 43  MSQKYHVIDHEYDCVVLGAGGAGLRAAFGLVSEGFKTACISKLFPTRSHTVAAQGGINAA 102

Query: 67  LANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQ 126
           L NM PD W WH YDT+KGSDWLGD DAI Y+  EAP S+YELEHYGVPFSRNE G+IYQ
Sbjct: 103 LGNMHPDDWHWHFYDTVKGSDWLGDQDAIHYMTKEAPASIYELEHYGVPFSRNEEGRIYQ 162

Query: 127 RPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEG 186
           R FGG  + +G+G    RTCA ADRTGHA+LH+LYGQ+L+++  FFIE+F LDL++  +G
Sbjct: 163 RAFGGQSKEFGKGGQAYRTCAVADRTGHALLHSLYGQSLRHDCHFFIEFFGLDLMMK-DG 221

Query: 187 CCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQD 246
            C+GV+A+  E G +HRF A   V+ATGGYGRAYFS TSAHTCTGDG  MV+RAGLPL+D
Sbjct: 222 TCIGVIAYNQEDGTLHRFFANRTVIATGGYGRAYFSCTSAHTCTGDGYAMVSRAGLPLED 281

Query: 247 MEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMM 306
           +EFVQFHP+GIYG+GCLITEGARGEGG+L+NS+GERFMERYAPSAKDLASRDVVSR + M
Sbjct: 282 LEFVQFHPSGIYGSGCLITEGARGEGGFLINSEGERFMERYAPSAKDLASRDVVSRAITM 341

Query: 307 EIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYN 366
           EI EGRGVG  KDH++L L+H+  AVL+ERLPGISE+A IFAGVDVT++PIP++PTVHYN
Sbjct: 342 EINEGRGVGPEKDHMYLQLSHIPAAVLKERLPGISETAHIFAGVDVTKEPIPILPTVHYN 401

Query: 367 MGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAV 426
           MGGIPTN+ GEVL       +   PGL+A GE+ CASVHGANRLG+NSL+DLVVFGRA  
Sbjct: 402 MGGIPTNWQGEVLKKGPDGKDEVVPGLLACGESACASVHGANRLGANSLLDLVVFGRAVA 461

Query: 427 IRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRT 486
                 +   +PIP          +   D+LR+A G  PTA +R  MQ+ MQ    VFRT
Sbjct: 462 HTVKGNLKPGTPIPDHPKDIGYESIANLDKLRNASGSRPTADIRLDMQKTMQKGCAVFRT 521

Query: 487 QDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKES 546
           QD+L     +++ +     D+K  DRS+IWNSDLVETLELQNL+  A  T  SA ARKES
Sbjct: 522 QDTLDQCVEHIAEIDKSFEDVKTTDRSMIWNSDLVETLELQNLLTCATQTAVSAAARKES 581

Query: 547 RGSHAREDFKDGEFGGRDDVNWRKHSL 573
           RG+H+R+DF D     RDDVNWRKH+ 
Sbjct: 582 RGAHSRDDFPD-----RDDVNWRKHTF 603


>gi|195436412|ref|XP_002066162.1| GK22213 [Drosophila willistoni]
 gi|194162247|gb|EDW77148.1| GK22213 [Drosophila willistoni]
          Length = 661

 Score =  740 bits (1910), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/621 (60%), Positives = 450/621 (72%), Gaps = 15/621 (2%)

Query: 3   NSSNLKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGG 62
           N   +   Y  VDHS+D +VVGAGGAGLRA  G+  +GFKTA ITK+FPTRSHT+AAQGG
Sbjct: 44  NPDKISKQYPIVDHSFDAIVVGAGGAGLRAAFGLVAEGFKTAVITKLFPTRSHTIAAQGG 103

Query: 63  IAASLANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAG 122
           I A+L NM  D W+WH+YDT+KGSDWLGD DAI Y+  EAP++V ELE+YG+PFSR + G
Sbjct: 104 INAALGNMEEDDWKWHMYDTVKGSDWLGDQDAIHYMTREAPKAVIELENYGMPFSRTQDG 163

Query: 123 KIYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLII 182
           KIYQR FGG    +G+G    R CA ADRTGH++LHTLYGQ+L  +  +F+EYFALDLI 
Sbjct: 164 KIYQRAFGGQSLKFGKGGQAHRCCAVADRTGHSLLHTLYGQSLSYDCNYFVEYFALDLIF 223

Query: 183 NSEGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGL 242
             +G C GV+A  LE G +HRF A+  V+ATGGYGRA+FS TSAHTCTGDG  MVAR GL
Sbjct: 224 -EDGECRGVLALNLEDGTLHRFRAQNTVMATGGYGRAFFSCTSAHTCTGDGTAMVARQGL 282

Query: 243 PLQDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSR 302
           P QD+EFVQFHPTGIYGAGCLITEG RGEGGYL+NSKGERFMERYAP AKDLASRDVVSR
Sbjct: 283 PSQDLEFVQFHPTGIYGAGCLITEGCRGEGGYLINSKGERFMERYAPVAKDLASRDVVSR 342

Query: 303 CMMMEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPT 362
            M +EI EGRGVG  KDH++L L+HL P  L ERLPGISE+A IFAGVDVTR+PIPV+PT
Sbjct: 343 SMTIEIMEGRGVGPEKDHVYLQLHHLPPKQLAERLPGISETAMIFAGVDVTREPIPVLPT 402

Query: 363 VHYNMGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFG 422
           VHYNMGGIPTNY G+V+  +    +   PGL A GEA  +SVHGANRLG+NSL+DLVVFG
Sbjct: 403 VHYNMGGIPTNYRGQVITIDKDGKDVIVPGLYAAGEAASSSVHGANRLGANSLLDLVVFG 462

Query: 423 RAAVIRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAG 482
           RA     +E     +P P L  ++ +  +   D+LRHA+G + TA LR KMQ+ MQ  A 
Sbjct: 463 RACAKTIAEENKPGAPAPKLKDNAGEASVANLDKLRHANGQITTADLRLKMQKTMQGHAA 522

Query: 483 VFRTQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEA 542
           VFR    L  G   +  ++ E  D+KV D+SLIWNSDLVETLELQNL+ NA  T+  AEA
Sbjct: 523 VFRDGPILQKGVAKMQEVYKEFKDVKVVDKSLIWNSDLVETLELQNLLANAQMTIVGAEA 582

Query: 543 RKESRGSHAREDFK--------DGEFGGRDDV----NWRKHSLCWVDWNTGKIKLDYRPV 590
           RKESRG+HAREDFK             G++ V    +WRKH+L WV  + G ++LDYR V
Sbjct: 583 RKESRGAHAREDFKTRIDEYDYSKPLEGQEKVPVEKHWRKHTLSWVCNDNGDVQLDYRNV 642

Query: 591 HTELLCGGVDYSKIAPKARVY 611
               L   V  S + P  R Y
Sbjct: 643 IDTTLDNEV--STVPPAIRSY 661


>gi|225683272|gb|EEH21556.1| succinate dehydrogenase flavoprotein subunit [Paracoccidioides
           brasiliensis Pb03]
          Length = 647

 Score =  740 bits (1910), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/592 (63%), Positives = 439/592 (74%), Gaps = 6/592 (1%)

Query: 4   SSNLKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGI 63
           S  +  +Y  +DH YD VVVGAGGAGLRA  G+AE GF TACI+K+FPTRSHTVAAQGGI
Sbjct: 47  SPFVSKNYPVIDHEYDAVVVGAGGAGLRAAFGLAEAGFNTACISKLFPTRSHTVAAQGGI 106

Query: 64  AASLANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGK 123
            A+L NM  D W+WH+YDT+KGSDWLGD DAI Y+  EAPQSV ELE YG PFSR E GK
Sbjct: 107 NAALGNMHEDDWRWHMYDTVKGSDWLGDQDAIHYMTREAPQSVIELEGYGCPFSRTEDGK 166

Query: 124 IYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIIN 183
           IYQR FGG  Q YG+G    R CAAADRTGHA+LHTLYGQ+L++N  +FIEYFA+DL++ 
Sbjct: 167 IYQRAFGGQSQKYGKGGQAYRCCAAADRTGHALLHTLYGQSLRHNTNYFIEYFAMDLLME 226

Query: 184 SEGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLP 243
            +G C GV+A+  E G IHRF A   VLATGGYGRAYFS TSAHTCTGDG  MVARAGLP
Sbjct: 227 -DGECKGVIAYNQEDGTIHRFRAHNTVLATGGYGRAYFSCTSAHTCTGDGMAMVARAGLP 285

Query: 244 LQDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRC 303
            QD+EFVQFHPTGIYGAGCLITEG+RGEGGYL+NS+GERFMERYAP+AKDLASRDVVSR 
Sbjct: 286 NQDLEFVQFHPTGIYGAGCLITEGSRGEGGYLLNSEGERFMERYAPTAKDLASRDVVSRS 345

Query: 304 MMMEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTV 363
           M +EIREGRGVG  KDHI+L L+HL P +L ERLPGISE+A IFAGVDVT+ PIPV+PTV
Sbjct: 346 MTLEIREGRGVGPEKDHIYLQLSHLPPEILHERLPGISETASIFAGVDVTKQPIPVLPTV 405

Query: 364 HYNMGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGR 423
           HYNMGGIPT Y GEVL  + K  ++  PGL A GEA C SVHGANRLG+NSL+DL+VFGR
Sbjct: 406 HYNMGGIPTRYTGEVLTIDEKGRDKIVPGLYACGEAACVSVHGANRLGANSLLDLIVFGR 465

Query: 424 AAVIRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGV 483
           A      +      P   +   +    +   D++R ADG   TA +R  MQ+ MQ D  V
Sbjct: 466 AVSHTIRDKASPGQPHKEIGADAGAESIGILDKIRTADGSKSTAEIRNAMQKTMQTDVSV 525

Query: 484 FRTQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEAR 543
           FRTQ+SL +G R +  +     D+   DRS+IWNSDL+ETLEL+NL+  A  T  +A  R
Sbjct: 526 FRTQESLDEGVRKIKEVDQMFNDVSTKDRSMIWNSDLIETLELRNLLTCATQTAIAAANR 585

Query: 544 KESRGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELL 595
           KESRG+HAREDF +     RDD NW KH+L +     GK+ L YR V+   L
Sbjct: 586 KESRGAHAREDFPE-----RDDENWMKHTLTFQKEPHGKVDLTYRAVNANTL 632


>gi|226288251|gb|EEH43763.1| succinate dehydrogenase flavoprotein subunit [Paracoccidioides
           brasiliensis Pb18]
          Length = 647

 Score =  739 bits (1909), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/592 (63%), Positives = 439/592 (74%), Gaps = 6/592 (1%)

Query: 4   SSNLKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGI 63
           S  +  +Y  +DH YD VVVGAGGAGLRA  G+AE GF TACI+K+FPTRSHTVAAQGGI
Sbjct: 47  SPFVSKNYPVIDHEYDAVVVGAGGAGLRAAFGLAEAGFNTACISKLFPTRSHTVAAQGGI 106

Query: 64  AASLANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGK 123
            A+L NM  D W+WH+YDT+KGSDWLGD DAI Y+  EAPQSV ELE YG PFSR E GK
Sbjct: 107 NAALGNMHEDDWRWHMYDTVKGSDWLGDQDAIHYMTREAPQSVIELEGYGCPFSRTEDGK 166

Query: 124 IYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIIN 183
           IYQR FGG  Q YG+G    R CAAADRTGHA+LHTLYGQ+L++N  +FIEYFA+DL++ 
Sbjct: 167 IYQRAFGGQSQKYGKGGQAYRCCAAADRTGHALLHTLYGQSLRHNTNYFIEYFAMDLLME 226

Query: 184 SEGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLP 243
            +G C GV+A+  E G IHRF A   VLATGGYGRAYFS TSAHTCTGDG  MVARAGLP
Sbjct: 227 -DGECKGVIAYNQEDGTIHRFCAHNTVLATGGYGRAYFSCTSAHTCTGDGMAMVARAGLP 285

Query: 244 LQDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRC 303
            QD+EFVQFHPTGIYGAGCLITEG+RGEGGYL+NS+GERFMERYAP+AKDLASRDVVSR 
Sbjct: 286 NQDLEFVQFHPTGIYGAGCLITEGSRGEGGYLLNSEGERFMERYAPTAKDLASRDVVSRS 345

Query: 304 MMMEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTV 363
           M +EIREGRGVG  KDHI+L L+HL P +L ERLPGISE+A IFAGVDVT+ PIPV+PTV
Sbjct: 346 MTLEIREGRGVGPEKDHIYLQLSHLPPEILHERLPGISETASIFAGVDVTKQPIPVLPTV 405

Query: 364 HYNMGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGR 423
           HYNMGGIPT Y GEVL  + K  ++  PGL A GEA C SVHGANRLG+NSL+DL+VFGR
Sbjct: 406 HYNMGGIPTRYTGEVLTIDEKGRDKIVPGLYACGEAACVSVHGANRLGANSLLDLIVFGR 465

Query: 424 AAVIRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGV 483
           A      +      P   +   +    +   D++R ADG   TA +R  MQ+ MQ D  V
Sbjct: 466 AVSHTIRDKASPGQPHKEIGADAGAESIGILDKIRTADGSKSTAEIRNAMQKTMQTDVSV 525

Query: 484 FRTQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEAR 543
           FRTQ+SL +G R +  +     D+   DRS+IWNSDL+ETLEL+NL+  A  T  +A  R
Sbjct: 526 FRTQESLDEGVRKIKEVDQMFNDVSTKDRSMIWNSDLIETLELRNLLTCATQTAIAAANR 585

Query: 544 KESRGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELL 595
           KESRG+HAREDF +     RDD NW KH+L +     GK+ L YR V+   L
Sbjct: 586 KESRGAHAREDFPE-----RDDENWMKHTLTFQKEPHGKVDLTYRAVNANTL 632


>gi|156050553|ref|XP_001591238.1| conserved hypothetical protein [Sclerotinia sclerotiorum 1980]
 gi|154692264|gb|EDN92002.1| conserved hypothetical protein [Sclerotinia sclerotiorum 1980
           UF-70]
          Length = 647

 Score =  739 bits (1909), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 380/612 (62%), Positives = 448/612 (73%), Gaps = 15/612 (2%)

Query: 4   SSNLKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGI 63
           S  + + Y  VDH YD +V+GAGGAGLRA  G+AE GF TACI+K+FPTRSHTVAAQGGI
Sbjct: 47  SPFVSNKYPVVDHEYDAIVIGAGGAGLRAAFGLAEAGFNTACISKLFPTRSHTVAAQGGI 106

Query: 64  AASLANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGK 123
            A+L NM  D W+WH+YDT+KGSDWLGD DAI Y+  EAP SV ELE+YG PFSR + GK
Sbjct: 107 NAALGNMHEDDWRWHMYDTVKGSDWLGDQDAIHYMTREAPASVIELENYGCPFSRTDDGK 166

Query: 124 IYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIIN 183
           IYQR FGG  Q +G+G    R CAAADRTGHA+LHTLYGQ+L++N  +FIEYFALDLI+ 
Sbjct: 167 IYQRAFGGQSQKFGKGGQAYRCCAAADRTGHALLHTLYGQSLRHNTNYFIEYFALDLIME 226

Query: 184 SEGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLP 243
            +G C GV+A+  E G +HRF A   VLATGGYGRAYFS TSAHTCTGDG  MVARAGLP
Sbjct: 227 -DGECKGVIAYNQEDGTLHRFRAHNTVLATGGYGRAYFSCTSAHTCTGDGMAMVARAGLP 285

Query: 244 LQDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRC 303
            QD+EFVQFHPTGIYGAGCLITEGARGEGGYL+NS+GERFMERYAP+AKDLASRDVVSR 
Sbjct: 286 NQDLEFVQFHPTGIYGAGCLITEGARGEGGYLLNSEGERFMERYAPTAKDLASRDVVSRS 345

Query: 304 MMMEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTV 363
           M MEIREGRGVG  KDHI+L L+HL P VL ERLPGISE+A IF+GVDVT+ PIPV+PTV
Sbjct: 346 MTMEIREGRGVGPDKDHIYLQLSHLPPDVLHERLPGISETASIFSGVDVTKQPIPVLPTV 405

Query: 364 HYNMGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGR 423
           HYNMGGIPT Y GEVL  +++  ++  PGL A GEA C SVHGANRLG+NSL+DL+VFGR
Sbjct: 406 HYNMGGIPTKYTGEVLTVDAEGKDKVVPGLFACGEAACVSVHGANRLGANSLLDLIVFGR 465

Query: 424 AAVIRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGV 483
           A      +  +   P   +   +    +   D++R ADG   T  +R  MQ+ MQ D  V
Sbjct: 466 AVSHTIRDNFEPGMPHKEISADAGAESISVLDQIRTADGTKSTHEIRLAMQKTMQTDVSV 525

Query: 484 FRTQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEAR 543
           FRTQ+SL +G   ++ +     D+K  DRS+IWNSDLVETLEL+NL+  A+ T  +A AR
Sbjct: 526 FRTQESLDEGVTKINAVDQTFNDIKTQDRSMIWNSDLVETLELRNLLTCAVQTAEAAAAR 585

Query: 544 KESRGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPV--HT--ELLCGGV 599
           KESRG+HARED+ +     RDD  W KHSL +     GK  L YR V  HT  E  C  V
Sbjct: 586 KESRGAHAREDYPE-----RDDNEWMKHSLTFQKKPQGKTDLTYRAVVGHTLDENECKAV 640

Query: 600 DYSKIAPKARVY 611
                 P  RVY
Sbjct: 641 -----PPFKRVY 647


>gi|50422145|ref|XP_459635.1| DEHA2E07458p [Debaryomyces hansenii CBS767]
 gi|49655303|emb|CAG87865.1| DEHA2E07458p [Debaryomyces hansenii]
          Length = 643

 Score =  739 bits (1907), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/611 (60%), Positives = 454/611 (74%), Gaps = 7/611 (1%)

Query: 1   MKNSSNLKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQ 60
           +  +  +   Y  +DH YD VVVGAGGAGLRA  G+AE GFKTACI+K+FPTRSHTVAAQ
Sbjct: 40  LNTAKYMGKQYHVIDHEYDCVVVGAGGAGLRAAFGLAEAGFKTACISKLFPTRSHTVAAQ 99

Query: 61  GGIAASLANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNE 120
           GGI A+L NM  D W WH+YDT+KGSDWLGD DAI Y+  EAP S+YELE+YGVPFSRN+
Sbjct: 100 GGINAALGNMHKDDWHWHMYDTVKGSDWLGDQDAIHYMTREAPDSIYELENYGVPFSRND 159

Query: 121 AGKIYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDL 180
            G+IYQR FGG  + +G+G    RTCA ADRTGHA+LH+LYGQAL++N  FFIE+ A+DL
Sbjct: 160 EGRIYQRAFGGQSKEFGKGGQAYRTCAVADRTGHALLHSLYGQALRHNTHFFIEFMAMDL 219

Query: 181 IINSEGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARA 240
           ++  +G CVGV+A+  E G +HRF +   ++ATGGYGRAYFS TSAHTCTGDG  MV+RA
Sbjct: 220 LMQ-DGECVGVMAYNQEDGTLHRFRSHKTIMATGGYGRAYFSCTSAHTCTGDGYAMVSRA 278

Query: 241 GLPLQDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVV 300
           GLPL+DMEF+QFHP+GIYG+GCLITEGARGEGG+LVNS+GERFMERYAP+AKDLA RDVV
Sbjct: 279 GLPLEDMEFIQFHPSGIYGSGCLITEGARGEGGFLVNSEGERFMERYAPTAKDLACRDVV 338

Query: 301 SRCMMMEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVI 360
           SR + MEI EGRGVG  KDH+HL L+HL P+VL+ERLPGISE+A IFAGVDVT++PIPV+
Sbjct: 339 SRAITMEINEGRGVGPEKDHMHLQLSHLPPSVLKERLPGISETAHIFAGVDVTKEPIPVL 398

Query: 361 PTVHYNMGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVV 420
           PTVHYNMGGIPT Y GEV+       ++  PGL+A GE  CASVHGANRLG+NSL+DLVV
Sbjct: 399 PTVHYNMGGIPTKYNGEVITKGPNGEDKVVPGLLACGEVACASVHGANRLGANSLLDLVV 458

Query: 421 FGRAAVIRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLD 480
           FGRA      + +   +P+P L   S    ++  D+LR ADG   TA +R +MQ+ MQ  
Sbjct: 459 FGRAVSHTIRDSLTPGTPLPPLAADSGKESIENLDKLRTADGSKSTAQIRLEMQKTMQKG 518

Query: 481 AGVFRTQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSA 540
             VFRTQ++L +   ++  +    +D+   DRS+IWNSDLVETLELQNL+  A  T  SA
Sbjct: 519 CAVFRTQETLDECIEHIGQVDKTFSDVGTTDRSMIWNSDLVETLELQNLLTCATQTAASA 578

Query: 541 EARKESRGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVD 600
            ARKESRG+HARED+ D     RDDVNW KH+L +       +KLDYR V  +      +
Sbjct: 579 AARKESRGAHAREDYPD-----RDDVNWWKHTLSYQTNFGDDVKLDYRDV-IQTTLDESE 632

Query: 601 YSKIAPKARVY 611
              + P  R Y
Sbjct: 633 CKPVPPTVRAY 643


>gi|316976249|gb|EFV59576.1| succinate dehydrogenase, flavoprotein subunit [Trichinella
           spiralis]
          Length = 765

 Score =  738 bits (1906), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/599 (60%), Positives = 450/599 (75%), Gaps = 13/599 (2%)

Query: 4   SSNLKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGI 63
           S    S Y  VDH+YD V+VGAGGAGLRA +G+ E GFKTA +TK+FPTRSHTVAAQGG+
Sbjct: 29  SRRFVSGYEIVDHTYDAVIVGAGGAGLRAAMGLVEAGFKTAVVTKLFPTRSHTVAAQGGV 88

Query: 64  AASLANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGK 123
            A+L NM PD W+WH YDT+KGSDWLGD DAI Y+  EAP++V ELE+YG+PFSR + GK
Sbjct: 89  NAALGNMEPDDWRWHFYDTVKGSDWLGDQDAIHYMCREAPRAVLELENYGMPFSRTKEGK 148

Query: 124 IYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIIN 183
           IYQR FGG   +YG G    RTC  ADRTGH++LHTLYG+ L  + ++FIEY ALDL++N
Sbjct: 149 IYQRAFGGQSLDYGRGGQAHRTCCVADRTGHSMLHTLYGRTLAYDCKYFIEYLALDLLMN 208

Query: 184 SEGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLP 243
            +  CVGV+AW LE G++HRF +   +LATGGYGRAYFS TSAHTCTGDG  MV+RAGLP
Sbjct: 209 -KNRCVGVIAWNLEDGKLHRFHSNNTILATGGYGRAYFSCTSAHTCTGDGTAMVSRAGLP 267

Query: 244 LQDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRC 303
             DMEFVQFHPTGIYGAGCLITEG RGEGGYL+NSKGERFMERYAP+AKDLASRDVVSR 
Sbjct: 268 NADMEFVQFHPTGIYGAGCLITEGVRGEGGYLINSKGERFMERYAPNAKDLASRDVVSRA 327

Query: 304 MMMEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTV 363
           M +EIREGRGVG  KDHI+L L+HL   ++ +RLPGI+E+A IFAGVD T++PIPV+PTV
Sbjct: 328 MAIEIREGRGVGAQKDHIYLQLHHLPANLIHDRLPGIAETAHIFAGVDCTKEPIPVLPTV 387

Query: 364 HYNMGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGR 423
           HYNMGGIPTN+  +VL     + ++   GL A GE    SVHGANRLG+NSL+DLV+FGR
Sbjct: 388 HYNMGGIPTNHTAQVLTFKPGSGDQIIQGLYAAGETAAHSVHGANRLGANSLLDLVIFGR 447

Query: 424 AAVIRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGV 483
           A  +  ++        P L  ++ +R +   D+LR A+G +  A LR KMQ+ MQ  A V
Sbjct: 448 ACALTIAKTCKPGEKFPDLPANAGERSVANLDKLRQANGTITVADLRLKMQKTMQEHASV 507

Query: 484 FRTQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEAR 543
           FRT + L +GC+ +  ++ ++ ++K+ DR LIWN+DLVE +ELQNLM+NA+ T+  AEAR
Sbjct: 508 FRTGEVLQEGCKKMEGIYKQLENVKLSDRGLIWNTDLVEAIELQNLMLNAVQTINCAEAR 567

Query: 544 KESRGSHAREDFK------------DGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPV 590
           KESRG+HAREDFK            DG+     + +WRKHS+ W+D  TG+ +++YRPV
Sbjct: 568 KESRGAHAREDFKQRIDEFDYSKPLDGQTKLPFEKHWRKHSMVWMDEVTGRTRIEYRPV 626


>gi|169866615|ref|XP_001839894.1| succinate dehydrogenase flavoprotein subunit [Coprinopsis cinerea
           okayama7#130]
 gi|116498978|gb|EAU81873.1| succinate dehydrogenase flavoprotein subunit [Coprinopsis cinerea
           okayama7#130]
          Length = 638

 Score =  738 bits (1906), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/602 (62%), Positives = 453/602 (75%), Gaps = 8/602 (1%)

Query: 11  YTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLANM 70
           Y  ++H YD VVVGAGGAGLRA  G+AE GFKTACITK+FPTRSHTVAAQGGI A+L NM
Sbjct: 44  YPLIEHEYDAVVVGAGGAGLRAAFGLAEAGFKTACITKLFPTRSHTVAAQGGINAALGNM 103

Query: 71  TPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRPFG 130
           T D W+WH+YDT+KGSDWLGD DAI Y+  EAP +V ELEH+GVPFSR + GKIYQR FG
Sbjct: 104 TEDDWRWHMYDTVKGSDWLGDQDAIHYMCREAPNTVIELEHFGVPFSRTKEGKIYQRAFG 163

Query: 131 GHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCCVG 190
           G    +G+G    R  AAADRTGHAILHTLYGQ+L+++  FFIEYFALDLI+  +G CVG
Sbjct: 164 GQSLKFGKGGQAYRCAAAADRTGHAILHTLYGQSLRHDTNFFIEYFALDLIMQ-DGECVG 222

Query: 191 VVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDMEFV 250
           V+A  +E G +HRF A   VLATGGYGRAYFS TSAHTC+GDG  MVARAGLP QD+EFV
Sbjct: 223 VIALNMEDGTLHRFRAHKTVLATGGYGRAYFSCTSAHTCSGDGNAMVARAGLPQQDLEFV 282

Query: 251 QFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEIRE 310
           QFHPTGIYGAGCLITEG+RGEGGYL+NS+GERFMERYAP+AKDLASRDVVSR M +EIRE
Sbjct: 283 QFHPTGIYGAGCLITEGSRGEGGYLLNSEGERFMERYAPTAKDLASRDVVSRSMTIEIRE 342

Query: 311 GRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMGGI 370
           GRGVG  KDHI+L L+HL P +L ERLPGISE+A IFAGVDVT++PIPV+PTVHYNMGGI
Sbjct: 343 GRGVGPEKDHIYLQLSHLPPDILHERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGI 402

Query: 371 PTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIRAS 430
           PT Y GEV+  +    ++  PGL A GEA   SVHGANRLG+NSL+D+VVFGRA      
Sbjct: 403 PTRYTGEVITVDENGNDKVVPGLYAAGEAASVSVHGANRLGANSLLDIVVFGRAVAHHIR 462

Query: 431 EMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQDSL 490
           +      P  ++   S    ++  D++R ADG  PTA +R  +Q+AMQ DA VFRTQ+SL
Sbjct: 463 DTWTPGKPHKTIPEESGLESIEFLDKIRRADGPEPTAKIRLDLQKAMQADAAVFRTQESL 522

Query: 491 SDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRGSH 550
            +G   +  +++   ++ + DRS+IWNSDLVETLEL+NL+  AI T+ SA ARKESRG+H
Sbjct: 523 DEGVEKVREIYNNFKNVGIKDRSMIWNSDLVETLELRNLLQCAIQTIVSAAARKESRGAH 582

Query: 551 AREDFKDGEFGGRDDVNWRKHSLCWV-DWNTGKIKLDYRPVHTELLCGGVDYSKIAPKAR 609
           ARED+ +     RDD NW KH+L +  D  +  +KL YR V  E      +   + P  R
Sbjct: 583 AREDYPE-----RDDENWMKHTLSYQPDVESPDVKLAYRRV-IETTLDENECKPVPPFKR 636

Query: 610 VY 611
           VY
Sbjct: 637 VY 638


>gi|58270950|ref|XP_572631.1| succinate dehydrogenase flavoprotein subunit precursor
           [Cryptococcus neoformans var. neoformans JEC21]
 gi|134115126|ref|XP_773861.1| hypothetical protein CNBH3130 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|50256489|gb|EAL19214.1| hypothetical protein CNBH3130 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|57228890|gb|AAW45324.1| succinate dehydrogenase flavoprotein subunit precursor, putative
           [Cryptococcus neoformans var. neoformans JEC21]
          Length = 637

 Score =  738 bits (1906), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/605 (61%), Positives = 451/605 (74%), Gaps = 8/605 (1%)

Query: 8   KSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASL 67
           K  Y  +DH +D VVVGAGGAGLRA  G+AE G KTACITK+FPTRSHTVAAQGG+ A+L
Sbjct: 40  KKGYPIIDHEFDAVVVGAGGAGLRAAFGLAEGGLKTACITKLFPTRSHTVAAQGGVNAAL 99

Query: 68  ANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQR 127
            NMT D W+WH+YDT+KGSDWLGD DAI Y+  EAP +V ELEHYGVPFSR + GKIYQR
Sbjct: 100 GNMTEDDWRWHMYDTVKGSDWLGDQDAIHYMCREAPHTVIELEHYGVPFSRTKEGKIYQR 159

Query: 128 PFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGC 187
            FGG    YG+G    R  AAADRTGHAILHTLYGQ+L++N  FFIEYFALDL++  +G 
Sbjct: 160 AFGGQSLKYGKGGQAYRCAAAADRTGHAILHTLYGQSLRHNTNFFIEYFALDLLMQ-DGE 218

Query: 188 CVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDM 247
           CVGV+A  +E G +HRF +   VLATGGYGRAYFS TSAHTC+GDG  M  RAGLPLQD+
Sbjct: 219 CVGVLAINMEDGTLHRFRSHKTVLATGGYGRAYFSCTSAHTCSGDGNAMAVRAGLPLQDL 278

Query: 248 EFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMME 307
           EFVQFHPTGIYGAGCLITEG+RGEGGYLVNS+GERFMERYAP+AKDLASRDVVSR M +E
Sbjct: 279 EFVQFHPTGIYGAGCLITEGSRGEGGYLVNSEGERFMERYAPTAKDLASRDVVSRSMTLE 338

Query: 308 IREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNM 367
           IREGRGVG  KDHI L L+HL   VL ERLPGISE+A IFAGVDVT++PIPV+PTVHYNM
Sbjct: 339 IREGRGVGPEKDHIFLQLSHLPAEVLHERLPGISETAAIFAGVDVTKEPIPVLPTVHYNM 398

Query: 368 GGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVI 427
           GGIPT Y GEVL  + +  ++  PGL A GEA C SVHGANRLG+NSL+D+VVFGRA   
Sbjct: 399 GGIPTKYTGEVLTIDEQGNDKVVPGLYAAGEAACVSVHGANRLGANSLLDIVVFGRACAN 458

Query: 428 RASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQ 487
              E +  ++P   ++       ++  D++R+A G +PT+ +R  MQ+ MQ DA VFRTQ
Sbjct: 459 HIKETLAPNTPHKPMNPELGKESIEDLDKIRNASGPLPTSQIRLNMQKTMQTDAAVFRTQ 518

Query: 488 DSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESR 547
            SL +G   +  ++     + + DRS+IWNSDL+ETLEL+N+M NA+ TV SA ARKESR
Sbjct: 519 QSLDEGVAKMREVYKSYDQVGIKDRSMIWNSDLIETLELRNIMQNAMQTVVSAAARKESR 578

Query: 548 GSHAREDFKDGEFGGRDDVNWRKHSLCWV-DWNTGKIKLDYRPVHTELLCGGVDYSKIAP 606
           G+HARED+ +     R+D  W KH+L +  D N+  ++L YR V    L    +   + P
Sbjct: 579 GAHAREDYPE-----RNDEEWMKHTLSFQHDPNSPDVELKYRGVIANTL-DEAECKPVPP 632

Query: 607 KARVY 611
             R Y
Sbjct: 633 FKRTY 637


>gi|154308745|ref|XP_001553708.1| conserved hypothetical protein [Botryotinia fuckeliana B05.10]
 gi|150852746|gb|EDN27938.1| conserved hypothetical protein [Botryotinia fuckeliana B05.10]
          Length = 662

 Score =  738 bits (1906), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/587 (63%), Positives = 439/587 (74%), Gaps = 6/587 (1%)

Query: 4   SSNLKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGI 63
           S  + + Y  VDH YD +V+GAGGAGLRA  G+AE GF TACI+K+FPTRSHTVAAQGGI
Sbjct: 47  SPFVSNKYPVVDHEYDAIVIGAGGAGLRAAFGLAEAGFNTACISKLFPTRSHTVAAQGGI 106

Query: 64  AASLANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGK 123
            A+L NM  D W+WH+YDT+KGSDWLGD DAI Y+  EAP SV ELE+YG PFSR + GK
Sbjct: 107 NAALGNMHEDDWRWHMYDTVKGSDWLGDQDAIHYMTREAPASVIELENYGCPFSRTDDGK 166

Query: 124 IYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIIN 183
           IYQR FGG  Q +G+G    R CAAADRTGHA+LHTLYGQ+L++N  +FIEYFALDLI+ 
Sbjct: 167 IYQRAFGGQSQKFGKGGQAYRCCAAADRTGHALLHTLYGQSLRHNTNYFIEYFALDLIME 226

Query: 184 SEGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLP 243
            +G C GV+A+  E G +HRF A   VLATGGYGRAYFS TSAHTCTGDG  MVARAGLP
Sbjct: 227 -DGECKGVIAYNQEDGTLHRFRAHNTVLATGGYGRAYFSCTSAHTCTGDGMAMVARAGLP 285

Query: 244 LQDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRC 303
            QD+EFVQFHPTGIYGAGCLITEGARGEGGYL+NS+GERFMERYAP+AKDLASRDVVSR 
Sbjct: 286 NQDLEFVQFHPTGIYGAGCLITEGARGEGGYLLNSQGERFMERYAPTAKDLASRDVVSRS 345

Query: 304 MMMEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTV 363
           M MEIR+GRGVG  KDHI+L L+HL P VL ERLPGISE+A IF+GVDVT+ PIPV+PTV
Sbjct: 346 MTMEIRDGRGVGPDKDHIYLQLSHLPPDVLHERLPGISETASIFSGVDVTKQPIPVLPTV 405

Query: 364 HYNMGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGR 423
           HYNMGGIPT Y GEVL  +++  ++  PGL A GEA C SVHGANRLG+NSL+DL+VFGR
Sbjct: 406 HYNMGGIPTKYTGEVLTVDAEGKDQVVPGLFACGEAACVSVHGANRLGANSLLDLIVFGR 465

Query: 424 AAVIRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGV 483
           A      +  +   P   +   +    +   D++R ADG   T  +R  MQ+ MQ D  V
Sbjct: 466 AVSHTIRDNFEPGMPHKEISADAGAESISVLDQIRTADGTKSTHDVRLAMQKTMQTDVSV 525

Query: 484 FRTQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEAR 543
           FRTQ+SL +G   ++ +     D+K  DRS+IWNSDLVETLEL+NL+  A+ T  +A AR
Sbjct: 526 FRTQESLDEGVTKINAVDQTFKDIKTQDRSMIWNSDLVETLELRNLLTCAVQTAEAAAAR 585

Query: 544 KESRGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPV 590
           KESRG+HARED+ +     RDD  W KHSL +     GK  L YR V
Sbjct: 586 KESRGAHAREDYPE-----RDDKEWMKHSLTFQKKPQGKTDLTYRAV 627


>gi|241955062|ref|XP_002420252.1| flavoprotein subunit of succinate dehydrogenase, putative [Candida
           dubliniensis CD36]
 gi|223643593|emb|CAX42475.1| flavoprotein subunit of succinate dehydrogenase, putative [Candida
           dubliniensis CD36]
          Length = 641

 Score =  738 bits (1906), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/605 (61%), Positives = 455/605 (75%), Gaps = 7/605 (1%)

Query: 7   LKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAAS 66
           +   Y  VDH YD VVVGAGGAGLRA  G+  +GFKTAC++K+FPTRSHTVAAQGGI A+
Sbjct: 44  MSQKYHVVDHEYDCVVVGAGGAGLRAAFGLVSEGFKTACVSKLFPTRSHTVAAQGGINAA 103

Query: 67  LANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQ 126
           L NM PD W WH YDT+KGSDWLGD DAI Y+  EAP S+YELEHYGVPFSRN+ G+IYQ
Sbjct: 104 LGNMHPDDWHWHFYDTVKGSDWLGDQDAIHYMTKEAPASIYELEHYGVPFSRNDEGRIYQ 163

Query: 127 RPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEG 186
           R FGG  + +G+G    RTCA ADRTGHA+LH+LYGQ+L+++  FFIE+FA+DL++  +G
Sbjct: 164 RAFGGQSKEFGKGGQAYRTCAVADRTGHALLHSLYGQSLRHDCHFFIEFFAMDLMMK-DG 222

Query: 187 CCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQD 246
            C+G++A+  E G +HRF A   ++ATGGYGRAYFS TSAHTCTGDG  MV+RAGLPL+D
Sbjct: 223 ACIGIIAYNEEDGTLHRFFANRTIMATGGYGRAYFSCTSAHTCTGDGYAMVSRAGLPLED 282

Query: 247 MEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMM 306
           +EFVQFHP+GIYG+GCLITEGARGEGG+LVNS+GERFMERYAPSAKDLASRDVVSR + M
Sbjct: 283 LEFVQFHPSGIYGSGCLITEGARGEGGFLVNSEGERFMERYAPSAKDLASRDVVSRAITM 342

Query: 307 EIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYN 366
           EI EGRGVG  KDH++L L+H+   VL+ERLPGISE+A IFAGVDVT++PIP++PTVHYN
Sbjct: 343 EINEGRGVGPEKDHMYLQLSHIPAPVLKERLPGISETAHIFAGVDVTKEPIPILPTVHYN 402

Query: 367 MGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAV 426
           MGGIPTN+ GEVL  ++   +   PGL+A GEA CASVHGANRLG+NSL+DLVVFGRA  
Sbjct: 403 MGGIPTNWKGEVLKKSADGNDEVVPGLLACGEAACASVHGANRLGANSLLDLVVFGRAVA 462

Query: 427 IRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRT 486
               + +   +PIP          +   D+LR+A+G  PTA +R +MQ+ MQ    VFRT
Sbjct: 463 HTIRDNLQPGTPIPDHAKDIGYESIANLDKLRNANGSKPTADIRLEMQKTMQKGCAVFRT 522

Query: 487 QDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKES 546
           Q++L     ++  +     D+K  DRS+IWNSDLVETLELQNL+  A  T  SA AR ES
Sbjct: 523 QETLDQCVEHIGEVDKSFEDVKTTDRSMIWNSDLVETLELQNLLTCATQTAASAAARTES 582

Query: 547 RGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAP 606
           RG+H+R+DF D     RDDVNWRKH+L + +   G ++LDYR V    L    D   + P
Sbjct: 583 RGAHSRDDFPD-----RDDVNWRKHTLSYQETVGGPVRLDYRDVVKTTLDEN-DCKPVPP 636

Query: 607 KARVY 611
             RVY
Sbjct: 637 AKRVY 641


>gi|149234605|ref|XP_001523182.1| succinate dehydrogenase flavoprotein subunit, mitochondrial
           precursor [Lodderomyces elongisporus NRRL YB-4239]
 gi|146453291|gb|EDK47547.1| succinate dehydrogenase flavoprotein subunit, mitochondrial
           precursor [Lodderomyces elongisporus NRRL YB-4239]
          Length = 640

 Score =  738 bits (1906), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/605 (61%), Positives = 456/605 (75%), Gaps = 7/605 (1%)

Query: 7   LKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAAS 66
           +   Y  VDH YD +VVGAGGAGLRA  G+A +G+KTAC++K+FPTRSHTVAAQGGI A+
Sbjct: 43  MGQKYHVVDHEYDCLVVGAGGAGLRAAFGLASEGYKTACVSKLFPTRSHTVAAQGGINAA 102

Query: 67  LANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQ 126
           L NM  D W WH YDT+KGSDWLGD DAI Y+  EAP S+YELE+YGVPFSRNE G+IYQ
Sbjct: 103 LGNMHKDDWHWHFYDTVKGSDWLGDQDAIHYMTKEAPASIYELENYGVPFSRNEEGRIYQ 162

Query: 127 RPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEG 186
           R FGG  + +G+G    RTCA ADRTGHA+LH+LYGQ+L+++  FFIE+FA+DL++  +G
Sbjct: 163 RAFGGQSKEFGKGGQAYRTCAVADRTGHALLHSLYGQSLRHDCHFFIEFFAMDLMMQ-DG 221

Query: 187 CCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQD 246
            C+G+VA+  E G +HRF A   V+ATGGYGRAYFS TSAHTCTGDG  MV+RAGLPL+D
Sbjct: 222 ACIGIVAYNEEDGTLHRFFANRTVIATGGYGRAYFSCTSAHTCTGDGYAMVSRAGLPLED 281

Query: 247 MEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMM 306
           +EFVQFHP+GIYG+GCLITEGARGEGG+LVNS+GERFMERYAPSAKDLASRDVVSR + M
Sbjct: 282 LEFVQFHPSGIYGSGCLITEGARGEGGFLVNSEGERFMERYAPSAKDLASRDVVSRAITM 341

Query: 307 EIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYN 366
           EI EGRGVG  KDH++L L+H+  AVL+ERLPGISE+A IFAGVDVT++PIP++PTVHYN
Sbjct: 342 EINEGRGVGPEKDHMYLQLSHIPAAVLKERLPGISETAHIFAGVDVTKEPIPILPTVHYN 401

Query: 367 MGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAV 426
           MGGIPTN+ GEVL  N+   +   PGL+A GEA CASVHGANRLG+NSL+DLVVFGRA  
Sbjct: 402 MGGIPTNWQGEVLKKNADGQDEVVPGLLACGEAACASVHGANRLGANSLLDLVVFGRAVS 461

Query: 427 IRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRT 486
              +  +    PIP  +       +   D+LR+A+G   TA +R  MQ+ MQ    VFRT
Sbjct: 462 HTIAGNLKPGQPIPQHEKDIGYESIANLDKLRNANGTKSTADIRLDMQKTMQKGCAVFRT 521

Query: 487 QDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKES 546
           Q++L     ++  +  + A++K  DRS+IWNSDLVETLELQNL+  A  T  SA ARKES
Sbjct: 522 QETLDQCVEHIGQVDADFANVKTTDRSMIWNSDLVETLELQNLLTCATQTAASAAARKES 581

Query: 547 RGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAP 606
           RG+HAR+D+ D     RDDVNWRKH+L + D     ++LDYR V    L    D   + P
Sbjct: 582 RGAHARDDYPD-----RDDVNWRKHTLSYQDGFGAPVRLDYRDVVKHTLDDN-DCKPVPP 635

Query: 607 KARVY 611
             RVY
Sbjct: 636 AKRVY 640


>gi|170039586|ref|XP_001847611.1| succinate dehydrogenase flavoprotein subunit, mitochondrial [Culex
           quinquefasciatus]
 gi|167863129|gb|EDS26512.1| succinate dehydrogenase flavoprotein subunit, mitochondrial [Culex
           quinquefasciatus]
          Length = 661

 Score =  738 bits (1905), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/621 (59%), Positives = 458/621 (73%), Gaps = 15/621 (2%)

Query: 3   NSSNLKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGG 62
           N+  +   Y  VDH+YD VVVGAGGAGLRA  G+  +GFKTA ITK+FPTRSHTVAAQGG
Sbjct: 44  NADAISKEYPVVDHTYDAVVVGAGGAGLRAAFGLVAEGFKTAVITKLFPTRSHTVAAQGG 103

Query: 63  IAASLANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAG 122
           I A+L NM  D W+WH+YDT+KGSDWLGD DAI Y+  EAP++V ELE+YG+PFSR   G
Sbjct: 104 INAALGNMEEDDWKWHMYDTVKGSDWLGDQDAIHYMTREAPKAVIELENYGMPFSRTPDG 163

Query: 123 KIYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLII 182
           KIYQR FGG    +G+G    R C  ADRTGH++LHTLYGQ+L  +  +FIEYFA+DL++
Sbjct: 164 KIYQRAFGGQSLKFGKGGQAHRCCCVADRTGHSLLHTLYGQSLSYDCNYFIEYFAMDLLM 223

Query: 183 NSEGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGL 242
            + G CVGV+A  LE G IHRF +K  VLATGGYGRAYFS TSAHTCTGDG  MVARAGL
Sbjct: 224 EN-GQCVGVIALNLEDGSIHRFRSKNTVLATGGYGRAYFSCTSAHTCTGDGTAMVARAGL 282

Query: 243 PLQDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSR 302
           P +D+EFVQFHPTGIYGAGCLITEG RGEGGYL+NS+GERFMERYAP AKDLASRDVVSR
Sbjct: 283 PSEDLEFVQFHPTGIYGAGCLITEGCRGEGGYLINSQGERFMERYAPVAKDLASRDVVSR 342

Query: 303 CMMMEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPT 362
            M +EIREGRG G  KDH++L L+HL P  L +RLPGISE+A IFAGVDVTR+PIPV+PT
Sbjct: 343 SMTIEIREGRGCGPEKDHVYLQLHHLPPEQLAQRLPGISETAMIFAGVDVTREPIPVLPT 402

Query: 363 VHYNMGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFG 422
           VHYNMGG+PTNY G+VL  ++   +   PGL A GE+ C+SVHGANRLG+NSL+DLVVFG
Sbjct: 403 VHYNMGGVPTNYKGQVLTVDASGNDHVVPGLYACGESACSSVHGANRLGANSLLDLVVFG 462

Query: 423 RAAVIRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAG 482
           RA     +        I  +  ++ +  +   D +R+A+G +PT+ LR  MQ+ MQ  A 
Sbjct: 463 RACAKTIAAEHRPGEKIADIKSNAGEESVANLDWVRNANGAIPTSELRLNMQKTMQTHAA 522

Query: 483 VFRTQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEA 542
           VFR + +L +G R +  ++  + D+KV DRSL+WNSDLVETLELQNL++NA  T+ +AE 
Sbjct: 523 VFREEKTLQEGVRKMGEIYKTIKDVKVSDRSLVWNSDLVETLELQNLLLNANMTITAAEN 582

Query: 543 RKESRGSHAREDFK------------DGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPV 590
           RKESRG+HARED+K            +G+     + +WRKH+L W+D  TG +K+DYRPV
Sbjct: 583 RKESRGAHAREDYKTRVDEYDYSKPLEGQQKKPVEEHWRKHTLTWIDPATGAVKIDYRPV 642

Query: 591 HTELLCGGVDYSKIAPKARVY 611
             + L    + + + P  R Y
Sbjct: 643 IDQTL--SEECNTVPPAIRSY 661


>gi|119195929|ref|XP_001248568.1| succinate dehydrogenase [ubiquinone] flavoprotein subunit,
           mitochondrial precursor [Coccidioides immitis RS]
          Length = 647

 Score =  738 bits (1905), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/608 (62%), Positives = 445/608 (73%), Gaps = 7/608 (1%)

Query: 4   SSNLKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGI 63
           S  L   Y  +DH YD VVVGAGGAGLRA  G+AE GF TAC+TK+FPTRSHTVAAQGGI
Sbjct: 47  SPFLTKKYPVIDHEYDAVVVGAGGAGLRAAFGLAEAGFNTACVTKLFPTRSHTVAAQGGI 106

Query: 64  AASLANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGK 123
            A+L NM  D W+WH+YDT+KGSDWLGD DAI Y+  EAPQSV ELE YG PFSR E GK
Sbjct: 107 NAALGNMHEDDWRWHMYDTVKGSDWLGDQDAIHYMTREAPQSVIELEGYGCPFSRTEDGK 166

Query: 124 IYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIIN 183
           IYQR FGG  + +G+G    R CAAADRTGHA+LHTLYGQ+L+ NA +FIEYFALDL++ 
Sbjct: 167 IYQRAFGGQSKEFGKGGQAYRCCAAADRTGHALLHTLYGQSLRYNASYFIEYFALDLLME 226

Query: 184 SEGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLP 243
           + G C G++A+  E G +HRF A   VLATGGYGRAYFS TSAHTCTGDG  MVARAGLP
Sbjct: 227 N-GECKGILAYNQEDGTLHRFKAHHTVLATGGYGRAYFSCTSAHTCTGDGMAMVARAGLP 285

Query: 244 LQDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRC 303
            QD+EFVQFHPTGIYGAGCLITEGARGEGGYL+NS GERFMERYA +AKDLASRDVVSR 
Sbjct: 286 NQDLEFVQFHPTGIYGAGCLITEGARGEGGYLLNSNGERFMERYASTAKDLASRDVVSRS 345

Query: 304 MMMEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTV 363
           M +EIREGRGVG  KDHI+L L+HL P +L ERLPGISE+A IFAGVDVT+ PIPV+PTV
Sbjct: 346 MTLEIREGRGVGPEKDHIYLQLSHLPPEILHERLPGISETASIFAGVDVTKQPIPVLPTV 405

Query: 364 HYNMGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGR 423
           HYNMGGIPT Y GEVL  + K  ++  PGL A GEA C SVHGANRLG+NSL+DL+VFGR
Sbjct: 406 HYNMGGIPTRYTGEVLTIDEKGNDKIVPGLYACGEAACVSVHGANRLGANSLLDLIVFGR 465

Query: 424 AAVIRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGV 483
           A      +    ++P   +   +    ++  D++R ADG   T  +R  MQ+ MQ D  V
Sbjct: 466 AVSHTIRDNATPNTPHKEISADAGAESIEVLDKIRTADGPKSTFDIRNAMQKTMQTDVSV 525

Query: 484 FRTQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEAR 543
           FRTQ+SL +G R ++ +    A +   DRS+IWNSDLVETLEL+NL+  A  T  +A  R
Sbjct: 526 FRTQESLDEGVRKINEVDQMFAQVGTKDRSMIWNSDLVETLELRNLLTCATQTAVAAANR 585

Query: 544 KESRGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSK 603
           KESRG+HARED+ D     RDD NW KH+L +     GK+ L YR V T+      +   
Sbjct: 586 KESRGAHAREDYPD-----RDDANWMKHTLTFQKEPHGKVDLTYRAV-TQTTLDESECKP 639

Query: 604 IAPKARVY 611
           + P  RVY
Sbjct: 640 VPPFKRVY 647


>gi|170089319|ref|XP_001875882.1| predicted protein [Laccaria bicolor S238N-H82]
 gi|164649142|gb|EDR13384.1| predicted protein [Laccaria bicolor S238N-H82]
          Length = 639

 Score =  738 bits (1905), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/602 (62%), Positives = 450/602 (74%), Gaps = 8/602 (1%)

Query: 11  YTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLANM 70
           Y  ++H +D VVVGAGGAGLRA  G+AE GFKTACITK+FPTRSHTVAAQGGI A+L NM
Sbjct: 45  YPLIEHEFDAVVVGAGGAGLRAAFGLAEAGFKTACITKLFPTRSHTVAAQGGINAALGNM 104

Query: 71  TPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRPFG 130
           T D W+WH+YDT+KGSDWLGD DAI Y+  EAP +V ELEHYGVPFSR   GKIYQR FG
Sbjct: 105 TEDDWRWHMYDTVKGSDWLGDQDAIHYMCREAPHTVIELEHYGVPFSRTPEGKIYQRAFG 164

Query: 131 GHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCCVG 190
           G    YG+G    R  AAADRTGHA+LHTLYGQ+L++N  FFIEYFALDLI+  +G CVG
Sbjct: 165 GQSLKYGKGGQAYRCAAAADRTGHALLHTLYGQSLRHNTNFFIEYFALDLIMQ-DGECVG 223

Query: 191 VVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDMEFV 250
           V+A  +E G +HRF +   VLATGGYGRAYFS TSAHTC+GDG  MV RAGLPLQD+EFV
Sbjct: 224 VIALNMEDGTLHRFRSHKTVLATGGYGRAYFSCTSAHTCSGDGNAMVVRAGLPLQDLEFV 283

Query: 251 QFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEIRE 310
           QFHPTGIYGAGCLITEG+RGEGGYL+NS+GERFMERYAP+AKDLASRDVVSR M +EIRE
Sbjct: 284 QFHPTGIYGAGCLITEGSRGEGGYLLNSEGERFMERYAPTAKDLASRDVVSRSMTIEIRE 343

Query: 311 GRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMGGI 370
           GRGVG  KDH++L L+HL   VL ERLPGISE+A IF+GVDVT++PIPV+PTVHYNMGGI
Sbjct: 344 GRGVGPEKDHLYLQLSHLPAEVLHERLPGISETAAIFSGVDVTKEPIPVLPTVHYNMGGI 403

Query: 371 PTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIRAS 430
           PT Y GEVL  +    ++  PGL A GEA C SVHGANRLG+NSL+D+VVFGRA      
Sbjct: 404 PTKYTGEVLTVDKDGNDKVVPGLYAAGEAACVSVHGANRLGANSLLDIVVFGRAVAHHIR 463

Query: 431 EMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQDSL 490
           + +        +   +    ++  D++R +DG  PTA +R  MQ+AMQ DA VFRTQ +L
Sbjct: 464 DTLSPGKSHKGIPEEAGIESIEFLDKIRRSDGPEPTAKIRLDMQKAMQTDAAVFRTQKTL 523

Query: 491 SDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRGSH 550
            +G   +  ++    ++ + DRS+IWNSDLVETLEL+N++  AI T+ SA ARKESRG+H
Sbjct: 524 DEGVEKVRSIYRNFDNVGIKDRSMIWNSDLVETLELRNILQCAIQTITSAAARKESRGAH 583

Query: 551 AREDFKDGEFGGRDDVNWRKHSLCWV-DWNTGKIKLDYRPVHTELLCGGVDYSKIAPKAR 609
           AREDF D     RDD NW KH+L +  D N+  ++L YR V  +      +   + P  R
Sbjct: 584 AREDFPD-----RDDENWMKHTLSFQHDVNSPDVELKYRKV-IDTTLDEAECKPVPPFKR 637

Query: 610 VY 611
           VY
Sbjct: 638 VY 639


>gi|219877897|gb|ACL50596.1| succinate dehydrogenase subunit A [Botryotinia fuckeliana]
          Length = 663

 Score =  738 bits (1905), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/587 (63%), Positives = 439/587 (74%), Gaps = 6/587 (1%)

Query: 4   SSNLKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGI 63
           S  + + Y  VDH YD +V+GAGGAGLRA  G+AE GF TACI+K+FPTRSHTVAAQGGI
Sbjct: 47  SPFVSNKYPVVDHEYDAIVIGAGGAGLRAAFGLAEAGFNTACISKLFPTRSHTVAAQGGI 106

Query: 64  AASLANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGK 123
            A+L NM  D W+WH+YDT+KGSDWLGD DAI Y+  EAP SV ELE+YG PFSR + GK
Sbjct: 107 NAALGNMHEDDWRWHMYDTVKGSDWLGDQDAIHYMTREAPASVIELENYGCPFSRTDDGK 166

Query: 124 IYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIIN 183
           IYQR FGG  Q +G+G    R CAAADRTGHA+LHTLYGQ+L++N  +FIEYFALDLI+ 
Sbjct: 167 IYQRAFGGQSQKFGKGGQAYRCCAAADRTGHALLHTLYGQSLRHNTNYFIEYFALDLIME 226

Query: 184 SEGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLP 243
            +G C GV+A+  E G +HRF A   VLATGGYGRAYFS TSAHTCTGDG  MVARAGLP
Sbjct: 227 -DGECKGVIAYNQEDGTLHRFRAHNTVLATGGYGRAYFSCTSAHTCTGDGMAMVARAGLP 285

Query: 244 LQDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRC 303
            QD+EFVQFHPTGIYGAGCLITEGARGEGGYL+NS+GERFMERYAP+AKDLASRDVVSR 
Sbjct: 286 NQDLEFVQFHPTGIYGAGCLITEGARGEGGYLLNSQGERFMERYAPTAKDLASRDVVSRS 345

Query: 304 MMMEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTV 363
           M MEIR+GRGVG  KDHI+L L+HL P VL ERLPGISE+A IF+GVDVT+ PIPV+PTV
Sbjct: 346 MTMEIRDGRGVGPDKDHIYLQLSHLPPDVLHERLPGISETASIFSGVDVTKQPIPVLPTV 405

Query: 364 HYNMGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGR 423
           HYNMGGIPT Y GEVL  +++  ++  PGL A GEA C SVHGANRLG+NSL+DL+VFGR
Sbjct: 406 HYNMGGIPTKYTGEVLTVDAEGKDQVVPGLFACGEAACVSVHGANRLGANSLLDLIVFGR 465

Query: 424 AAVIRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGV 483
           A      +  +   P   +   +    +   D++R ADG   T  +R  MQ+ MQ D  V
Sbjct: 466 AVSHTIRDNFEPGMPHKEISADAGAESISVLDQIRTADGTKSTHDVRLAMQKTMQTDVSV 525

Query: 484 FRTQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEAR 543
           FRTQ+SL +G   ++ +     D+K  DRS+IWNSDLVETLEL+NL+  A+ T  +A AR
Sbjct: 526 FRTQESLDEGVTKINAVDQTFKDIKTQDRSMIWNSDLVETLELRNLLTCAVQTAEAAAAR 585

Query: 544 KESRGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPV 590
           KESRG+HARED+ +     RDD  W KHSL +     GK  L YR V
Sbjct: 586 KESRGAHAREDYPE-----RDDKEWMKHSLTFQKKPQGKTDLTYRAV 627


>gi|50306573|ref|XP_453260.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
 gi|33386568|emb|CAD87728.1| flavoprotein subunit of succinate dehydrogenase complex
           [Kluyveromyces lactis]
 gi|49642394|emb|CAH00356.1| KLLA0D04444p [Kluyveromyces lactis]
          Length = 651

 Score =  738 bits (1905), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/608 (61%), Positives = 447/608 (73%), Gaps = 8/608 (1%)

Query: 5   SNLKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIA 64
           S+    Y  +DH YD VVVGAGGAGLRA  G+AE G+KTACI+K+FPTRSHTVAAQGGI 
Sbjct: 51  SSSSHGYNIIDHEYDCVVVGAGGAGLRAAFGLAEAGYKTACISKLFPTRSHTVAAQGGIN 110

Query: 65  ASLANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKI 124
           A+L NM  D W+WH+YDT+KGSDWLGD D+I Y+  EAP+S+ ELEH+GVPFSR E G+I
Sbjct: 111 AALGNMHKDDWKWHMYDTVKGSDWLGDQDSIHYMTREAPKSIIELEHFGVPFSRTEEGRI 170

Query: 125 YQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINS 184
           YQR FGG  + YG+G    RTCA ADRTGHA+LHTLYGQAL++N  FFIE+FA+DL+ ++
Sbjct: 171 YQRAFGGQSKEYGKGGQAYRTCAVADRTGHALLHTLYGQALRHNTHFFIEFFAMDLLTHN 230

Query: 185 EGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPL 244
            G  VGV+A+  E G IHRF A   ++ATGGYGRAYFS TSAHTCTGDG  MV+RAG PL
Sbjct: 231 -GEVVGVMAYNQEDGTIHRFRAHKTIIATGGYGRAYFSCTSAHTCTGDGYAMVSRAGFPL 289

Query: 245 QDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCM 304
           QD+EF+QFHP+GIYG+GCLITEGARGEGG+LVNS+GERFMERYAP+AKDLA RDVVSR +
Sbjct: 290 QDLEFIQFHPSGIYGSGCLITEGARGEGGFLVNSEGERFMERYAPTAKDLACRDVVSRAI 349

Query: 305 MMEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVH 364
            MEIREGRGVG  KDH+ L LNHL P+VL ERLPGISE+A IFAGVDVT++PIP++PTVH
Sbjct: 350 TMEIREGRGVGPEKDHMFLQLNHLPPSVLHERLPGISETAAIFAGVDVTKEPIPILPTVH 409

Query: 365 YNMGGIPTNYWGEVLDANSKNPER-FAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGR 423
           YNMGGIPT + GE L  + +  E    PGL+A GEA C SVHGANRLG+NSL+DLVVFGR
Sbjct: 410 YNMGGIPTKWNGEALTIDEETGEDVLIPGLLACGEAACVSVHGANRLGANSLLDLVVFGR 469

Query: 424 AAVIRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGV 483
           A     ++ +    P   L        +   D+LR+A GH PTA +R  MQ+ MQ D  V
Sbjct: 470 AVAHTIADTLQPGLPHKPLPADLGKESIANLDKLRNATGHRPTADIRLAMQKTMQKDVSV 529

Query: 484 FRTQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEAR 543
           FRTQ SL +G +N++ +     D+   DRS+IWNSDLVETLELQNL+  A  T  SA  R
Sbjct: 530 FRTQASLDEGVKNINAVDKTFVDVGTTDRSMIWNSDLVETLELQNLLTCATQTAKSAAER 589

Query: 544 KESRGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSK 603
           KESRG+HARED+ +     RDDV+W KH+L W       + L YR V    L    +   
Sbjct: 590 KESRGAHAREDYPE-----RDDVHWMKHTLSWQRDTGDDVVLKYRKVIATTL-DEKECPP 643

Query: 604 IAPKARVY 611
           + P  R Y
Sbjct: 644 VPPTVRAY 651


>gi|219877899|gb|ACL50597.1| succinate dehydrogenase subunit A [Botryotinia fuckeliana]
          Length = 662

 Score =  738 bits (1905), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/587 (63%), Positives = 439/587 (74%), Gaps = 6/587 (1%)

Query: 4   SSNLKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGI 63
           S  + + Y  VDH YD +V+GAGGAGLRA  G+AE GF TACI+K+FPTRSHTVAAQGGI
Sbjct: 47  SPFVSNKYPVVDHEYDAIVIGAGGAGLRAAFGLAEAGFNTACISKLFPTRSHTVAAQGGI 106

Query: 64  AASLANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGK 123
            A+L NM  D W+WH+YDT+KGSDWLGD DAI Y+  EAP SV ELE+YG PFSR + GK
Sbjct: 107 NAALGNMHEDDWRWHMYDTVKGSDWLGDQDAIHYMTREAPASVIELENYGCPFSRTDDGK 166

Query: 124 IYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIIN 183
           IYQR FGG  Q +G+G    R CAAADRTGHA+LHTLYGQ+L++N  +FIEYFALDLI+ 
Sbjct: 167 IYQRAFGGQSQKFGKGGQAYRCCAAADRTGHALLHTLYGQSLRHNTNYFIEYFALDLIME 226

Query: 184 SEGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLP 243
            +G C GV+A+  E G +HRF A   VLATGGYGRAYFS TSAHTCTGDG  MVARAGLP
Sbjct: 227 -DGECKGVIAYNQEDGTLHRFRAHNTVLATGGYGRAYFSCTSAHTCTGDGMAMVARAGLP 285

Query: 244 LQDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRC 303
            QD+EFVQFHPTGIYGAGCLITEGARGEGGYL+NS+GERFMERYAP+AKDLASRDVVSR 
Sbjct: 286 NQDLEFVQFHPTGIYGAGCLITEGARGEGGYLLNSQGERFMERYAPTAKDLASRDVVSRS 345

Query: 304 MMMEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTV 363
           M MEIR+GRGVG  KDHI+L L+HL P VL ERLPGISE+A IF+GVDVT+ PIPV+PTV
Sbjct: 346 MTMEIRDGRGVGPDKDHIYLQLSHLPPDVLHERLPGISETASIFSGVDVTKQPIPVLPTV 405

Query: 364 HYNMGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGR 423
           HYNMGGIPT Y GEVL  +++  ++  PGL A GEA C SVHGANRLG+NSL+DL+VFGR
Sbjct: 406 HYNMGGIPTKYTGEVLTVDAEGKDQVVPGLFACGEAACVSVHGANRLGANSLLDLIVFGR 465

Query: 424 AAVIRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGV 483
           A      +  +   P   +   +    +   D++R ADG   T  +R  MQ+ MQ D  V
Sbjct: 466 AVSHTIRDNFEPGMPHKEISADAGAESISVLDQIRTADGTKSTHDVRLAMQKTMQTDVSV 525

Query: 484 FRTQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEAR 543
           FRTQ+SL +G   ++ +     D+K  DRS+IWNSDLVETLEL+NL+  A+ T  +A AR
Sbjct: 526 FRTQESLDEGVTKINAVDQTFKDIKTQDRSMIWNSDLVETLELRNLLTCAVQTAEAAAAR 585

Query: 544 KESRGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPV 590
           KESRG+HARED+ +     RDD  W KHSL +     GK  L YR V
Sbjct: 586 KESRGAHAREDYPE-----RDDKEWMKHSLTFQKKPQGKTDLTYRAV 627


>gi|303321744|ref|XP_003070866.1| succinate dehydrogenase flavoprotein subunit, putative
           [Coccidioides posadasii C735 delta SOWgp]
 gi|111606573|gb|ABH10651.1| succinate dehydrogenase [Coccidioides posadasii]
 gi|240110563|gb|EER28721.1| succinate dehydrogenase flavoprotein subunit, putative
           [Coccidioides posadasii C735 delta SOWgp]
 gi|320040355|gb|EFW22288.1| succinate dehydrogenase [Coccidioides posadasii str. Silveira]
          Length = 647

 Score =  738 bits (1905), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/608 (62%), Positives = 445/608 (73%), Gaps = 7/608 (1%)

Query: 4   SSNLKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGI 63
           S  L   Y  +DH YD VVVGAGGAGLRA  G+AE GF TAC+TK+FPTRSHTVAAQGGI
Sbjct: 47  SPFLTKKYPVIDHEYDAVVVGAGGAGLRAAFGLAEAGFNTACVTKLFPTRSHTVAAQGGI 106

Query: 64  AASLANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGK 123
            A+L NM  D W+WH+YDT+KGSDWLGD DAI Y+  EAPQSV ELE YG PFSR E GK
Sbjct: 107 NAALGNMHEDDWRWHMYDTVKGSDWLGDQDAIHYMTREAPQSVIELEGYGCPFSRTEDGK 166

Query: 124 IYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIIN 183
           IYQR FGG  + +G+G    R CAAADRTGHA+LHTLYGQ+L+ NA +FIEYFALDL++ 
Sbjct: 167 IYQRAFGGQSKEFGKGGQAYRCCAAADRTGHALLHTLYGQSLRYNASYFIEYFALDLLME 226

Query: 184 SEGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLP 243
           + G C G++A+  E G +HRF A   VLATGGYGRAYFS TSAHTCTGDG  MVARAGLP
Sbjct: 227 N-GECKGILAYNQEDGTLHRFKAHHTVLATGGYGRAYFSCTSAHTCTGDGMAMVARAGLP 285

Query: 244 LQDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRC 303
            QD+EFVQFHPTGIYGAGCLITEGARGEGGYL+NS GERFMERYA +AKDLASRDVVSR 
Sbjct: 286 NQDLEFVQFHPTGIYGAGCLITEGARGEGGYLLNSNGERFMERYASTAKDLASRDVVSRS 345

Query: 304 MMMEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTV 363
           M +EIREGRGVG  KDHI+L L+HL P +L ERLPGISE+A IFAGVDVT+ PIPV+PTV
Sbjct: 346 MTLEIREGRGVGPEKDHIYLQLSHLPPEILHERLPGISETASIFAGVDVTKQPIPVLPTV 405

Query: 364 HYNMGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGR 423
           HYNMGGIPT Y GEVL  + K  ++  PGL A GEA C SVHGANRLG+NSL+DL+VFGR
Sbjct: 406 HYNMGGIPTRYTGEVLTIDEKGNDKVVPGLYACGEAACVSVHGANRLGANSLLDLIVFGR 465

Query: 424 AAVIRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGV 483
           A      +    ++P   +   +    ++  D++R ADG   T  +R  MQ+ MQ D  V
Sbjct: 466 AVSHTIRDNATPNTPHKEISADAGAESIEVLDKIRTADGPKSTFDIRNAMQKTMQTDVSV 525

Query: 484 FRTQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEAR 543
           FRTQ+SL +G R ++ +    A +   DRS+IWNSDLVETLEL+NL+  A  T  +A  R
Sbjct: 526 FRTQESLDEGVRKINEVDQMFAQVGTKDRSMIWNSDLVETLELRNLLTCATQTAVAAANR 585

Query: 544 KESRGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSK 603
           KESRG+HARED+ D     RDD NW KH+L +     GK+ L YR V T+      +   
Sbjct: 586 KESRGAHAREDYPD-----RDDANWMKHTLTFQKEPHGKVDLTYRAV-TQTTLDESECKP 639

Query: 604 IAPKARVY 611
           + P  RVY
Sbjct: 640 VPPFKRVY 647


>gi|164424871|ref|XP_001728186.1| succinate dehydrogenase flavoprotein subunit, mitochondrial
           precursor [Neurospora crassa OR74A]
 gi|157070700|gb|EDO65095.1| succinate dehydrogenase flavoprotein subunit, mitochondrial
           precursor [Neurospora crassa OR74A]
          Length = 661

 Score =  737 bits (1903), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/609 (61%), Positives = 451/609 (74%), Gaps = 9/609 (1%)

Query: 4   SSNLKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGI 63
           S +L S Y  +DH YD +VVGAGGAGLRA  G+AE GF TACI+K+FPTRSHTVAAQGGI
Sbjct: 61  SPHLSSKYHVIDHEYDAIVVGAGGAGLRAAFGLAEAGFNTACISKLFPTRSHTVAAQGGI 120

Query: 64  AASLANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGK 123
            A+L NM  D W+WH+YDT+KGSDWLGD DAI Y+  EAP S+ ELE+YG PFSR E GK
Sbjct: 121 NAALGNMHEDDWRWHMYDTVKGSDWLGDQDAIHYMTREAPASIVELENYGCPFSRTEDGK 180

Query: 124 IYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIIN 183
           IYQR FGG  + +G+G    R CAAADRTGHA+LHTLYGQ+L++N  +FIEYFA+DLI+ 
Sbjct: 181 IYQRAFGGQSKEFGKGGQAYRCCAAADRTGHALLHTLYGQSLRHNTNYFIEYFAVDLIMQ 240

Query: 184 SEGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLP 243
            +G C GV+A+  E G +HRF A   VLATGGYGRAYFS TSAHTCTGDG+ MVARAGLP
Sbjct: 241 -DGECRGVLAYNQEDGTLHRFLANNTVLATGGYGRAYFSCTSAHTCTGDGSAMVARAGLP 299

Query: 244 LQDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRC 303
            QD+EFVQFHPTGIYGAGCLITEGARGEGGYL+NS+GERFMERYAP+AKDLASRDVVSR 
Sbjct: 300 NQDLEFVQFHPTGIYGAGCLITEGARGEGGYLLNSEGERFMERYAPTAKDLASRDVVSRS 359

Query: 304 MMMEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTV 363
           M MEIREGRGVG  KDHI+L L+HL   +L ERLPGISE+A IFAGVDV + PIPV+PTV
Sbjct: 360 MTMEIREGRGVGPEKDHIYLQLSHLPAEILAERLPGISETAGIFAGVDVRKQPIPVLPTV 419

Query: 364 HYNMGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGR 423
           HYNMGGIPT Y GEVL  + +  ++  PGL A GEA   SVHGANRLG+NSL+DLVVFGR
Sbjct: 420 HYNMGGIPTRYTGEVLTVDEQGNDKVVPGLFACGEAASVSVHGANRLGANSLLDLVVFGR 479

Query: 424 AAVIRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGV 483
           A      +     S +  ++  +    ++  D++R +DG   TA +R  MQ+ MQ D  V
Sbjct: 480 AVSHTIRDKFTPGSKLKPIEADAGSESIEVLDKIRTSDGPKSTAEIRLAMQKTMQRDVSV 539

Query: 484 FRTQDSLSDGCRNLSCLWDEMAD-LKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEA 542
           FRTQ+SL +G   ++ + D+M D + + DRS+IWNSDLVETLEL+NL+  A  T  SA  
Sbjct: 540 FRTQESLDEGVEKITQV-DQMFDQVGIKDRSMIWNSDLVETLELRNLLTCATQTAVSAAN 598

Query: 543 RKESRGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYS 602
           RKESRG+HARED+ +     RDD NW KH+L W     GKI+L YR V  +      +  
Sbjct: 599 RKESRGAHAREDYPE-----RDDKNWMKHTLSWQKQPHGKIELGYRRV-IDTTLDEKECP 652

Query: 603 KIAPKARVY 611
            + P  RVY
Sbjct: 653 PVPPFKRVY 661


>gi|196016611|ref|XP_002118157.1| hypothetical protein TRIADDRAFT_38520 [Trichoplax adhaerens]
 gi|190579283|gb|EDV19382.1| hypothetical protein TRIADDRAFT_38520 [Trichoplax adhaerens]
          Length = 588

 Score =  737 bits (1903), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/569 (60%), Positives = 436/569 (76%), Gaps = 13/569 (2%)

Query: 34  LGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLANMTPDSWQWHLYDTIKGSDWLGDVD 93
           +G++  GFKTACI+K+FPTRSHTVAAQGGI A+L NM  D W+WH++DT+KGSDWLGD +
Sbjct: 1   MGLSMAGFKTACISKLFPTRSHTVAAQGGINAALGNMEEDDWKWHMFDTVKGSDWLGDQN 60

Query: 94  AIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRPFGGHMQNYGEGPPVQRTCAAADRTG 153
           +I Y+  EAP++V ELE++G+PFSR E+GKIYQR FGG    YG+G    R C  ADRTG
Sbjct: 61  SIHYMTREAPKAVIELENFGMPFSRTESGKIYQRAFGGQSLKYGKGGQAHRCCCVADRTG 120

Query: 154 HAILHTLYGQALKNNAEFFIEYFALDLIINSEGCCVGVVAWQLETGEIHRFSAKLVVLAT 213
           H++LHTLYG++LK +  FFIEYFALDLI+  +G C+GV+A  +E G IHRF AK  VLAT
Sbjct: 121 HSLLHTLYGRSLKYDTHFFIEYFALDLIMK-DGACIGVIAMDMEDGSIHRFRAKNTVLAT 179

Query: 214 GGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDMEFVQFHPTGIYGAGCLITEGARGEGG 273
           GGYGRAYFS TSAHTCTGDG  MV+RAGL  +DMEFVQFHPTGIYGAGCLITEG RGEGG
Sbjct: 180 GGYGRAYFSCTSAHTCTGDGTAMVSRAGLANEDMEFVQFHPTGIYGAGCLITEGCRGEGG 239

Query: 274 YLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEIREGRGVGKSKDHIHLYLNHLDPAVL 333
           YL+NS+GERFMERYAP+AKDLASRDVVSR M MEIREGRG G  KDH++L L+HL P  L
Sbjct: 240 YLINSEGERFMERYAPTAKDLASRDVVSRSMTMEIREGRGCGPDKDHVYLQLSHLPPETL 299

Query: 334 QERLPGISESARIFAGVDVTRDPIPVIPTVHYNMGGIPTNYWGEVLDANSKNPERFAPGL 393
           + RLPGISE+A IFAGVDVT++PIPVIPTVHYNMGG+PT Y G+ +    +  +   PGL
Sbjct: 300 RTRLPGISETAMIFAGVDVTKEPIPVIPTVHYNMGGVPTLYNGQAIQYTKEGGDVIVPGL 359

Query: 394 MAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIRASEMIDKSSPIPSLDISSCDRIMDR 453
            A GEA CASVHGANRLG+NSL+DLV+FGRA  +   E       I  L  ++ +  +  
Sbjct: 360 YAAGEAACASVHGANRLGANSLLDLVIFGRACALHIEETCKPGDSIADLPSNAGEETVAN 419

Query: 454 FDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQDSLSDGCRNLSCLWDEMADLKVHDRS 513
            D+L HA+G +PTA LR K+Q+ MQ +A VFRT   L +GC+ +  ++++M D+++ DR 
Sbjct: 420 VDKLLHANGAIPTADLRLKLQKTMQNNAAVFRTGPVLEEGCKLIDEIYNQMGDIRLSDRG 479

Query: 514 LIWNSDLVETLELQNLMINAIATVYSAEARKESRGSHAREDFKD------------GEFG 561
           L+WNSDL+ETLELQN+++N++ T+Y+A+AR+ESRG+HAREDFKD            G+  
Sbjct: 480 LVWNSDLIETLELQNILVNSVQTIYAAQAREESRGAHAREDFKDRVDEYDYSKPLEGQQE 539

Query: 562 GRDDVNWRKHSLCWVDWNTGKIKLDYRPV 590
              + +WRKH++ +VD  TGK  L+YRPV
Sbjct: 540 KPFNQHWRKHTMSYVDHRTGKSHLEYRPV 568


>gi|74219241|dbj|BAE26754.1| unnamed protein product [Mus musculus]
          Length = 664

 Score =  737 bits (1903), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/622 (59%), Positives = 452/622 (72%), Gaps = 15/622 (2%)

Query: 2   KNSSNLKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQG 61
           K S  + + Y  VDH +D VVVG GGAGLRA  G++E GF TAC+TK+FPTRSHTVAAQG
Sbjct: 46  KVSDAISTQYPVVDHEFDAVVVGVGGAGLRAAFGLSEAGFNTACLTKLFPTRSHTVAAQG 105

Query: 62  GIAASLANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEA 121
           GI A+L NM  D+W+WH YDT+KGSDWLGD DAI Y+  +AP SV ELE+YG+PFSR E 
Sbjct: 106 GINAALGNMEEDNWRWHFYDTVKGSDWLGDQDAIHYMTEQAPASVVELENYGMPFSRTED 165

Query: 122 GKIYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLI 181
           GKIYQR FGG    +G+G    R C  ADRTGH++LHTLYG++L+ +  +F+EYFALDL+
Sbjct: 166 GKIYQRAFGGQSLKFGKGGQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLL 225

Query: 182 INSEGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAG 241
           + + G C GV+A  +E G IH+  AK  V+ATGGYGR YFS TSAHT TGDG  MV RAG
Sbjct: 226 MEN-GECRGVIALCIEDGSIHQIRAKNTVIATGGYGRTYFSCTSAHTSTGDGTAMVTRAG 284

Query: 242 LPLQDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVS 301
           LP QD+EFVQFHPTGIYGAGCLITEG RGEGG L+NS+GERFMERYAP AKDLASRDVVS
Sbjct: 285 LPCQDLEFVQFHPTGIYGAGCLITEGCRGEGGILINSQGERFMERYAPVAKDLASRDVVS 344

Query: 302 RCMMMEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIP 361
           R M +EIREGRG G  KDH++L L+HL P  L  RLPGISE+A IFAGVDVT++PIPV+P
Sbjct: 345 RSMTLEIREGRGCGPEKDHVYLQLHHLPPEQLATRLPGISETAMIFAGVDVTKEPIPVLP 404

Query: 362 TVHYNMGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVF 421
           TVHYNMGGIPTNY G+VL  +    ++  PGL A GEA CASVHGANRLG+NSL+DLVVF
Sbjct: 405 TVHYNMGGIPTNYKGQVLK-HVNGRDQIVPGLYACGEAACASVHGANRLGANSLLDLVVF 463

Query: 422 GRAAVIRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDA 481
           GRA  +  +E       +PS+  ++ +  +   D+LR ADG + T+ LR  MQ++MQ  A
Sbjct: 464 GRACALSIAESCRPGDKVPSIKANAGEESVMNLDKLRFADGSIRTSELRLNMQKSMQNHA 523

Query: 482 GVFRTQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAE 541
            VFR    L +GC  +S L+ ++  LK  DR ++WN+DLVETLELQNLM+ A+ T+Y AE
Sbjct: 524 AVFRVGSVLQEGCEKISQLYGDLKHLKTFDRGMVWNTDLVETLELQNLMLCALQTIYGAE 583

Query: 542 ARKESRGSHAREDFK------------DGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRP 589
           ARKESRG+HARED+K             G+       +WRKH+L +VD  TGK+ L+YRP
Sbjct: 584 ARKESRGAHAREDYKVRVDEYDYSKPIQGQQKKPFGEHWRKHTLSYVDIKTGKVTLEYRP 643

Query: 590 VHTELLCGGVDYSKIAPKARVY 611
           V  + L    D + + P  R Y
Sbjct: 644 VIDKTL-NEADCATVPPAIRSY 664


>gi|302915795|ref|XP_003051708.1| predicted protein [Nectria haematococca mpVI 77-13-4]
 gi|256732647|gb|EEU45995.1| predicted protein [Nectria haematococca mpVI 77-13-4]
          Length = 1711

 Score =  737 bits (1902), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/611 (61%), Positives = 453/611 (74%), Gaps = 13/611 (2%)

Query: 4    SSNLKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGI 63
            S  + + Y  +DH YD +VVGAGGAGLRA  G+AE GF TACI+K+FPTRSHTVAAQGGI
Sbjct: 1111 SPFVSTKYAVIDHEYDALVVGAGGAGLRAAFGLAEAGFNTACISKLFPTRSHTVAAQGGI 1170

Query: 64   AASLANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGK 123
             A+L NM  D W+WH+YDT+KGSDWLGD DAI Y+  EAP S+ ELE+YG PFSR E GK
Sbjct: 1171 NAALGNMHEDDWRWHMYDTVKGSDWLGDQDAIHYMTREAPASIIELENYGCPFSRTEEGK 1230

Query: 124  IYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIIN 183
            IYQR FGG  + +G+G    R CAAADRTGHA+LHTLYGQ+L++   +FIEYFALDLI+ 
Sbjct: 1231 IYQRAFGGQSKEFGKGGQAYRCCAAADRTGHALLHTLYGQSLRHKTNYFIEYFALDLIMQ 1290

Query: 184  SEGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLP 243
             +G C GV+A+  E G +HRF A   VLATGGYGRAYFS TSAHTCTGDG  MVARAGLP
Sbjct: 1291 -DGECRGVLAYNQEDGTLHRFLANHTVLATGGYGRAYFSCTSAHTCTGDGMAMVARAGLP 1349

Query: 244  LQDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRC 303
             QD+EFVQFHPTGIYGAGCLITEGARGEGG+L+NS+GERFMERYAP+A+DLASRDVVSR 
Sbjct: 1350 NQDLEFVQFHPTGIYGAGCLITEGARGEGGFLLNSEGERFMERYAPTARDLASRDVVSRS 1409

Query: 304  MMMEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTV 363
            M MEIR+GRGVG  KDHI L L+HL   +L ERLPGISE+A IFAGVDV + PIPV+PTV
Sbjct: 1410 MTMEIRDGRGVGAEKDHIFLQLSHLPAEILAERLPGISETAGIFAGVDVRKQPIPVLPTV 1469

Query: 364  HYNMGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGR 423
            HYNMGGIPT Y GEVL  + +  ++  PGL A GEA C SVHGANRLG+NSL+DLVVFGR
Sbjct: 1470 HYNMGGIPTRYTGEVLTVDEQGEDKVVPGLYACGEAACVSVHGANRLGANSLLDLVVFGR 1529

Query: 424  AAVIRASEMIDKSSPIPSLDISSCDRIMDR---FDRLRHADGHVPTAALREKMQRAMQLD 480
            A    +  + DK +P  +L  ++ D   D     D++R ADG   TA +R  MQ+AMQ +
Sbjct: 1530 AV---SHTIRDKFNPGDALKPTAADAGADHIEVLDKVRTADGSKSTAEIRLAMQKAMQTE 1586

Query: 481  AGVFRTQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSA 540
              VFRTQ+SL +G R +  +    AD+ + DRS+IWNSDLVETLEL+NL+  A+ T  SA
Sbjct: 1587 VSVFRTQESLDEGVRKMKEIDALYADVGMKDRSMIWNSDLVETLELRNLLTCAMQTATSA 1646

Query: 541  EARKESRGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVD 600
              RKESRG+HARED+ D     RDD NW KH+L +     G+++L YR V +  L    +
Sbjct: 1647 ANRKESRGAHAREDYPD-----RDDKNWMKHTLSFQREPHGEVELKYRKVISTTL-DEAE 1700

Query: 601  YSKIAPKARVY 611
               + P  RVY
Sbjct: 1701 CKPVPPFKRVY 1711


>gi|194753168|ref|XP_001958889.1| GF12611 [Drosophila ananassae]
 gi|190620187|gb|EDV35711.1| GF12611 [Drosophila ananassae]
          Length = 661

 Score =  737 bits (1902), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/621 (60%), Positives = 448/621 (72%), Gaps = 15/621 (2%)

Query: 3   NSSNLKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGG 62
           N   +   Y  VDH+YD +VVGAGGAGLRA  G+  +GF+TA ITK+FPTRSHT+AAQGG
Sbjct: 44  NPDKISKQYPVVDHAYDAIVVGAGGAGLRAAFGLVAEGFRTAVITKLFPTRSHTIAAQGG 103

Query: 63  IAASLANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAG 122
           I A+L NM  D W+WH+YDT+KGSDWLGD DAI Y+  EAP++V ELE+YG+PFSR + G
Sbjct: 104 INAALGNMEEDDWKWHMYDTVKGSDWLGDQDAIHYMTREAPKAVIELENYGMPFSRTQDG 163

Query: 123 KIYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLII 182
           KIYQR FGG    +G+G    R CA ADRTGH++LHTLYGQ+L  +  +F+EYFALDLI 
Sbjct: 164 KIYQRAFGGQSLKFGKGGQAHRCCAVADRTGHSLLHTLYGQSLSYDCNYFVEYFALDLIF 223

Query: 183 NSEGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGL 242
             EG C GV+A  LE G +HRF AK  V+ATGGYGRA+FS TSAHTCTGDG  MVAR GL
Sbjct: 224 -EEGECRGVLALNLEDGSLHRFRAKNTVVATGGYGRAFFSCTSAHTCTGDGTAMVARQGL 282

Query: 243 PLQDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSR 302
           P QD+EFVQFHPTGIYGAGCLITEG RGEGGYL+N  GERFMERYAP AKDLASRDVVSR
Sbjct: 283 PSQDLEFVQFHPTGIYGAGCLITEGCRGEGGYLINGNGERFMERYAPVAKDLASRDVVSR 342

Query: 303 CMMMEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPT 362
            M +EI EGRGVG  KDH+ L L+HL P  L ERLPGISE+A IFAGVDVTR+PIPV+PT
Sbjct: 343 SMTIEIMEGRGVGPEKDHVFLQLHHLPPKQLAERLPGISETAMIFAGVDVTREPIPVLPT 402

Query: 363 VHYNMGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFG 422
           VHYNMGGIPTNY G+V+  +    +   PGL A GE+  +SVHGANRLG+NSL+DLVVFG
Sbjct: 403 VHYNMGGIPTNYRGQVITIDKDGKDVIVPGLYAAGESASSSVHGANRLGANSLLDLVVFG 462

Query: 423 RAAVIRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAG 482
           RA     +E      P P+L  ++ +  +   D+LR+A+G + TA LR KMQ+ MQ  A 
Sbjct: 463 RACAKTIAEENKPGVPAPTLKDNAGEASVANLDKLRNANGSITTADLRLKMQKTMQHHAA 522

Query: 483 VFRTQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEA 542
           VFR    L DG   +  ++ +  D+KV D+S IWNSDLVETLELQNL+ NA  T+ +AEA
Sbjct: 523 VFRDGPILKDGVNKMQEIYKQFKDIKVVDKSPIWNSDLVETLELQNLLANAQMTIVAAEA 582

Query: 543 RKESRGSHAREDFK------------DGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPV 590
           RKESRG+HAREDFK            +G+     D +WRKH+L WV  + G I LDYRPV
Sbjct: 583 RKESRGAHAREDFKTREDEYDYSKPIEGQTQKPMDQHWRKHTLSWVCNDNGDISLDYRPV 642

Query: 591 HTELLCGGVDYSKIAPKARVY 611
               L   V  + + P  R Y
Sbjct: 643 IDSTLDKEV--TTVPPAIRSY 661


>gi|302306987|ref|NP_983455.2| ACR052Wp [Ashbya gossypii ATCC 10895]
 gi|299788782|gb|AAS51279.2| ACR052Wp [Ashbya gossypii ATCC 10895]
          Length = 633

 Score =  736 bits (1901), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/605 (60%), Positives = 451/605 (74%), Gaps = 8/605 (1%)

Query: 8   KSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASL 67
           ++ Y  VDH YD VVVGAGGAGLRA  G+AE G+KTACI+K+FPTRSHTVAAQGGI A+L
Sbjct: 36  QAKYHIVDHEYDCVVVGAGGAGLRAAFGLAEAGYKTACISKLFPTRSHTVAAQGGINAAL 95

Query: 68  ANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQR 127
            NM  D W+WH+YDT+KGSDWLGD D+I Y+  EAP S+ ELE++G+PFSRN+ G+IYQR
Sbjct: 96  GNMHGDDWKWHMYDTVKGSDWLGDQDSIHYMTREAPASIIELENFGMPFSRNDEGRIYQR 155

Query: 128 PFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGC 187
            FGG  + YG+G    RTCA ADRTGHA+LHTLYGQAL +N  FF+EYFA+DL+ ++ G 
Sbjct: 156 AFGGQSKEYGKGGQAYRTCAVADRTGHAMLHTLYGQALSHNTHFFVEYFAMDLLTHN-GE 214

Query: 188 CVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDM 247
            VGV+A+  E G +HRF A   V+ATGGYGRAYFS TSAHTCTGDG  MV+RAG PLQD+
Sbjct: 215 VVGVIAYNQEDGTVHRFRAHRTVMATGGYGRAYFSCTSAHTCTGDGNAMVSRAGFPLQDL 274

Query: 248 EFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMME 307
           EFVQFHP+GIYG+GCLITEGARGEGG+L+NS+GERFMERYAP+AKDLA RDVVSR + ME
Sbjct: 275 EFVQFHPSGIYGSGCLITEGARGEGGFLLNSEGERFMERYAPTAKDLACRDVVSRAITME 334

Query: 308 IREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNM 367
           IREGRGVG  KDHIHL L+HL P+VL+ERLPGISE+A IFAGVDVT++PIPV+PTVHYNM
Sbjct: 335 IREGRGVGPEKDHIHLQLSHLPPSVLKERLPGISETAHIFAGVDVTKEPIPVLPTVHYNM 394

Query: 368 GGIPTNYWGEVLDANSKNPE-RFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAV 426
           GGIPT + GE L  + +  E +  PGL+A GEA C SVHGANRLG+NSL+DLVVFGRA  
Sbjct: 395 GGIPTRWTGEALTIDEETGEDKVIPGLLACGEAACVSVHGANRLGANSLLDLVVFGRAVA 454

Query: 427 IRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRT 486
              ++ +    P   L        +   +R+R A G + T+ +R  MQ+AMQ D  VFRT
Sbjct: 455 HTVADSLQPGLPHKPLPADLGKESIANLERMRTASGPLTTSQIRLNMQKAMQKDVSVFRT 514

Query: 487 QDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKES 546
           Q +L +G  N+S + + + D+   DRS+IWNSDLVETLELQNL+  A+ T  SA  RKES
Sbjct: 515 QQTLDEGVHNVSAIDETLKDVGTSDRSMIWNSDLVETLELQNLLTCAVQTAKSAAERKES 574

Query: 547 RGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAP 606
           RG+HAREDF +     R+D  W KH+L W   +   +++ YR V T  L    +   + P
Sbjct: 575 RGAHAREDFPE-----RNDEEWMKHTLSWQHASGAPVEIKYRNVITTTL-DETECPPVPP 628

Query: 607 KARVY 611
             R Y
Sbjct: 629 TVRAY 633


>gi|294085395|ref|YP_003552155.1| succinate dehydrogenase flavoprotein subunit [Candidatus
           Puniceispirillum marinum IMCC1322]
 gi|292664970|gb|ADE40071.1| succinate dehydrogenase flavoprotein subunit [Candidatus
           Puniceispirillum marinum IMCC1322]
          Length = 596

 Score =  736 bits (1900), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/602 (62%), Positives = 449/602 (74%), Gaps = 10/602 (1%)

Query: 11  YTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLANM 70
           Y   DH YDVVVVGAGGAGLRATLGMA  G KTACI+KVFPTRSHTVAAQGGI A+L NM
Sbjct: 4   YEIEDHYYDVVVVGAGGAGLRATLGMATAGLKTACISKVFPTRSHTVAAQGGIGAALDNM 63

Query: 71  TP-DSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRPF 129
              D+W++H+YDT+KGSDWLGD DAI+Y+   A  +V ELEHYGVPFSR E G IYQRPF
Sbjct: 64  GEGDNWKYHMYDTVKGSDWLGDQDAIEYMCRNAAPAVIELEHYGVPFSRTEDGNIYQRPF 123

Query: 130 GGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCCV 189
           GGH  +YG+    +R C+AADRTGHAILHTLY Q LK+ A F IEYF LDL++N EG C 
Sbjct: 124 GGHTLDYGKNM-ARRACSAADRTGHAILHTLYQQCLKHQAAFHIEYFVLDLLMNDEGECA 182

Query: 190 GVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDMEF 249
           GV+A  +E G +HRF  +  VLATGGYGR YFS TSAHTCTGDG  M  RAGLPLQDMEF
Sbjct: 183 GVIALCMEDGSLHRFWGQQTVLATGGYGRVYFSCTSAHTCTGDGNAMALRAGLPLQDMEF 242

Query: 250 VQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEIR 309
           VQFHPTG+YGAG LITEGARGEGGYL NS+GERFMER+AP+AKDLASRDVVSR M +EI 
Sbjct: 243 VQFHPTGVYGAGVLITEGARGEGGYLTNSEGERFMERFAPNAKDLASRDVVSRAMTIEIN 302

Query: 310 EGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMGG 369
           EGRGVG +KDHI L+L H+DP  L  RLPGI E+A+IF GVD+T++PIPV+PTVHYNMGG
Sbjct: 303 EGRGVGPNKDHIMLHLEHIDPETLNMRLPGIMETAKIFCGVDITKEPIPVLPTVHYNMGG 362

Query: 370 IPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIRA 429
           IPTNY GEVL   + +     PGLMAIGEA C SVHGANRLG+NSL+D++VFGRAA  RA
Sbjct: 363 IPTNYNGEVLAPTADDENHVVPGLMAIGEAACVSVHGANRLGTNSLLDIIVFGRAAAKRA 422

Query: 430 SEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQDS 489
           +E I       +   S+ D+ + R D++RHADG V  A++R +MQ AMQ  A VFR+ +S
Sbjct: 423 AETITPGDAPRTAPQSATDKAIARLDKMRHADGDVTAASIRLEMQHAMQRHAAVFRSSES 482

Query: 490 LSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRGS 549
           L+DG   +  +  +MA + V D+SLIWN+DL+E LEL NL+  A+ T+ SA+ R+ESRG+
Sbjct: 483 LADGVERMDGIAAKMAKIGVKDKSLIWNTDLIEALELDNLIGQALVTIRSADQRQESRGA 542

Query: 550 HAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPKAR 609
           HA ED+ +     RDD NW KH++  +D    K  L YR V    L    D + I P  R
Sbjct: 543 HAHEDWPE-----RDDDNWMKHTIMRLD-ERNKSDLSYRGVVMNTLSN--DVAPIPPAPR 594

Query: 610 VY 611
           VY
Sbjct: 595 VY 596


>gi|157126787|ref|XP_001660946.1| succinate dehydrogenase [Aedes aegypti]
 gi|108873156|gb|EAT37381.1| succinate dehydrogenase [Aedes aegypti]
          Length = 659

 Score =  736 bits (1900), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/621 (60%), Positives = 457/621 (73%), Gaps = 16/621 (2%)

Query: 3   NSSNLKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGG 62
           N   +   Y  VDH+YD VVVGAGGAGLRA  G+  +GFKTA ITK+FPTRSHTVAAQGG
Sbjct: 43  NPGAISKEYPVVDHTYDAVVVGAGGAGLRAAFGLVAEGFKTAVITKLFPTRSHTVAAQGG 102

Query: 63  IAASLANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAG 122
           I A+L NM  D W+WH+YDT+KGSDWLGD DAI Y+  EAP++V ELE+YG+PFSR   G
Sbjct: 103 INAALGNMEEDDWKWHMYDTVKGSDWLGDQDAIHYMTREAPKAVIELENYGMPFSRTPDG 162

Query: 123 KIYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLII 182
           KIYQR FGG    YG+G    R C  ADRTGH++LHTLYGQ+L  +  +FIEYFALDL++
Sbjct: 163 KIYQRAFGGQSLKYGKGGQAHRCCCVADRTGHSLLHTLYGQSLSYDCNYFIEYFALDLLM 222

Query: 183 NSEGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGL 242
            + G CVGV+A  LE G IHRF +K  VLATGGYGRAYFS TSAHTCTGDG  MVARAGL
Sbjct: 223 EN-GQCVGVIALNLEDGSIHRFRSKNTVLATGGYGRAYFSCTSAHTCTGDGTAMVARAGL 281

Query: 243 PLQDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSR 302
           P +D+EFVQFHPTGIYGAGCLITEG RGEGGYL+NS+GERFMERYAP AKDLASRDVVSR
Sbjct: 282 PSEDLEFVQFHPTGIYGAGCLITEGCRGEGGYLINSQGERFMERYAPVAKDLASRDVVSR 341

Query: 303 CMMMEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPT 362
            M +EIREGRG    KDH++L L+HL P  L +RLPGISE+A IFAGVDVTR+PIPV+PT
Sbjct: 342 SMTIEIREGRGC-PEKDHVYLQLHHLPPEQLAQRLPGISETAMIFAGVDVTREPIPVLPT 400

Query: 363 VHYNMGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFG 422
           VHYNMGG+PTNY G+VL  +S   +   PGL A GE+ C+SVHGANRLG+NSL+DLVVFG
Sbjct: 401 VHYNMGGVPTNYKGQVLTVDSSGNDHVVPGLYACGESACSSVHGANRLGANSLLDLVVFG 460

Query: 423 RAAVIRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAG 482
           RA     +        I  +  ++ +  +   D +R+A+G VPT+ LR  MQ+ MQ  A 
Sbjct: 461 RACAKTIAAENRPGEKIADIKPNAGEASVANLDWVRNANGAVPTSTLRLNMQKTMQTHAA 520

Query: 483 VFRTQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEA 542
           VFR + +L +G R ++ ++  + D+KV DRSL+WNSDLVETLELQNL++NA  T+ +AE 
Sbjct: 521 VFREEKTLQEGVRKMADIYKTIKDVKVSDRSLVWNSDLVETLELQNLLLNANMTITAAEN 580

Query: 543 RKESRGSHAREDFK------------DGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPV 590
           RKESRG+HARED+K            +G+     + +WRKH+L W+D  TG +K+DYRPV
Sbjct: 581 RKESRGAHAREDYKHRVDEYDYSKPLEGQQKKPVEEHWRKHTLTWIDPETGAVKIDYRPV 640

Query: 591 HTELLCGGVDYSKIAPKARVY 611
             + L    + + + P  R Y
Sbjct: 641 IDQTL--SEECNTVPPAIRSY 659


>gi|291242821|ref|XP_002741304.1| PREDICTED: succinate dehydrogenase-like [Saccoglossus kowalevskii]
          Length = 666

 Score =  736 bits (1899), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/619 (59%), Positives = 458/619 (73%), Gaps = 19/619 (3%)

Query: 6   NLKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAA 65
            +   Y  VDH++D +VVGAGGAGLRA  G+A  GFKTAC++K+FPTRSHTVAAQGG+ A
Sbjct: 54  QISRDYPVVDHTFDAIVVGAGGAGLRAAFGLAIDGFKTACLSKLFPTRSHTVAAQGGVNA 113

Query: 66  SLANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIY 125
           +L NM PD W+WH++DT+KGSDWLGD +AI Y+  EAP++V ELE+YG+PFSR   GKIY
Sbjct: 114 ALGNMEPDEWRWHMFDTVKGSDWLGDQNAIHYMTREAPKAVIELENYGMPFSRTPDGKIY 173

Query: 126 QRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSE 185
           QR FGG   +YG G    R C  ADRTGH++LHTLYGQ+L  +  +FIEYFA+DLI++ +
Sbjct: 174 QRAFGGQSYDYGRGGQAHRCCCVADRTGHSLLHTLYGQSLHYDVHYFIEYFAMDLIMDGD 233

Query: 186 GCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQ 245
            C  GV A  LE G IHRF AK  VLATGGYGRAYFS TSAHTCTGDG  M ++AG+   
Sbjct: 234 EC-RGVTALCLEDGSIHRFRAKNTVLATGGYGRAYFSCTSAHTCTGDGTAMTSKAGIANS 292

Query: 246 DMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMM 305
           DMEFVQFHPTGIYGAGCL+TEG RGEGGYL+NS+GERFMERYAP+AKDLASRDVVSR M 
Sbjct: 293 DMEFVQFHPTGIYGAGCLMTEGCRGEGGYLINSEGERFMERYAPTAKDLASRDVVSRSMT 352

Query: 306 MEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHY 365
           MEIREGRGVG  KDH++L L+HL P  L  RLPGISE+A IFAGVDVTR+PIPVIPTVHY
Sbjct: 353 MEIREGRGVGPEKDHVYLQLHHLPPEQLHSRLPGISETAMIFAGVDVTREPIPVIPTVHY 412

Query: 366 NMGGIPTNYWGEVLDANSKNPERF-APGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRA 424
           NMGG+PTNY G+ +    +N E F   GL A GE+ CASVHGANRLG+NSL+DLVVFGRA
Sbjct: 413 NMGGVPTNYTGQAI--GHRNGEDFIIGGLYACGESACASVHGANRLGANSLLDLVVFGRA 470

Query: 425 AVIRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVF 484
                SE      PIP    ++ +  +   D+ RHA+G  P++ LR KMQ+ MQ +A VF
Sbjct: 471 CAHTISENNKPGDPIPEFKKNAGEESVANLDKFRHANGSTPSSVLRLKMQKTMQNNAAVF 530

Query: 485 RTQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARK 544
           RT ++L +GC+ +  ++D + D+K++DR ++WN+DLVE LELQN +INA+ T+++AE RK
Sbjct: 531 RTGETLKEGCKLIDEVYDGLEDIKLYDRGMVWNTDLVEALELQNCLINAVQTMHAAENRK 590

Query: 545 ESRGSHAREDFKD------------GEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHT 592
           ESRG+HAREDFKD            G+       +WRKHSL +VD   GK+ LDYRPV  
Sbjct: 591 ESRGAHAREDFKDRIDEYDYTKPLEGQKKKALKDHWRKHSLSYVD--NGKVTLDYRPVID 648

Query: 593 ELLCGGVDYSKIAPKARVY 611
           E L    + + + P+ R Y
Sbjct: 649 ETL-DQEECAWVPPRIRSY 666


>gi|225556434|gb|EEH04722.1| succinate dehydrogenase [Ajellomyces capsulatus G186AR]
          Length = 647

 Score =  736 bits (1899), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/608 (62%), Positives = 449/608 (73%), Gaps = 13/608 (2%)

Query: 7   LKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAAS 66
           +  +Y  +DH YD VVVGAGGAGLRA  G+AE GF TAC++K+FPTRSHTVAAQGGI A+
Sbjct: 50  VSKNYPVIDHEYDAVVVGAGGAGLRAAFGLAEAGFNTACVSKLFPTRSHTVAAQGGINAA 109

Query: 67  LANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQ 126
           L NM  D W+WH+YDT+KGSDWLGD DAI Y+  EAPQS+ ELE YG PFSR E GKIYQ
Sbjct: 110 LGNMHEDDWRWHMYDTVKGSDWLGDQDAIHYMTREAPQSIIELEGYGCPFSRTEDGKIYQ 169

Query: 127 RPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEG 186
           R FGG  Q YG+G    R CAAADRTGHA+LHTLYGQ+L++N  +FIEYFALDL++  +G
Sbjct: 170 RAFGGQSQKYGKGGQAYRCCAAADRTGHALLHTLYGQSLRHNTNYFIEYFALDLLME-DG 228

Query: 187 CCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQD 246
            C G++A+  E G IHRF A   VLATGGYGRAYFS TSAHTCTGDG  MVARAGLP QD
Sbjct: 229 ECKGIIAYNQEDGTIHRFRAHNTVLATGGYGRAYFSCTSAHTCTGDGMAMVARAGLPNQD 288

Query: 247 MEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMM 306
           +EFVQFHPTGIYGAGCLITEG+RGEGGYL+NS+GERFMERYAP+AKDLASRDVVSR M +
Sbjct: 289 LEFVQFHPTGIYGAGCLITEGSRGEGGYLLNSEGERFMERYAPTAKDLASRDVVSRSMTL 348

Query: 307 EIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYN 366
           EIREGRGVG  KDHI+L L+HL   +L ERLPGISE+A IFAGVDVT+ PIPV+PTVHYN
Sbjct: 349 EIREGRGVGPEKDHIYLQLSHLPAEILHERLPGISETASIFAGVDVTKQPIPVLPTVHYN 408

Query: 367 MGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAV 426
           MGGIPT Y GEVL  + K  ++  PGL A GEA C SVHGANRLG+NSL+DL+VFGRA  
Sbjct: 409 MGGIPTRYTGEVLTLDEKGQDKVVPGLYACGEAACVSVHGANRLGANSLLDLIVFGRAV- 467

Query: 427 IRASEMIDKSSP-IPSLDIS--SCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGV 483
             +  + DKSSP  P  +IS  +    +   D++R A+G   T  +R  MQ+ MQ D  V
Sbjct: 468 --SHTIRDKSSPGQPHKEISADAGAESISVLDKVRTAEGSKSTFDIRNAMQKTMQTDVSV 525

Query: 484 FRTQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEAR 543
           FRTQ+SL +G R +  +     D+   DRS+IWNSDLVETLEL+NL+  A  T  +A  R
Sbjct: 526 FRTQESLDEGVRKIKEVDQMFDDVGTKDRSMIWNSDLVETLELRNLLTCATQTAIAAANR 585

Query: 544 KESRGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSK 603
           KESRG+HARED+ D     RDD NW KH+L +     GK+ L YR V+   L    +   
Sbjct: 586 KESRGAHAREDYPD-----RDDENWMKHTLTYQKQPHGKVDLTYRAVNPNTLDAN-ECKP 639

Query: 604 IAPKARVY 611
           + P  R Y
Sbjct: 640 VPPFKRTY 647


>gi|295672341|ref|XP_002796717.1| succinate dehydrogenase flavoprotein subunit [Paracoccidioides
           brasiliensis Pb01]
 gi|226283697|gb|EEH39263.1| succinate dehydrogenase flavoprotein subunit [Paracoccidioides
           brasiliensis Pb01]
          Length = 596

 Score =  735 bits (1898), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/584 (64%), Positives = 442/584 (75%), Gaps = 12/584 (2%)

Query: 15  DHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLANMTPDS 74
           DH YD VVVGAGGAGLRA  G+AE GF TACI+K+FPTRSHTVAAQGGI A+L NM  D 
Sbjct: 7   DHEYDAVVVGAGGAGLRAAFGLAEAGFNTACISKLFPTRSHTVAAQGGINAALGNMHEDD 66

Query: 75  WQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRPFGGHMQ 134
           W+WH+YDT+KGSDWLGD DAI Y+  EAPQSV ELE YG PFSR E GKIYQR FGG  Q
Sbjct: 67  WRWHMYDTVKGSDWLGDQDAIHYMTREAPQSVIELEGYGCPFSRTEDGKIYQRAFGGQSQ 126

Query: 135 NYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCCVGVVAW 194
            YG+G    R CAAADRTGHA+LHTLYGQ+L++N  +FIEYFA+DL++  +G C GV+A+
Sbjct: 127 KYGKGGQAYRCCAAADRTGHALLHTLYGQSLRHNTNYFIEYFAMDLLME-DGECKGVIAY 185

Query: 195 QLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDMEFVQFHP 254
             E G IHRF A   VLATGGYGRAYFS TSAHTCTGDG  MVARAGLP QD+EFVQFHP
Sbjct: 186 NQEDGTIHRFRAHNTVLATGGYGRAYFSCTSAHTCTGDGMAMVARAGLPNQDLEFVQFHP 245

Query: 255 TGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEIREGRGV 314
           TGIYGAGCLITEG+RGEGGYL+NS+GERFMERYAP+AKDLASRDVVSR M +EIREGRGV
Sbjct: 246 TGIYGAGCLITEGSRGEGGYLLNSEGERFMERYAPTAKDLASRDVVSRSMTLEIREGRGV 305

Query: 315 GKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMGGIPTNY 374
           G  KDHI+L L+HL P +L ERLPGISE+A IFAGVDVT+ PIPV+PTVHYNMGGIPT Y
Sbjct: 306 GPEKDHIYLQLSHLPPEILHERLPGISETASIFAGVDVTKQPIPVLPTVHYNMGGIPTRY 365

Query: 375 WGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIRASEMID 434
            GEVL  + K  ++  PGL A GEA C SVHGANRLG+NSL+DL+VFGRA    +  + D
Sbjct: 366 TGEVLTIDEKGRDKIVPGLYACGEAACVSVHGANRLGANSLLDLIVFGRAV---SHTIRD 422

Query: 435 KSSP-IPSLDIS--SCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQDSLS 491
           K+SP  P  +IS  +    +   D++R ADG   TA +R  MQ+ MQ D  VFRTQ+SL 
Sbjct: 423 KASPRQPHKEISADAGAESIGVLDKIRTADGSKSTAEIRNAMQKTMQTDVSVFRTQESLD 482

Query: 492 DGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRGSHA 551
           +G R +  +     D+   DRS+IWNSDL+ETLEL+NL+  A  T  +A  RKESRG+HA
Sbjct: 483 EGVRKIKEVDQMFNDVSTKDRSMIWNSDLIETLELRNLLTCATQTAIAAANRKESRGAHA 542

Query: 552 REDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELL 595
           REDF +     RDD NW KH+L +     GK+ L YR V+   L
Sbjct: 543 REDFPE-----RDDENWMKHTLTFQKEPHGKVVLTYRAVNANTL 581


>gi|66813780|ref|XP_641069.1| succinate dehydrogenase [Dictyostelium discoideum AX4]
 gi|74849559|sp|Q9U3X4|DHSA_DICDI RecName: Full=Succinate dehydrogenase [ubiquinone] flavoprotein
           subunit, mitochondrial; AltName: Full=Flavoprotein
           subunit of complex II; Short=FP; Flags: Precursor
 gi|6644394|gb|AAF21045.1|AF211482_1 SdhA [Dictyostelium discoideum]
 gi|60469073|gb|EAL67069.1| succinate dehydrogenase [Dictyostelium discoideum AX4]
          Length = 626

 Score =  735 bits (1898), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/602 (61%), Positives = 447/602 (74%), Gaps = 9/602 (1%)

Query: 11  YTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLANM 70
           Y  VDH+YD +VVGAGGAGLRA LG+ EKG+KTACITK+FPTRSHTVAAQGGI A+L N 
Sbjct: 33  YAVVDHTYDAIVVGAGGAGLRAALGLTEKGYKTACITKLFPTRSHTVAAQGGINAALGNA 92

Query: 71  TPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRPFG 130
             D W+WH YDT+KGSD+LGD DAI Y+  EA  +V ELE YGVPFSR + G+IYQR FG
Sbjct: 93  DQDDWRWHAYDTVKGSDFLGDQDAIHYMCKEAVPTVLELEQYGVPFSRMDDGRIYQRAFG 152

Query: 131 GHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCCVG 190
           G  +N+G+G    R CAAADRTGHA+LHTLYGQA+K+N +FFIEYF  DLI+ + G C G
Sbjct: 153 GQSKNFGKGGQATRCCAAADRTGHALLHTLYGQAVKHNTKFFIEYFVTDLIMEN-GDCRG 211

Query: 191 VVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDMEFV 250
           VVA  LE G IHRF +   V+ATGGYGRAYFSATSAHTCTGDG  MV RAGLP QD+EFV
Sbjct: 212 VVAINLEDGTIHRFRSHATVIATGGYGRAYFSATSAHTCTGDGNAMVIRAGLPCQDLEFV 271

Query: 251 QFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEIRE 310
           QFHPTGIYG+GCLITEGARGEGGYL+NS GERFM RYAPS  DLASRDVVSR   MEIRE
Sbjct: 272 QFHPTGIYGSGCLITEGARGEGGYLLNSSGERFMPRYAPSVADLASRDVVSRSETMEIRE 331

Query: 311 GRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMGGI 370
           GRGVG  KDH  L L HL P ++ ERLPGI E+A IFAGVDVT++PIPVIPTVHYNMGGI
Sbjct: 332 GRGVGPEKDHCLLNLTHLSPEIIDERLPGIRETAMIFAGVDVTKEPIPVIPTVHYNMGGI 391

Query: 371 PTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIRAS 430
           PTNY G+V+       ++   GL A GE+ C SVHGANRLG+NSL+D+VVFGRA      
Sbjct: 392 PTNYKGQVI-TQVDGKDKLVKGLYAAGESACVSVHGANRLGANSLLDIVVFGRAVANEIE 450

Query: 431 EMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQDSL 490
             + K +P   L  ++ +  +   D +R ++G   TA +R +MQ+ MQ +A VFR    L
Sbjct: 451 NTLAKDTPHKPLPPNAGEESIANIDAIRFSNGTRSTAEIRLEMQKIMQRNAAVFRDGQVL 510

Query: 491 SDGCRNL-SCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRGS 549
            +G   +  C    + DLK  DR++IWN+DL+E+LELQNLM  A+ T++SAEARKESRG+
Sbjct: 511 KEGVELIDKCARSLINDLKTTDRTMIWNTDLIESLELQNLMTQAVLTMHSAEARKESRGA 570

Query: 550 HAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPKAR 609
           HARED+K+     RDD NW KH+L ++D NTGK+ L+YRPV +E L    +   I P  R
Sbjct: 571 HAREDYKE-----RDDANWMKHTLSYLDVNTGKVTLNYRPVVSETL-DQSEMETIKPFKR 624

Query: 610 VY 611
           VY
Sbjct: 625 VY 626


>gi|68480862|ref|XP_715584.1| hypothetical protein CaO19.10389 [Candida albicans SC5314]
 gi|68480973|ref|XP_715528.1| hypothetical protein CaO19.2871 [Candida albicans SC5314]
 gi|46437153|gb|EAK96504.1| hypothetical protein CaO19.2871 [Candida albicans SC5314]
 gi|46437213|gb|EAK96563.1| hypothetical protein CaO19.10389 [Candida albicans SC5314]
 gi|238881234|gb|EEQ44872.1| succinate dehydrogenase flavoprotein subunit, mitochondrial
           precursor [Candida albicans WO-1]
          Length = 641

 Score =  735 bits (1897), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/605 (60%), Positives = 454/605 (75%), Gaps = 7/605 (1%)

Query: 7   LKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAAS 66
           +   Y  VDH YD VVVGAGGAGLRA  G+  +GFKTAC++K+FPTRSHTVAAQGGI A+
Sbjct: 44  MSQKYHVVDHEYDCVVVGAGGAGLRAAFGLVSEGFKTACVSKLFPTRSHTVAAQGGINAA 103

Query: 67  LANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQ 126
           L NM  D W WH YDT+KGSDWLGD DAI Y+  EAP S+YELEHYGVPFSRN+ G+IYQ
Sbjct: 104 LGNMHADDWHWHFYDTVKGSDWLGDQDAIHYMTKEAPASIYELEHYGVPFSRNDEGRIYQ 163

Query: 127 RPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEG 186
           R FGG  + +G+G    RTCA ADRTGHA+LH+LYGQ+L+++  FFIE+FA+DL++  +G
Sbjct: 164 RAFGGQSKEFGKGGQAYRTCAVADRTGHALLHSLYGQSLRHDCHFFIEFFAMDLMMK-DG 222

Query: 187 CCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQD 246
            C+G++A+  E G +HRF A   ++ATGGYGRAYFS TSAHTCTGDG  MV+RAGLPL+D
Sbjct: 223 ACIGIIAYNEEDGTLHRFFANRTIMATGGYGRAYFSCTSAHTCTGDGYAMVSRAGLPLED 282

Query: 247 MEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMM 306
           +EFVQFHP+GIYG+GCLITEGARGEGG+LVNS+GERFMERYAPSAKDLASRDVVSR + M
Sbjct: 283 LEFVQFHPSGIYGSGCLITEGARGEGGFLVNSEGERFMERYAPSAKDLASRDVVSRAITM 342

Query: 307 EIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYN 366
           EI EGRGVG  KDH++L L+H+   VL+ERLPGISE+A IFAGVDVT++PIP++PTVHYN
Sbjct: 343 EINEGRGVGPEKDHMYLQLSHIPAPVLKERLPGISETAHIFAGVDVTKEPIPILPTVHYN 402

Query: 367 MGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAV 426
           MGGIPTN+ GEVL  ++   +   PGL+A GEA CASVHGANRLG+NSL+DLVVFGRA  
Sbjct: 403 MGGIPTNWKGEVLKKSADGNDEVVPGLLACGEAACASVHGANRLGANSLLDLVVFGRAVA 462

Query: 427 IRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRT 486
               + +   +PIP          +   D+LR+A+G  PTA +R +MQ+ MQ    VFRT
Sbjct: 463 HTIRDNLQPGTPIPDHAKDIGYESIANLDKLRNANGSKPTADIRLEMQKTMQKGCAVFRT 522

Query: 487 QDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKES 546
           Q++L     ++  +     D+K  DRS+IWNSDLVETLELQNL+  A  T  SA AR ES
Sbjct: 523 QETLDQCVEHIGEVDKSFEDVKTTDRSMIWNSDLVETLELQNLLTCATQTAASAAARTES 582

Query: 547 RGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAP 606
           RG+H+R+DF D     RDDVNWRKH+L + +   G ++LDYR V    L    D   + P
Sbjct: 583 RGAHSRDDFPD-----RDDVNWRKHTLSYQETVGGPVRLDYRDVVKTTLDEN-DCKPVPP 636

Query: 607 KARVY 611
             RVY
Sbjct: 637 AKRVY 641


>gi|327305321|ref|XP_003237352.1| succinate dehydrogenase flavoprotein subunit [Trichophyton rubrum
           CBS 118892]
 gi|326460350|gb|EGD85803.1| succinate dehydrogenase flavoprotein subunit [Trichophyton rubrum
           CBS 118892]
          Length = 647

 Score =  735 bits (1897), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/608 (61%), Positives = 444/608 (73%), Gaps = 7/608 (1%)

Query: 4   SSNLKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGI 63
           S  +   Y  +DH +D VVVGAGGAGLRA  G+AE GF TAC+TK+FPTRSHTVAAQGGI
Sbjct: 47  SPFVSQKYPVIDHEFDAVVVGAGGAGLRAAFGLAEAGFNTACVTKLFPTRSHTVAAQGGI 106

Query: 64  AASLANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGK 123
            A+L NM  D W+WH+YDT+KGSDWLGD DAI Y+  EAPQSV ELE YG PFSR E G+
Sbjct: 107 NAALGNMHKDDWRWHMYDTVKGSDWLGDQDAIHYMTREAPQSVIELEGYGCPFSRTEDGR 166

Query: 124 IYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIIN 183
           IYQR FGG  Q+YG+G    R CAAADRTGHA+LHTLYGQ+L++NA +FIEYFA+DL++ 
Sbjct: 167 IYQRAFGGQSQDYGKGGQAYRCCAAADRTGHALLHTLYGQSLRHNANYFIEYFAMDLLME 226

Query: 184 SEGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLP 243
            +G C GV+A+  E G +HRF A   VLATGGYGRAYFS TSAHTCTGDG  MVARAGLP
Sbjct: 227 -DGECKGVIAYNQEDGTLHRFRAHHTVLATGGYGRAYFSCTSAHTCTGDGMAMVARAGLP 285

Query: 244 LQDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRC 303
            QD+EFVQFHPTGIYGAGCLITEG+RGEGGYL+NS GERFME+YAP+AKDLASRDVVSR 
Sbjct: 286 NQDLEFVQFHPTGIYGAGCLITEGSRGEGGYLLNSNGERFMEKYAPTAKDLASRDVVSRS 345

Query: 304 MMMEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTV 363
           M MEIREGRGVG  KDHI+L L+HL   +L ERLPGISE+A IFAGVDVT+ PIPV+PTV
Sbjct: 346 MTMEIREGRGVGPDKDHIYLQLSHLPAEILHERLPGISETASIFAGVDVTKQPIPVLPTV 405

Query: 364 HYNMGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGR 423
           HYNMGGIPT Y GEVL  +    ++  PGL A GEA C SVHGANRLG+NSL+DL+VFGR
Sbjct: 406 HYNMGGIPTKYTGEVLTLDENGNDKVVPGLYACGEAACVSVHGANRLGANSLLDLIVFGR 465

Query: 424 AAVIRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGV 483
           A      +     +P   +   +    +   D++R ADG   T  +R  MQR MQ D  V
Sbjct: 466 AVSHTVRDNASPGAPHKEISADAGAESIAALDKIRTADGSKSTFEIRNAMQRTMQSDVSV 525

Query: 484 FRTQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEAR 543
           FRTQ+SL +G   ++ +    AD+ + DRS+IWNSDLVET+EL+NL+  A  T  +A  R
Sbjct: 526 FRTQESLDEGVTKITEVDQMFADVNIKDRSMIWNSDLVETMELRNLLTCATQTAVAAANR 585

Query: 544 KESRGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSK 603
           KESRG+HARED+ +     RDD NW KH+L +     GKI L YR V+   L    +   
Sbjct: 586 KESRGAHAREDYPE-----RDDTNWMKHTLTFQKKPHGKIDLTYRAVNGHTL-DEAECKA 639

Query: 604 IAPKARVY 611
           + P  R Y
Sbjct: 640 VPPFKRTY 647


>gi|322701072|gb|EFY92823.1| succinate dehydrogenase flavoprotein subunit precursor [Metarhizium
           acridum CQMa 102]
          Length = 635

 Score =  734 bits (1896), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/608 (62%), Positives = 448/608 (73%), Gaps = 7/608 (1%)

Query: 4   SSNLKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGI 63
           S ++ + Y  +DH YD +VVGAGGAGLRA  G+AE GF TACI+K+FPTRSHTVAAQGGI
Sbjct: 35  SPHVSTKYNVIDHEYDALVVGAGGAGLRAAFGLAEAGFNTACISKLFPTRSHTVAAQGGI 94

Query: 64  AASLANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGK 123
            A+L NM  D W+WH+YDT+KGSDWLGD DAI Y+  EAP S+ ELEHYG PFSR E GK
Sbjct: 95  NAALGNMHEDDWRWHMYDTVKGSDWLGDQDAIHYMTREAPASIIELEHYGCPFSRTEEGK 154

Query: 124 IYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIIN 183
           IYQR FGG  Q YG+G    R CAAADRTGHA+LHTLYGQ+L +N  +FIEYFALDLI+ 
Sbjct: 155 IYQRAFGGQSQKYGKGGQAYRCCAAADRTGHALLHTLYGQSLAHNTNYFIEYFALDLIMQ 214

Query: 184 SEGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLP 243
            +G C GV+A+  E G +HRF A   VLATGGYGRAYFS TSAHTCTGDG  MVARAGLP
Sbjct: 215 -DGECRGVLAYNQEDGTLHRFLANNTVLATGGYGRAYFSCTSAHTCTGDGMAMVARAGLP 273

Query: 244 LQDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRC 303
            QD+EFVQFHPTGIYGAGCLITEGARGEGGYL+NS+GERFMERYAP+AKDLASRDVVSR 
Sbjct: 274 NQDLEFVQFHPTGIYGAGCLITEGARGEGGYLLNSEGERFMERYAPTAKDLASRDVVSRS 333

Query: 304 MMMEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTV 363
           M MEIR+GRGVG  KDHI+L L+HL   +L ERLPGISE+A IFAGVDV + PIPV+PTV
Sbjct: 334 MTMEIRDGRGVGAEKDHIYLQLSHLPAEILAERLPGISETAGIFAGVDVRKQPIPVLPTV 393

Query: 364 HYNMGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGR 423
           HYNMGGIPT Y GEVL  + +  ++  PGL A GEA C SVHGANRLG+NSL+DLVVFGR
Sbjct: 394 HYNMGGIPTRYTGEVLTVDEQGNDKVVPGLFACGEAACVSVHGANRLGANSLLDLVVFGR 453

Query: 424 AAVIRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGV 483
           A      +       +  L   +    ++  D++R +DG   TA +R  MQ+AMQ D  V
Sbjct: 454 AVSHTIRDNFKPGEKLKPLAADAGAEHIEVLDQVRTSDGPKSTAEIRLAMQKAMQTDVSV 513

Query: 484 FRTQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEAR 543
           FRTQ+SL +G R ++ +     ++ + DRS+IWNSDLVETLEL+NL+  A  T  SA AR
Sbjct: 514 FRTQESLDEGVRKMNAIDPMFKEVGIKDRSMIWNSDLVETLELRNLLTCATQTATSAAAR 573

Query: 544 KESRGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSK 603
           KESRG+HARED+ D     RDD NW KH+L +     GK+ L YR V +  L    +   
Sbjct: 574 KESRGAHAREDYPD-----RDDKNWMKHTLSFQKTPHGKVDLKYRGVISTTLDEN-ECKP 627

Query: 604 IAPKARVY 611
           + P  RVY
Sbjct: 628 VPPFKRVY 635


>gi|307214278|gb|EFN89374.1| Succinate dehydrogenase [ubiquinone] flavoprotein subunit,
           mitochondrial [Harpegnathos saltator]
          Length = 663

 Score =  734 bits (1895), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/622 (60%), Positives = 456/622 (73%), Gaps = 15/622 (2%)

Query: 2   KNSSNLKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQG 61
           K S  +   Y +VDH+YD VVVGAGGAGLRA  G+  +GFKTA +TK+FPTRSHTVAAQG
Sbjct: 45  KISDAISKQYPFVDHTYDAVVVGAGGAGLRAAYGLVAEGFKTAVVTKLFPTRSHTVAAQG 104

Query: 62  GIAASLANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEA 121
           GI A+L NM  D+WQWH+YDT+KGSDWLGD DAI Y+  EAP++V ELE+ G+PFSR   
Sbjct: 105 GINAALGNMEDDNWQWHMYDTVKGSDWLGDQDAIHYMTREAPKAVIELENCGMPFSRTND 164

Query: 122 GKIYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLI 181
           GKIYQR FGG    +G+G    R C  ADRTGH++LHTLYGQ+L  +  +F+EYF LDL+
Sbjct: 165 GKIYQRAFGGQSLKFGKGGQAHRCCCVADRTGHSLLHTLYGQSLSYDCNYFVEYFGLDLL 224

Query: 182 INSEGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAG 241
           +  +G C GV+A  LE G +HRF AK  VLATGGYGRAYFS TSAHTCTGDG  M++RA 
Sbjct: 225 M-EDGECRGVIALCLEDGTLHRFHAKNTVLATGGYGRAYFSCTSAHTCTGDGTAMISRAN 283

Query: 242 LPLQDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVS 301
           LP QD+EFVQFHPTGIYGAGCLITEG+RGEGGYL+NS+GERFMERYAP AKDLASRDVVS
Sbjct: 284 LPNQDLEFVQFHPTGIYGAGCLITEGSRGEGGYLINSEGERFMERYAPVAKDLASRDVVS 343

Query: 302 RCMMMEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIP 361
           R M MEIREGRGVG  KDHI+L L+HL P  L  RLPGISE+A IFAGVDVTR+PIPV+P
Sbjct: 344 RSMTMEIREGRGVGPEKDHIYLQLHHLPPEQLAARLPGISETAMIFAGVDVTREPIPVLP 403

Query: 362 TVHYNMGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVF 421
           TVHYNMGG+PTNY G+VL     N ++  PGL A GEA CASVHGANRLG+NSL+DLVVF
Sbjct: 404 TVHYNMGGVPTNYKGQVL-TKQNNQDKVVPGLYACGEAACASVHGANRLGANSLLDLVVF 462

Query: 422 GRAAVIRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDA 481
           GRA     ++       I  L  ++ +  +   D  R+A G + TA LR  MQ+ MQ  A
Sbjct: 463 GRACAKTIAQENKPGEAIGPLSSNAGEETVANLDWARNAKGSISTAELRLTMQKTMQTHA 522

Query: 482 GVFRTQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAE 541
            VFR  ++L +GCR ++ L+ ++ +LKV DRSLIWNSDL+ETLELQNLMINA+ T+  AE
Sbjct: 523 AVFRMAETLQEGCRKMTDLYKKLDELKVADRSLIWNSDLIETLELQNLMINAMQTIVGAE 582

Query: 542 ARKESRGSHAREDFKD--GEFGGRD----------DVNWRKHSLCWVDWNTGKIKLDYRP 589
            RKESRG+HAREDFK    E+              D +WRKH+L  ++  TG++ LDYRP
Sbjct: 583 QRKESRGAHAREDFKQRIDEYDYSKPLENQQPIPLDQHWRKHTLSKINPRTGEVSLDYRP 642

Query: 590 VHTELLCGGVDYSKIAPKARVY 611
           V  ++     + + + P  R Y
Sbjct: 643 V-IDVTLDQQECATVPPAIRSY 663


>gi|326472138|gb|EGD96147.1| succinate dehydrogenase flavoprotein subunit [Trichophyton
           tonsurans CBS 112818]
 gi|326477001|gb|EGE01011.1| succinate dehydrogenase flavoprotein subunit [Trichophyton equinum
           CBS 127.97]
          Length = 647

 Score =  734 bits (1895), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/608 (61%), Positives = 444/608 (73%), Gaps = 7/608 (1%)

Query: 4   SSNLKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGI 63
           S  +   Y  +DH +D VVVGAGGAGLRA  G+AE GF TAC+TK+FPTRSHTVAAQGGI
Sbjct: 47  SPFVSQKYPVIDHEFDAVVVGAGGAGLRAAFGLAEAGFNTACVTKLFPTRSHTVAAQGGI 106

Query: 64  AASLANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGK 123
            A+L NM  D W+WH+YDT+KGSDWLGD DAI Y+  EAPQSV ELE YG PFSR E G+
Sbjct: 107 NAALGNMHKDDWRWHMYDTVKGSDWLGDQDAIHYMTREAPQSVIELEGYGCPFSRTEDGR 166

Query: 124 IYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIIN 183
           IYQR FGG  Q+YG+G    R CAAADRTGHA+LHTLYGQ+L++NA +FIEYFA+DL++ 
Sbjct: 167 IYQRAFGGQSQDYGKGGQAYRCCAAADRTGHALLHTLYGQSLRHNANYFIEYFAMDLLME 226

Query: 184 SEGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLP 243
            +G C G++A+  E G +HRF A   VLATGGYGRAYFS TSAHTCTGDG  MVARAGLP
Sbjct: 227 -DGECKGIIAYNQEDGTLHRFRAHHTVLATGGYGRAYFSCTSAHTCTGDGMAMVARAGLP 285

Query: 244 LQDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRC 303
            QD+EFVQFHPTGIYGAGCLITEG+RGEGGYL+NS GERFME+YAP+AKDLASRDVVSR 
Sbjct: 286 NQDLEFVQFHPTGIYGAGCLITEGSRGEGGYLLNSNGERFMEKYAPTAKDLASRDVVSRS 345

Query: 304 MMMEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTV 363
           M MEIREGRGVG  KDHI+L L+HL   +L ERLPGISE+A IFAGVDVT+ PIPV+PTV
Sbjct: 346 MTMEIREGRGVGPDKDHIYLQLSHLPAEILHERLPGISETASIFAGVDVTKQPIPVLPTV 405

Query: 364 HYNMGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGR 423
           HYNMGGIPT Y GEVL  +    ++  PGL A GEA C SVHGANRLG+NSL+DL+VFGR
Sbjct: 406 HYNMGGIPTKYTGEVLTIDENGKDKVVPGLYACGEAACVSVHGANRLGANSLLDLIVFGR 465

Query: 424 AAVIRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGV 483
           A      +     +P   +   +    +   D++R ADG   T  +R  MQR MQ D  V
Sbjct: 466 AVSHTVRDNASPGAPHKEISADAGAESIAALDKIRTADGSKSTFEIRNAMQRTMQSDVSV 525

Query: 484 FRTQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEAR 543
           FRTQ+SL +G   ++ +     D+ + DRS+IWNSDLVET+EL+NL+  A  T  +A  R
Sbjct: 526 FRTQESLDEGVTKITEVDQMFDDVNIKDRSMIWNSDLVETMELRNLLTCATQTAVAAANR 585

Query: 544 KESRGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSK 603
           KESRG+HARED+ +     RDDVNW KH+L +     GKI L YR V+   L    +   
Sbjct: 586 KESRGAHAREDYPE-----RDDVNWMKHTLTFQKQPHGKIDLTYRAVNGHTL-DEAECKA 639

Query: 604 IAPKARVY 611
           + P  R Y
Sbjct: 640 VPPFKRTY 647


>gi|325087445|gb|EGC40755.1| succinate dehydrogenase [Ajellomyces capsulatus H88]
          Length = 647

 Score =  734 bits (1895), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/608 (62%), Positives = 448/608 (73%), Gaps = 13/608 (2%)

Query: 7   LKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAAS 66
           +  +Y  +DH YD VVVGAGGAGLRA  G+AE GF TAC++K+FPTRSHTVAAQGGI A+
Sbjct: 50  VSKNYPVIDHEYDAVVVGAGGAGLRAAFGLAEAGFNTACVSKLFPTRSHTVAAQGGINAA 109

Query: 67  LANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQ 126
           L NM  D W+WH+YDT+KGSDWLGD DAI Y+  EAPQS+ ELE YG PFSR E GKIYQ
Sbjct: 110 LGNMHEDDWRWHMYDTVKGSDWLGDQDAIHYMTREAPQSIIELEGYGCPFSRTEDGKIYQ 169

Query: 127 RPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEG 186
           R FGG  Q YG+G    R CAAADRTGHA+LHTLYGQ+L++N  +FIEYFALDL++  +G
Sbjct: 170 RAFGGQSQKYGKGGQAYRCCAAADRTGHALLHTLYGQSLRHNTNYFIEYFALDLLME-DG 228

Query: 187 CCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQD 246
            C G++A+  E G IHRF A   VLATGGYGRAYFS TSAHTCTGDG  MVARAGLP QD
Sbjct: 229 ECKGIIAYNQEDGTIHRFRAHNTVLATGGYGRAYFSCTSAHTCTGDGMAMVARAGLPNQD 288

Query: 247 MEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMM 306
           +EFVQFHPTGIYGAGCLITEG+RGEGGYL+NS+GERFMERYAP+AKDLASRDVVSR M +
Sbjct: 289 LEFVQFHPTGIYGAGCLITEGSRGEGGYLLNSEGERFMERYAPTAKDLASRDVVSRSMTL 348

Query: 307 EIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYN 366
           EIREGRGVG  KDHI+L L+HL   +L ERLPGISE+A IFAGVDVT+ PIPV+PTVHYN
Sbjct: 349 EIREGRGVGPEKDHIYLQLSHLPAEILHERLPGISETASIFAGVDVTKQPIPVLPTVHYN 408

Query: 367 MGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAV 426
           MGGIPT Y GEVL  + K  ++  PGL A GEA C SVHGANRLG+NSL+DL+VFGRA  
Sbjct: 409 MGGIPTRYTGEVLTLDEKGQDKVVPGLYACGEAACVSVHGANRLGANSLLDLIVFGRAV- 467

Query: 427 IRASEMIDKSSP-IPSLDIS--SCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGV 483
             +  + DKSSP  P  +IS  +    +   D +R A+G   T  +R  MQ+ MQ D  V
Sbjct: 468 --SHTIRDKSSPGQPHKEISADAGAESISVLDMVRTAEGSKSTFDIRNAMQKTMQTDVSV 525

Query: 484 FRTQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEAR 543
           FRTQ+SL +G R +  +     D+   DRS+IWNSDLVETLEL+NL+  A  T  +A  R
Sbjct: 526 FRTQESLDEGVRKIKEVDQMFDDVGTKDRSMIWNSDLVETLELRNLLTCATQTAIAAANR 585

Query: 544 KESRGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSK 603
           KESRG+HARED+ D     RDD NW KH+L +     GK+ L YR V+   L    +   
Sbjct: 586 KESRGAHAREDYPD-----RDDENWMKHTLTYQKQPHGKVDLTYRAVNPNTLDAN-ECKP 639

Query: 604 IAPKARVY 611
           + P  R Y
Sbjct: 640 VPPFKRTY 647


>gi|302658799|ref|XP_003021099.1| hypothetical protein TRV_04812 [Trichophyton verrucosum HKI 0517]
 gi|291184978|gb|EFE40481.1| hypothetical protein TRV_04812 [Trichophyton verrucosum HKI 0517]
          Length = 648

 Score =  734 bits (1894), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/608 (61%), Positives = 446/608 (73%), Gaps = 7/608 (1%)

Query: 4   SSNLKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGI 63
           S  +   Y  +DH +D VVVGAGGAGLRA  G+AE GF TAC+TK+FPTRSHTVAAQGGI
Sbjct: 48  SPFVSQKYPVIDHEFDAVVVGAGGAGLRAAFGLAEAGFNTACVTKLFPTRSHTVAAQGGI 107

Query: 64  AASLANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGK 123
            A+L NM  D W+WH+YDT+KGSDWLGD DAI Y+  EAPQSV ELE YG PFSR E G+
Sbjct: 108 NAALGNMHKDDWRWHMYDTVKGSDWLGDQDAIHYMTREAPQSVIELEGYGCPFSRTEDGR 167

Query: 124 IYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIIN 183
           IYQR FGG  Q+YG+G    R CAAADRTGHA+LHTLYGQ+L++NA +FIEYFA+DL++ 
Sbjct: 168 IYQRAFGGQSQDYGKGGQAYRCCAAADRTGHALLHTLYGQSLRHNANYFIEYFAMDLLME 227

Query: 184 SEGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLP 243
            +G C G++A+  E G +HRF +   VLATGGYGRAYFS TSAHTCTGDG  MVARAGLP
Sbjct: 228 -DGECKGIIAYNQEDGTLHRFRSHHTVLATGGYGRAYFSCTSAHTCTGDGMAMVARAGLP 286

Query: 244 LQDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRC 303
            QD+EFVQFHPTGIYGAGCLITEG+RGEGGYL+NS GERFME+YAP+AKDLASRDVVSR 
Sbjct: 287 NQDLEFVQFHPTGIYGAGCLITEGSRGEGGYLLNSNGERFMEKYAPTAKDLASRDVVSRS 346

Query: 304 MMMEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTV 363
           M MEIREGRGVG  KDHI+L L+HL   +L ERLPGISE+A IFAGVDVT+ PIPV+PTV
Sbjct: 347 MTMEIREGRGVGPDKDHIYLQLSHLPAEILHERLPGISETASIFAGVDVTKQPIPVLPTV 406

Query: 364 HYNMGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGR 423
           HYNMGGIPT Y GEVL  +    ++  PGL A GEA C SVHGANRLG+NSL+DL+VFGR
Sbjct: 407 HYNMGGIPTKYTGEVLTLDENGNDKVVPGLYACGEAACVSVHGANRLGANSLLDLIVFGR 466

Query: 424 AAVIRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGV 483
           A      +     +P   +   +    +   D++R ADG   T  +R  MQR MQ D  V
Sbjct: 467 AVSHTVRDNASPGAPHKEISADAGAESIAALDKIRTADGSKSTFEIRNAMQRTMQSDVSV 526

Query: 484 FRTQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEAR 543
           FRTQ+SL +G   ++ +    AD+ + DRS+IWNSDLVET+EL+NL+  A  T  +A  R
Sbjct: 527 FRTQESLDEGVTKITEVDQMFADVNIKDRSMIWNSDLVETMELRNLLTCATQTAVAAANR 586

Query: 544 KESRGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSK 603
           KESRG+HARED+ +     RDDVNW KH+L +     GKI L YR V+ + L    +   
Sbjct: 587 KESRGAHAREDYPE-----RDDVNWMKHTLTFQKQPHGKIDLTYRAVNGQTL-DEAECKA 640

Query: 604 IAPKARVY 611
           + P  R Y
Sbjct: 641 VPPFKRTY 648


>gi|294945512|ref|XP_002784717.1| conserved hypothetical protein [Perkinsus marinus ATCC 50983]
 gi|239897902|gb|EER16513.1| conserved hypothetical protein [Perkinsus marinus ATCC 50983]
          Length = 627

 Score =  734 bits (1894), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/607 (61%), Positives = 451/607 (74%), Gaps = 10/607 (1%)

Query: 8   KSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASL 67
           +++Y   DH YD VVVGAGGAGLRA  G+   G KTACI+KVFPTRSHTVAAQGGI A+L
Sbjct: 28  EANYPVHDHFYDAVVVGAGGAGLRAASGLVAHGLKTACISKVFPTRSHTVAAQGGINAAL 87

Query: 68  ANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQR 127
            NMT D W+WH YDT+KGSDWLGD DAI+++   APQ V ELE YG+PFSR + GKIYQR
Sbjct: 88  GNMTEDDWRWHAYDTVKGSDWLGDQDAIEHMCRLAPQVVLELESYGLPFSRTKEGKIYQR 147

Query: 128 PFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGC 187
            FGG    +G+G    R  AAADRTGHAILHTLYG +LK +  FFIEYFALDLI++ +G 
Sbjct: 148 AFGGQSLKFGKGGQAYRCAAAADRTGHAILHTLYGMSLKYDCLFFIEYFALDLIMDQDGS 207

Query: 188 CVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDM 247
           C GV+A  +E G IHRF A   V+ATGGYGRAY S TSAHTCTGDG GMV+RAGLPLQD+
Sbjct: 208 CKGVIAMSMEDGSIHRFGAHQTVIATGGYGRAYQSCTSAHTCTGDGGGMVSRAGLPLQDL 267

Query: 248 EFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMME 307
           EFVQFHPTGI+ AGCL+TEG RGEGG L NS+GE FM RYAP+AKDLASRDVVSR M +E
Sbjct: 268 EFVQFHPTGIFPAGCLMTEGCRGEGGILRNSEGEPFMARYAPTAKDLASRDVVSRAMTLE 327

Query: 308 IREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNM 367
           IREGRGVG +KDHI+L+L+HL    L+ERLPGISE+A+IFAGVDVT++PIPV+PTVHYNM
Sbjct: 328 IREGRGVGPNKDHIYLHLDHLPAETLRERLPGISETAKIFAGVDVTKEPIPVLPTVHYNM 387

Query: 368 GGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVI 427
           GGIPTN+  + L+  S +P R  PGL+A GEAG ASVHGANRLG+NSL+DLVVFGR A  
Sbjct: 388 GGIPTNWKAQCLNPTSSDPSRIVPGLLAAGEAGSASVHGANRLGANSLLDLVVFGRTAAD 447

Query: 428 RASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQ 487
             +E++  +SP  +L   + +  +DRFD++RHA G V TA LR K+QR MQ  A V+R  
Sbjct: 448 TVAEIVKPNSPPVTLPKDAGEATIDRFDKIRHAKGPVSTADLRSKLQRTMQTRAPVYRNG 507

Query: 488 DSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESR 547
           D L  GC  +  +  E  D+ + DR+L+WN+DL+ETLEL+NL+  A  T+ S EARKESR
Sbjct: 508 DDLKKGCEEVREIMKEYKDIGIKDRTLVWNTDLIETLELENLITQAAQTIISGEARKESR 567

Query: 548 GSHAREDFKDGEFGGRDDVNWRKHSLCWV---DWNTGKIKLDYRPVHTELLCGGVDYSKI 604
           G+HAREDF +     RDDV W KHSL +    +     I L YRPV  + L    +   +
Sbjct: 568 GAHAREDFPE-----RDDVKWMKHSLSYQTKHNVEDSDITLKYRPVVDQPL--DSEMHHV 620

Query: 605 APKARVY 611
            P  RVY
Sbjct: 621 PPAKRVY 627


>gi|322706955|gb|EFY98534.1| succinate dehydrogenase flavoprotein subunit [Metarhizium
           anisopliae ARSEF 23]
          Length = 651

 Score =  734 bits (1894), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/608 (62%), Positives = 447/608 (73%), Gaps = 7/608 (1%)

Query: 4   SSNLKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGI 63
           S ++ + Y  +DH YD +VVGAGGAGLRA  G+AE GF TACI+K+FPTRSHTVAAQGGI
Sbjct: 51  SPHVSTKYNVIDHEYDALVVGAGGAGLRAAFGLAEAGFNTACISKLFPTRSHTVAAQGGI 110

Query: 64  AASLANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGK 123
            A+L NM  D W+WH+YDT+KGSDWLGD DAI Y+  EAP S+ ELEHYG PFSR E GK
Sbjct: 111 NAALGNMHEDDWRWHMYDTVKGSDWLGDQDAIHYMTREAPASIIELEHYGCPFSRTEEGK 170

Query: 124 IYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIIN 183
           IYQR FGG  Q YG+G    R CAAADRTGHA+LHTLYGQ+L +N  +FIEYFALDLI+ 
Sbjct: 171 IYQRAFGGQSQKYGKGGQAYRCCAAADRTGHALLHTLYGQSLAHNTNYFIEYFALDLIMQ 230

Query: 184 SEGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLP 243
            +G C GV+A+  E G +HRF A   VLATGGYGRAYFS TSAHTCTGDG  MVARAGLP
Sbjct: 231 -DGECRGVLAYNQEDGTLHRFLANNTVLATGGYGRAYFSCTSAHTCTGDGMAMVARAGLP 289

Query: 244 LQDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRC 303
            QD+EFVQFHPTGIYGAGCLITEGARGEGGYL+NS+GERFMERYAP+AKDLASRDVVSR 
Sbjct: 290 NQDLEFVQFHPTGIYGAGCLITEGARGEGGYLLNSEGERFMERYAPTAKDLASRDVVSRS 349

Query: 304 MMMEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTV 363
           M MEIR+GRGVG  KDHI L L+HL   +L ERLPGISE+A IFAGVDV + PIPV+PTV
Sbjct: 350 MTMEIRDGRGVGAEKDHIFLQLSHLPAEILAERLPGISETAGIFAGVDVRKQPIPVLPTV 409

Query: 364 HYNMGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGR 423
           HYNMGGIPT Y GEVL  + +  ++  PGL A GEA C SVHGANRLG+NSL+DLVVFGR
Sbjct: 410 HYNMGGIPTRYTGEVLTVDEQGKDKVVPGLFACGEAACVSVHGANRLGANSLLDLVVFGR 469

Query: 424 AAVIRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGV 483
           A      +       +  L   +    ++  D++R +DG   TA +R  MQ+AMQ D  V
Sbjct: 470 AVSHTIRDNFKPGEKLKPLAADAGSDHIEVLDQVRTSDGPKSTAEIRLAMQKAMQTDVSV 529

Query: 484 FRTQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEAR 543
           FRTQ+SL +G R ++ +     ++ + DRS+IWNSDLVETLEL+NL+  A  T  +A AR
Sbjct: 530 FRTQESLDEGVRKMNAIDPMFKEVGIKDRSMIWNSDLVETLELRNLLTCATQTATAAAAR 589

Query: 544 KESRGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSK 603
           KESRG+HARED+ D     RDD NW KH+L +     GK+ L YR V +  L    +   
Sbjct: 590 KESRGAHAREDYPD-----RDDKNWMKHTLSFQKTPHGKVDLTYRGVISTTLDEN-ECKP 643

Query: 604 IAPKARVY 611
           + P  RVY
Sbjct: 644 VPPFKRVY 651


>gi|289622348|emb|CBI51526.1| unnamed protein product [Sordaria macrospora]
          Length = 649

 Score =  733 bits (1893), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/609 (61%), Positives = 453/609 (74%), Gaps = 9/609 (1%)

Query: 4   SSNLKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGI 63
           S +L + Y  +DH +D +VVGAGGAGLRA  G+AE GF TACI+K+FPTRSHTVAAQGGI
Sbjct: 49  SPHLSNKYHVIDHEFDAIVVGAGGAGLRAAFGLAEAGFNTACISKLFPTRSHTVAAQGGI 108

Query: 64  AASLANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGK 123
            A+L NM  D W+WH+YDT+KGSDWLGD DAI Y+  EAP S+ ELE+YG PFSR E GK
Sbjct: 109 NAALGNMHEDDWRWHMYDTVKGSDWLGDQDAIHYMTREAPASIVELENYGCPFSRTEDGK 168

Query: 124 IYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIIN 183
           IYQR FGG  + +G+G    R CAAADRTGHA+LHTLYGQ+L++N  +FIEYFA+DLI+ 
Sbjct: 169 IYQRAFGGQSKEFGKGGQAYRCCAAADRTGHALLHTLYGQSLRHNTNYFIEYFAIDLIMQ 228

Query: 184 SEGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLP 243
            +G C GV+A+  E G +HRF A   VLATGGYGRAYFS TSAHTCTGDG+ MVARAGLP
Sbjct: 229 -DGECRGVLAYNQEDGTLHRFLANNTVLATGGYGRAYFSCTSAHTCTGDGSAMVARAGLP 287

Query: 244 LQDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRC 303
            QD+EFVQFHPTGIYGAGCLITEGARGEGGYL+NS+GERFMERYAP+AKDLASRDVVSR 
Sbjct: 288 NQDLEFVQFHPTGIYGAGCLITEGARGEGGYLLNSEGERFMERYAPTAKDLASRDVVSRS 347

Query: 304 MMMEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTV 363
           M MEIREGRGVG  KDHI+L L+HL   +L ERLPGISE+A IFAGVDV + PIPV+PTV
Sbjct: 348 MTMEIREGRGVGPEKDHIYLQLSHLPAEILAERLPGISETAGIFAGVDVRKQPIPVLPTV 407

Query: 364 HYNMGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGR 423
           HYNMGGIPT Y GEVL  + K  ++  PGL A GEA   SVHGANRLG+NSL+DLVVFGR
Sbjct: 408 HYNMGGIPTRYTGEVLTVDEKGNDKVVPGLFACGEAASVSVHGANRLGANSLLDLVVFGR 467

Query: 424 AAVIRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGV 483
           A      +    S+ +  +   +    ++  D++R +DG   TA +R  MQ+ MQ D  V
Sbjct: 468 AVSHTIRDNFTPSAKLKPVAADAGADSIEVLDKIRTSDGPKSTAEIRLAMQKTMQRDVSV 527

Query: 484 FRTQDSLSDGCRNLSCLWDEMAD-LKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEA 542
           FRTQ+SL +G   ++ + D+M D + + DRS+IWNSDLVETLEL+NL+  A  T  SA  
Sbjct: 528 FRTQESLDEGVEKITQV-DQMFDQVGIKDRSMIWNSDLVETLELRNLLTCATQTAVSAAN 586

Query: 543 RKESRGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYS 602
           RKESRG+HARED+ +     RDD NW KH+L W     GKI+L YR V  + L    + +
Sbjct: 587 RKESRGAHAREDYPE-----RDDANWMKHTLSWQKQPHGKIELGYRRVIDKTL-DEKECA 640

Query: 603 KIAPKARVY 611
            + P  RVY
Sbjct: 641 PVPPFKRVY 649


>gi|126320852|ref|XP_001368606.1| PREDICTED: similar to flavoprotein subunit of complex II
           [Monodelphis domestica]
          Length = 662

 Score =  733 bits (1893), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/622 (59%), Positives = 457/622 (73%), Gaps = 15/622 (2%)

Query: 2   KNSSNLKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQG 61
           K S+++ + Y  VDH +D +VVGAGGAGLRA  G++E GF TACITK+FPTRSHTVAAQG
Sbjct: 44  KVSNSISTQYPVVDHEFDALVVGAGGAGLRAAFGLSEAGFNTACITKLFPTRSHTVAAQG 103

Query: 62  GIAASLANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEA 121
           GI A+L NM  D+W+WH YDT+KGSDWLGD DAI Y+  +AP SV ELE+YG+PFSR E 
Sbjct: 104 GINAALGNMEEDNWRWHFYDTVKGSDWLGDQDAIHYMTEQAPASVIELENYGMPFSRTEE 163

Query: 122 GKIYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLI 181
           GKIYQR FGG    +G+G    R C  ADRTGH++LHTLYG++L+ +  +F+EYFALDL+
Sbjct: 164 GKIYQRAFGGQSLKFGKGGQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLL 223

Query: 182 INSEGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAG 241
           +  +G C GV+A  +E G IHR  AK  V+ATGGYGR YFS TSAHT TGDG  MV RAG
Sbjct: 224 ME-DGECRGVIALCIEDGSIHRIRAKNTVIATGGYGRTYFSCTSAHTSTGDGTAMVTRAG 282

Query: 242 LPLQDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVS 301
           LP QD+EFVQFHPTGIYGAGCLITEG RGEGG L+NS+GERFMERYAP AKDLASRDVVS
Sbjct: 283 LPCQDLEFVQFHPTGIYGAGCLITEGCRGEGGILINSQGERFMERYAPVAKDLASRDVVS 342

Query: 302 RCMMMEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIP 361
           R M +EIREGRG G  KDH++L L+HL P  L  RLPGISE+A IFAGVDVT++PIPV+P
Sbjct: 343 RSMTIEIREGRGCGPEKDHVYLQLHHLPPEQLSTRLPGISETAMIFAGVDVTKEPIPVLP 402

Query: 362 TVHYNMGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVF 421
           TVHYNMGGIPTNY G+VL  +    ++  PGL A GEA  ASVHGANRLG+NSL+DLVVF
Sbjct: 403 TVHYNMGGIPTNYKGQVL-THVNGRDQVVPGLYACGEAASASVHGANRLGANSLLDLVVF 461

Query: 422 GRAAVIRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDA 481
           GRA  +  +E       +P +  ++ +  +   D+LR A G + T+ LR  MQ++MQ  A
Sbjct: 462 GRACALSIAETCKPGDKVPQIKANAGEESVANLDKLRFASGDIRTSELRLNMQKSMQNHA 521

Query: 482 GVFRTQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAE 541
            VFR    L +GC+ LS L++++ +LK  DR ++WN+DLVETLELQNLM+ A+ T++ AE
Sbjct: 522 AVFRVGSVLQEGCQILSQLYNDLKNLKTFDRGMVWNTDLVETLELQNLMLCALQTIHGAE 581

Query: 542 ARKESRGSHAREDFK------------DGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRP 589
           ARKESRG+HARED+K            +G+     + +WRKH+L +VD  TGK+ L+YRP
Sbjct: 582 ARKESRGAHAREDYKVRIDEYDYSKPIEGQRKKPFEEHWRKHTLSYVDVKTGKVSLEYRP 641

Query: 590 VHTELLCGGVDYSKIAPKARVY 611
           V  + L    D + + P  R Y
Sbjct: 642 VIDKTL-NEADCATVPPAIRSY 662


>gi|169626511|ref|XP_001806655.1| hypothetical protein SNOG_16547 [Phaeosphaeria nodorum SN15]
 gi|160706111|gb|EAT76087.2| hypothetical protein SNOG_16547 [Phaeosphaeria nodorum SN15]
          Length = 643

 Score =  733 bits (1893), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/594 (62%), Positives = 442/594 (74%), Gaps = 13/594 (2%)

Query: 4   SSNLKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGI 63
           S  +   Y  +DH YD +VVGAGGAGLRA  G+AE GF TACI+K+FPTRSHTVAAQGGI
Sbjct: 36  SGFISQKYPVIDHEYDAIVVGAGGAGLRAAFGLAEAGFNTACISKLFPTRSHTVAAQGGI 95

Query: 64  AASLA-------NMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPF 116
            A+L        +M  D W+WH+YDT+KGSDWLGD DAI Y+  EAPQSV ELE+YG PF
Sbjct: 96  NAALGKYADQVFSMHEDDWRWHMYDTVKGSDWLGDQDAIHYMTREAPQSVIELENYGCPF 155

Query: 117 SRNEAGKIYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYF 176
           SR + GKIYQR FGG  Q YG+G    R CAAADRTGHA+LHTLYGQ+L++N ++FIE+F
Sbjct: 156 SRTDDGKIYQRAFGGQSQKYGKGGQAYRCCAAADRTGHALLHTLYGQSLRHNTKYFIEFF 215

Query: 177 ALDLIINSEGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGM 236
           A DLI+  +G C GV+A+  E G IHRF AK  VLATGGYGRAYFS TSAHTCTGDG  M
Sbjct: 216 ATDLIME-DGVCKGVIAYNQEDGTIHRFIAKNTVLATGGYGRAYFSCTSAHTCTGDGMAM 274

Query: 237 VARAGLPLQDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLAS 296
           VARAGLP QD+EFVQFHPTGIYGAGCLITEG+RGEGGYL+NS+GERFMERYAP+AKDLAS
Sbjct: 275 VARAGLPNQDLEFVQFHPTGIYGAGCLITEGSRGEGGYLLNSEGERFMERYAPTAKDLAS 334

Query: 297 RDVVSRCMMMEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDP 356
           RDVVSR M +EIREGRGVG  KDHI+L L+HL P VL ERLPGISE+A IFAGVDVT+ P
Sbjct: 335 RDVVSRSMTLEIREGRGVGPEKDHIYLQLSHLPPEVLHERLPGISETAAIFAGVDVTKQP 394

Query: 357 IPVIPTVHYNMGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLI 416
           IPV+PTVHYNMGGIPT Y GEV+  ++K  ++  PGL A GEA   SVHGANRLG+NSL+
Sbjct: 395 IPVLPTVHYNMGGIPTKYTGEVITQDAKGNDQVVPGLFACGEAASVSVHGANRLGANSLL 454

Query: 417 DLVVFGRAAVIRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRA 476
           DL+VFGRA      +         ++   +    +   D++R ++G   TA +R  MQ+ 
Sbjct: 455 DLIVFGRAVSHTIRDNFSPGQKADAVAADAGADSIAVLDKIRTSEGSKSTAEVRLAMQKV 514

Query: 477 MQLDAGVFRTQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIAT 536
           MQ D  VFRTQ+SL +G + ++ +  + AD+ + DRS+IWNSDLVETLEL+NL+  A+ T
Sbjct: 515 MQTDVAVFRTQESLDEGVKKINEVDSQFADVGIKDRSMIWNSDLVETLELRNLLTCAVQT 574

Query: 537 VYSAEARKESRGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPV 590
             SA  R+ESRG+HAREDF D     RDD  W KH+L W     GK +L YR V
Sbjct: 575 AESAANRQESRGAHAREDFPD-----RDDEKWMKHTLSWQKQPHGKTELGYRKV 623


>gi|328873340|gb|EGG21707.1| succinate dehydrogenase [Dictyostelium fasciculatum]
          Length = 671

 Score =  733 bits (1892), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/612 (60%), Positives = 451/612 (73%), Gaps = 9/612 (1%)

Query: 2   KNSSNLKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQG 61
           ++      +Y  +DH+YD +VVGAGGAGLRA LG+ EKG KTACI+K+FPTRSHTVAAQG
Sbjct: 67  ESQGQFSRAYPVIDHTYDAIVVGAGGAGLRAALGLTEKGLKTACISKLFPTRSHTVAAQG 126

Query: 62  GIAASLANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEA 121
           GI A+LAN   D W+WH YDT+KGSDWLGD DAI Y+  EA  +V ELE YGVPFSR + 
Sbjct: 127 GINAALANADVDDWRWHAYDTVKGSDWLGDQDAIHYMCREAVPTVLELEQYGVPFSRMDD 186

Query: 122 GKIYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLI 181
           G+IYQR FGG  +N+G+G    R CAAADRTGHA+LHTLYGQ+LK++ +FFIEYF  DLI
Sbjct: 187 GRIYQRAFGGQSKNFGKGGQATRCCAAADRTGHALLHTLYGQSLKHDTKFFIEYFVTDLI 246

Query: 182 INSEGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAG 241
           + + G C GV+A+ +E G IHRF +   VLATGGYGRAYFSATSAHTCTGDG  MV RAG
Sbjct: 247 MEN-GECRGVIAYCMEDGTIHRFRSHATVLATGGYGRAYFSATSAHTCTGDGNAMVTRAG 305

Query: 242 LPLQDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVS 301
           LP QD+EFVQFHPTGIYG+GCLITEGARGEGGYL+NS+GERFM RYAPS  DLASRDVVS
Sbjct: 306 LPCQDLEFVQFHPTGIYGSGCLITEGARGEGGYLLNSEGERFMPRYAPSVADLASRDVVS 365

Query: 302 RCMMMEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIP 361
           R + MEI  GRGVG  KDH  L L HL P +++ERLPGI E+A IFAGVD+T++PIP++P
Sbjct: 366 RSITMEILAGRGVGPEKDHALLNLTHLSPDIIEERLPGIRETAMIFAGVDITKEPIPILP 425

Query: 362 TVHYNMGGIPTNYWGEVLDAN-SKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVV 420
           TVHYNMGG+PTNY GEV+     +  +    GL A GEA C SVHGANRLG+NSL+D+VV
Sbjct: 426 TVHYNMGGVPTNYKGEVVTRQPGEKTDTVVKGLYAAGEAACVSVHGANRLGANSLLDIVV 485

Query: 421 FGRAAVIRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLD 480
           FGRA     ++ + K +P   L  ++ +  +   D++R ADG   TA LR +MQ+ MQ  
Sbjct: 486 FGRACANTIADTLAKDTPHRPLPANAGEESIANLDKVRFADGTRSTAELRLEMQKVMQRH 545

Query: 481 AGVFRTQDSLSDGCRNLSCLWDEM-ADLKVHDRSLIWNSDLVETLELQNLMINAIATVYS 539
           A VFR    L +G  N+      +  DLK  DR++IWNSDLVE+LELQNLM  A+ T++S
Sbjct: 546 AAVFRDGPILKEGVTNIDKFAQSLKTDLKTTDRNMIWNSDLVESLELQNLMTQAVLTMHS 605

Query: 540 AEARKESRGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGV 599
           AEARKESRG+HAREDF +     RDDVNW KH+L ++D  TGK+ LDYRPV    L    
Sbjct: 606 AEARKESRGAHAREDFTE-----RDDVNWMKHTLSYLDVETGKVTLDYRPVIGHTL-DEA 659

Query: 600 DYSKIAPKARVY 611
           +   I P  RVY
Sbjct: 660 EMHSIPPAKRVY 671


>gi|213404298|ref|XP_002172921.1| succinate dehydrogenase flavoprotein subunit [Schizosaccharomyces
           japonicus yFS275]
 gi|212000968|gb|EEB06628.1| succinate dehydrogenase flavoprotein subunit [Schizosaccharomyces
           japonicus yFS275]
          Length = 641

 Score =  733 bits (1892), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/611 (59%), Positives = 453/611 (74%), Gaps = 9/611 (1%)

Query: 3   NSSNLKSSYTY--VDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQ 60
             +N  SS  Y  +DH+YD +VVGAGGAGLRA  G+AE GF TACITK+FPTRSHTVAAQ
Sbjct: 38  QQANTPSSVKYPLIDHTYDAIVVGAGGAGLRAAFGLAEAGFNTACITKLFPTRSHTVAAQ 97

Query: 61  GGIAASLANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNE 120
           GGI A+L NM  D W+WH YDT+KGSDWLGD DAI Y+  EAP++V ELEH+GVPFSR +
Sbjct: 98  GGINAALGNMGKDDWRWHFYDTVKGSDWLGDQDAIHYMTKEAPKTVLELEHFGVPFSRTK 157

Query: 121 AGKIYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDL 180
            GKIYQR FGG    YG+G    R  A ADRTGH+ILHTLYGQ+L++N  FFIEYFA+DL
Sbjct: 158 DGKIYQRAFGGQSLEYGKGGQAYRCAAVADRTGHSILHTLYGQSLRHNTNFFIEYFAMDL 217

Query: 181 IINSEGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARA 240
           ++ + G C GV+A  LE G IHRF A   VLATGGYGRAYFS TSAHTCTGDG  MV+RA
Sbjct: 218 LMEN-GTCRGVIAMNLEDGTIHRFRAHKTVLATGGYGRAYFSCTSAHTCTGDGNAMVSRA 276

Query: 241 GLPLQDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVV 300
           GLPLQD+EFVQFHPTGIYGAGCLITEG RGEGGYL+NS GERFMERYAP+AKDLASRDVV
Sbjct: 277 GLPLQDLEFVQFHPTGIYGAGCLITEGCRGEGGYLLNSNGERFMERYAPTAKDLASRDVV 336

Query: 301 SRCMMMEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVI 360
           SR M +EIREGRGVG  KDH++L L+HL   V++ERLPGI E+A IFAGVDVT++PIPV+
Sbjct: 337 SRSMTIEIREGRGVGPEKDHLYLQLSHLPHEVIRERLPGIVETAAIFAGVDVTKEPIPVL 396

Query: 361 PTVHYNMGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVV 420
           PTVHYNMGGIPT + GEVL  +    ++  PGL A GEA C SVHG NRLG+NSL+D+VV
Sbjct: 397 PTVHYNMGGIPTRFTGEVLTVDDNGHDKVVPGLYAAGEAACVSVHGGNRLGANSLLDIVV 456

Query: 421 FGRAAVIRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLD 480
           FGRA  +   E ++ ++P   L   +  + ++  D++R + G   T+ +R  MQ++MQ D
Sbjct: 457 FGRACALHIKETLEPNTPHKPLQPDAGLKSLEILDKIRTSTGPKHTSVIRLDMQKSMQRD 516

Query: 481 AGVFRTQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSA 540
             VFRT+D+L  G +N+  + + + DL + DRSLIWN+DL+ETLEL+NL+  A+ T  +A
Sbjct: 517 VSVFRTEDTLQAGVKNIQNVDNSLNDLGIRDRSLIWNTDLIETLELRNLLTCAVQTATAA 576

Query: 541 EARKESRGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVD 600
             R+ESRG+HARED+ +     RDD +W KH+L W   +   + + YR V ++ L    +
Sbjct: 577 LNRRESRGAHAREDYPE-----RDDEHWMKHTLTWQKESGAPVTIKYRNVTSKTLDEN-E 630

Query: 601 YSKIAPKARVY 611
              + P  RVY
Sbjct: 631 VKPVPPGKRVY 641


>gi|221129803|ref|XP_002164117.1| PREDICTED: similar to predicted protein [Hydra magnipapillata]
          Length = 654

 Score =  733 bits (1891), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/617 (59%), Positives = 452/617 (73%), Gaps = 15/617 (2%)

Query: 7   LKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAAS 66
           L   Y  VDH+YD VVVGAGGAGLRA  G+A  GFKTAC+TK+FPTRSHTVAAQGGI A+
Sbjct: 41  LSRQYPVVDHTYDCVVVGAGGAGLRAAFGLANAGFKTACVTKLFPTRSHTVAAQGGINAA 100

Query: 67  LANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQ 126
           L NM  D W+WH+YDT+KGSDWLGD DAI Y+  EAP +VYELE+YG+PFSR E G+IYQ
Sbjct: 101 LGNMEKDDWRWHMYDTVKGSDWLGDQDAIHYMTREAPAAVYELENYGMPFSRTEEGRIYQ 160

Query: 127 RPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEG 186
           R FGG   NYG+     R CA ADRTGH++LHTLYGQ+L+ +  +FIEYFALDL+++ +G
Sbjct: 161 RAFGGQSLNYGKNGQAHRCCAVADRTGHSLLHTLYGQSLRYDCNYFIEYFALDLLMD-KG 219

Query: 187 CCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQD 246
            CVG++A  LE G +HR  AK  VLATGG GR YFS TSAHTCTGDG  MV RAGL  +D
Sbjct: 220 KCVGIIALNLEDGSLHRIKAKNTVLATGGSGRTYFSCTSAHTCTGDGTAMVTRAGLANED 279

Query: 247 MEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMM 306
           +EF+QFHPTGIYGAGCLITEG RGEGGYL+NS+GERFMERYAP+AKDLASRDVVSR M +
Sbjct: 280 LEFIQFHPTGIYGAGCLITEGCRGEGGYLINSEGERFMERYAPTAKDLASRDVVSRSMTI 339

Query: 307 EIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYN 366
           E+REGRG G  KDH++L L+HL   +L+ RLPGISE+A IFAGVDVTRDPIPV+PT HYN
Sbjct: 340 EMREGRGCGPEKDHVYLQLSHLPQEILKSRLPGISETAMIFAGVDVTRDPIPVLPTCHYN 399

Query: 367 MGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAV 426
           MGGIPTN+ G+V+  +    +    GL A GEA CASVHGANRLG+NSL+DLV+FGRA  
Sbjct: 400 MGGIPTNFNGQVIQ-HHNGKDVIVEGLYAAGEAACASVHGANRLGANSLLDLVIFGRACA 458

Query: 427 IRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRT 486
           +  +        IP L     +  +   D++R A+GH PTA LR KMQ+ MQ  A VFRT
Sbjct: 459 LDIAAKNKPGDSIPDLPSDIGEVSVANLDKVRFANGHTPTANLRLKMQKIMQGHAAVFRT 518

Query: 487 QDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKES 546
              L++G   +   +DE+ D K++DR +IWN+DLVE LELQNLM+N+   + SAEARKES
Sbjct: 519 GAVLAEGVSKIYQAYDELKDFKLYDRGMIWNTDLVEALELQNLMLNSCQAMVSAEARKES 578

Query: 547 RGSHAREDFK------------DGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTEL 594
           RG+HARED+K            +G+     + +WRKH+L + +  TGK+ LDYRPV    
Sbjct: 579 RGAHAREDYKMRIDEFDYSKPLEGQKKKPLNEHWRKHTLSYQNIETGKVSLDYRPVIDAT 638

Query: 595 LCGGVDYSKIAPKARVY 611
           L   V+ + + P  R Y
Sbjct: 639 L-DEVECAMVPPAIRSY 654


>gi|332019677|gb|EGI60151.1| Succinate dehydrogenase [ubiquinone] flavoprotein subunit,
           mitochondrial [Acromyrmex echinatior]
          Length = 662

 Score =  733 bits (1891), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/622 (60%), Positives = 459/622 (73%), Gaps = 15/622 (2%)

Query: 2   KNSSNLKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQG 61
           K S+ +   Y  V+H+YD VVVGAGGAGLRA  G+  +GFKTA +TK+FPTRSHTVAAQG
Sbjct: 44  KISNEISKQYPLVNHTYDAVVVGAGGAGLRAAYGLVAEGFKTAVVTKLFPTRSHTVAAQG 103

Query: 62  GIAASLANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEA 121
           GI A+L NM  D+WQWH+YDT+KGSDWLGD DAI Y+  EAP++V ELE+ G+PFSR   
Sbjct: 104 GINAALGNMEDDNWQWHMYDTVKGSDWLGDQDAIHYMTREAPKAVIELENCGMPFSRTTD 163

Query: 122 GKIYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLI 181
           GKIYQR FGG    +G+G    R C  ADRTGH++LHTLYGQ+L  +  +F+EYFALDL+
Sbjct: 164 GKIYQRAFGGQSLKFGKGGQAHRCCCVADRTGHSLLHTLYGQSLSYDCNYFVEYFALDLL 223

Query: 182 INSEGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAG 241
           +  +G C GV+A  LE G +HRF AK  VLATGGYGRAYFS TSAHTCTGDG  MV+RA 
Sbjct: 224 M-EDGECRGVIALCLEDGTLHRFHAKNTVLATGGYGRAYFSCTSAHTCTGDGTAMVSRAN 282

Query: 242 LPLQDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVS 301
           LP QD+EFVQFHPTGIYGAGCLITEG+RGEGGYL+NS+GERFMERYAP AKDLASRDVVS
Sbjct: 283 LPNQDLEFVQFHPTGIYGAGCLITEGSRGEGGYLINSEGERFMERYAPVAKDLASRDVVS 342

Query: 302 RCMMMEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIP 361
           R M MEIREGRGVG  KDHI+L L+HL P  L  RLPGISE+A IFAGVDVTR+PIPVIP
Sbjct: 343 RSMTMEIREGRGVGPEKDHIYLQLHHLPPEQLAARLPGISETAMIFAGVDVTREPIPVIP 402

Query: 362 TVHYNMGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVF 421
           TVHYNMGG+PTNY G+VL     N ++  PGL A GEA CASVHGANRLG+NSL+DLVVF
Sbjct: 403 TVHYNMGGVPTNYKGQVL-IRENNQDKIVPGLYACGEAACASVHGANRLGANSLLDLVVF 461

Query: 422 GRAAVIRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDA 481
           GRA     ++       I  L  ++ +  +   D +R+A+G + TA LR  MQ+ MQ  A
Sbjct: 462 GRACAKTIAQENKPGEAIGPLRSNAGEETVANLDWVRNANGSISTAELRLTMQKTMQTHA 521

Query: 482 GVFRTQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAE 541
            VFR  ++L +GCR +S L+ ++ +LKV D+SLIWNSDL+ETLELQNLMINA+ T+  A+
Sbjct: 522 AVFRDAETLQEGCRKMSDLYKKLNELKVADKSLIWNSDLIETLELQNLMINAMQTIIGAD 581

Query: 542 ARKESRGSHAREDFK------------DGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRP 589
            RKESRG+HARED+K            + +     + +WRKH+L  ++  TG++ LDYRP
Sbjct: 582 NRKESRGAHAREDYKQRIDEYDYSKPIENQQPKPFNQHWRKHTLSKINPKTGEVSLDYRP 641

Query: 590 VHTELLCGGVDYSKIAPKARVY 611
           V  ++     + + + P  R Y
Sbjct: 642 V-IDVTLSQQECATVPPAIRSY 662


>gi|260950079|ref|XP_002619336.1| conserved hypothetical protein [Clavispora lusitaniae ATCC 42720]
 gi|238846908|gb|EEQ36372.1| conserved hypothetical protein [Clavispora lusitaniae ATCC 42720]
          Length = 629

 Score =  732 bits (1890), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/612 (60%), Positives = 456/612 (74%), Gaps = 9/612 (1%)

Query: 1   MKNSSNLKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQ 60
           + ++  L   Y  +DH YD VVVGAGGAGLRA  G+AE GFKTAC+TK+FPTRSHTVAAQ
Sbjct: 26  VNSTKYLGQKYHVIDHEYDCVVVGAGGAGLRAAFGLAEAGFKTACVTKLFPTRSHTVAAQ 85

Query: 61  GGIAASLANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNE 120
           GGI A+L NM  D W WH+YDT+KGSDWLGD DAI Y+  EAPQS+YELE+YGVPFSRNE
Sbjct: 86  GGINAALGNMHKDDWHWHMYDTVKGSDWLGDQDAIHYMTKEAPQSIYELENYGVPFSRNE 145

Query: 121 AGKIYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDL 180
            G+IYQR FGG  + YG+G    RTCA ADRTGHA+LH+LYGQ+L+++  FFIE+FA+DL
Sbjct: 146 EGRIYQRAFGGQSKEYGKGGQAYRTCAVADRTGHALLHSLYGQSLRHDTHFFIEFFAMDL 205

Query: 181 IINSEGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARA 240
           ++  +G CVGVVA+  E G +HRF A   VLATGGYGRAYFS TSAHTCTGDG  M +RA
Sbjct: 206 MMQ-DGECVGVVAYNQEDGTLHRFRAHKTVLATGGYGRAYFSCTSAHTCTGDGYAMASRA 264

Query: 241 GLPLQDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVV 300
           GLPLQD+EFVQFHP+GIYG+GCLITEGARGEGGYL+NS+GERFMERYAP AKDLASRDVV
Sbjct: 265 GLPLQDLEFVQFHPSGIYGSGCLITEGARGEGGYLINSEGERFMERYAPHAKDLASRDVV 324

Query: 301 SRCMMMEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVI 360
           SR + MEI EGRGVG  KDH+ L L+H+  +VL+ERLPGISE+A IFAGVDVT++PIP++
Sbjct: 325 SRAITMEINEGRGVGPEKDHMFLQLSHIPASVLKERLPGISETAHIFAGVDVTKEPIPIL 384

Query: 361 PTVHYNMGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVV 420
           PTVHYNMGGIPT + GEVL  N K  +   PGL+A GE  CASVHGANRLG+NSL+DLVV
Sbjct: 385 PTVHYNMGGIPTRWTGEVLKKNEKGEDEVVPGLLACGEVACASVHGANRLGANSLLDLVV 444

Query: 421 FGRAAVIRASEMIDKSSPI-PSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQL 479
           FGRA      + +   +P+ P       D I +  D+LR+A+G   TA +R  MQ+ MQ 
Sbjct: 445 FGRAVSHTIRDSLTPGTPLKPVPKDLGLDSIAN-LDKLRNANGTKSTAEIRLAMQKTMQK 503

Query: 480 DAGVFRTQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYS 539
              VFRTQ++L +  +N++ + +    +K  DRS+IWNSDLVETLELQNL+  A  T  S
Sbjct: 504 GCAVFRTQETLDECVKNINEVDETFKHVKTTDRSMIWNSDLVETLELQNLLTCATQTAAS 563

Query: 540 AEARKESRGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGV 599
           A AR ESRG+HAR+D+ D     R+D  W KH+L + +     ++LDYR V +  L    
Sbjct: 564 AAARPESRGAHARDDYPD-----RNDAEWMKHTLSYQEKFGAPVRLDYRNVISHTLDEN- 617

Query: 600 DYSKIAPKARVY 611
           D   + P  RVY
Sbjct: 618 DCKSVPPAKRVY 629


>gi|171687299|ref|XP_001908590.1| hypothetical protein [Podospora anserina S mat+]
 gi|170943611|emb|CAP69263.1| unnamed protein product [Podospora anserina S mat+]
          Length = 648

 Score =  732 bits (1890), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/608 (61%), Positives = 447/608 (73%), Gaps = 8/608 (1%)

Query: 4   SSNLKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGI 63
           S  + S Y  +DH YD +VVGAGGAGLRA  G+AE GF TACI+K+FPTRSHTVAAQGGI
Sbjct: 49  SPFVSSKYPVIDHEYDAIVVGAGGAGLRAAFGLAEAGFNTACISKLFPTRSHTVAAQGGI 108

Query: 64  AASLANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGK 123
            A+L NM  D W+WH+YDT+KGSDWLGD DAI Y+  EAP S+ ELE+YG PFSR E GK
Sbjct: 109 NAALGNMHKDDWRWHMYDTVKGSDWLGDQDAIHYMTREAPASIIELENYGCPFSRTEDGK 168

Query: 124 IYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIIN 183
           IYQR FGG  + YG+G    R CAAADRTGHA+LHTLYGQ+L++N  +FIEYFA+DLI+ 
Sbjct: 169 IYQRAFGGQSKEYGKGGQAYRCCAAADRTGHALLHTLYGQSLRHNTNYFIEYFAIDLIMQ 228

Query: 184 SEGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLP 243
            +G C GV+A+  E G +HRF A   VLATGGYGRAYFS TSAHTCTGDG  MVARAGLP
Sbjct: 229 -DGECRGVLAYNQEDGTLHRFLANNTVLATGGYGRAYFSCTSAHTCTGDGMAMVARAGLP 287

Query: 244 LQDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRC 303
            QD+EFVQFHPTGIYGAGCLITEGARGEGGYL+NS+GERFMERYAP+AKDLASRDVVSR 
Sbjct: 288 NQDLEFVQFHPTGIYGAGCLITEGARGEGGYLLNSEGERFMERYAPTAKDLASRDVVSRS 347

Query: 304 MMMEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTV 363
           M MEIR+GRGVG  KDHI+L L+HL   +L ERLPGISE+A IFAGVDV + PIPV+PTV
Sbjct: 348 MTMEIRDGRGVGAEKDHIYLQLSHLPAEILAERLPGISETAGIFAGVDVRKQPIPVLPTV 407

Query: 364 HYNMGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGR 423
           HYNMGGIPT Y GEVL  +    ++  PGL A GEA C SVHGANRLG+NSL+DLVVFGR
Sbjct: 408 HYNMGGIPTRYTGEVLTVDESGNDKVVPGLFACGEAACVSVHGANRLGANSLLDLVVFGR 467

Query: 424 AAVIRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGV 483
           A      +     + +  ++  +    ++  D++R ADG   TA +R  MQ+ MQ D  V
Sbjct: 468 AVAHTIRDNFTPGAKLKPVEADAGAAEIEMLDKIRTADGPKSTAEIRLAMQKTMQRDVSV 527

Query: 484 FRTQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEAR 543
           FRTQ+SL +G   ++ +    + + + DRS+IWNSDLVETLEL+NL+  A+ T  +A  R
Sbjct: 528 FRTQESLDEGVEKINQVDQTFSQVGIKDRSMIWNSDLVETLELRNLLTCAVQTATAAANR 587

Query: 544 KESRGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSK 603
           KESRG+HARED+ D     RDD NW KH+L W   + GK+ L YR V    L    +   
Sbjct: 588 KESRGAHAREDYPD-----RDDENWMKHTLTWQKPH-GKVDLKYRRVIGTTLDEN-ECKP 640

Query: 604 IAPKARVY 611
           + P  RVY
Sbjct: 641 VPPFKRVY 648


>gi|205831554|sp|Q7ZVF3|DHSA_DANRE RecName: Full=Succinate dehydrogenase [ubiquinone] flavoprotein
           subunit, mitochondrial; AltName: Full=Flavoprotein
           subunit of complex II; Short=Fp; Flags: Precursor
 gi|94733755|emb|CAK11468.1| succinate dehydrogenase complex, subunit A, flavoprotein (Fp)
           [Danio rerio]
          Length = 661

 Score =  732 bits (1890), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/622 (59%), Positives = 455/622 (73%), Gaps = 15/622 (2%)

Query: 2   KNSSNLKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQG 61
           K S  + + Y  VDH +D VVVGAGGAGLRA  G++E GF TAC+TK+FPTRSHTVAAQG
Sbjct: 43  KISDGVSNQYPVVDHEFDAVVVGAGGAGLRAAFGLSEAGFNTACVTKLFPTRSHTVAAQG 102

Query: 62  GIAASLANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEA 121
           GI A+L NM  D W+WH YDT+KGSDWLGD DAI Y+  +AP +V ELE++G+PFSR + 
Sbjct: 103 GINAALGNMEQDDWRWHFYDTVKGSDWLGDQDAIHYMTEQAPAAVVELENFGMPFSRTDD 162

Query: 122 GKIYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLI 181
           GKIYQR FGG    +G+G    R C  ADRTGH++LHTLYG++L+ +  +F+EYFALDL+
Sbjct: 163 GKIYQRAFGGQSLKFGKGGQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLL 222

Query: 182 INSEGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAG 241
           +  +G C GV+A  +E G IHRF AK  V+ATGGYGR +FS TSAHT TGDG  MV RAG
Sbjct: 223 ME-DGECKGVIALCMEDGSIHRFRAKNTVIATGGYGRTFFSCTSAHTSTGDGNAMVTRAG 281

Query: 242 LPLQDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVS 301
           LP QD+EFVQFHPTGIYGAGCLITEG RGEGG L+NS+GERFMERYAP+AKDLASRDVVS
Sbjct: 282 LPCQDLEFVQFHPTGIYGAGCLITEGCRGEGGILINSEGERFMERYAPNAKDLASRDVVS 341

Query: 302 RCMMMEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIP 361
           R M +EIREGRGVG  KDH+HL L+HL P  L  RLPGISE+A IFAGVDVT++PIPV+P
Sbjct: 342 RSMTIEIREGRGVGPDKDHVHLQLHHLPPQQLAARLPGISETAMIFAGVDVTKEPIPVLP 401

Query: 362 TVHYNMGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVF 421
           TVHYNMGGIPTNY G+V+       +   PGL A GEAGCASVHGANRLG+NSL+DLVVF
Sbjct: 402 TVHYNMGGIPTNYKGQVI-TYKDGQDHVVPGLYACGEAGCASVHGANRLGANSLLDLVVF 460

Query: 422 GRAAVIRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDA 481
           GRA  +  +E+      +  L  ++ +  +   D++R+A+G   T+ +R  MQ+ MQ  A
Sbjct: 461 GRACALTIAEIDTPGEKLSPLKPNAGEASVANLDKMRYANGSTRTSEIRLNMQKTMQSHA 520

Query: 482 GVFRTQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAE 541
            VFRT D L +GC  +  ++  M D+K  DR ++WN+DLVETLELQNLM+NA+ T+ SAE
Sbjct: 521 AVFRTGDVLKEGCVKMESVYKSMDDIKTFDRGIVWNTDLVETLELQNLMLNAVQTIVSAE 580

Query: 542 ARKESRGSHAREDFKD------------GEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRP 589
           ARKESRG+HAREDFKD            G+     + +WRKH+L +VD  TGK+ L+YRP
Sbjct: 581 ARKESRGAHAREDFKDRVDEYDYSKPLQGQVKKPFEQHWRKHTLSYVDPETGKVTLEYRP 640

Query: 590 VHTELLCGGVDYSKIAPKARVY 611
           V    L    D + I P  R Y
Sbjct: 641 VIDSSL-DAEDCAAIPPAIRSY 661


>gi|294899258|ref|XP_002776558.1| conserved hypothetical protein [Perkinsus marinus ATCC 50983]
 gi|239883600|gb|EER08374.1| conserved hypothetical protein [Perkinsus marinus ATCC 50983]
          Length = 627

 Score =  732 bits (1889), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/607 (61%), Positives = 450/607 (74%), Gaps = 10/607 (1%)

Query: 8   KSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASL 67
           ++++   DH YD VVVGAGGAGLRA  G+   G KTACI+KVFPTRSHTVAAQGGI A+L
Sbjct: 28  EANFPVHDHFYDAVVVGAGGAGLRAASGLVAHGLKTACISKVFPTRSHTVAAQGGINAAL 87

Query: 68  ANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQR 127
            NMT D W+WH YDT+KGSDWLGD DAI+++   APQ V ELE YG+PFSR + GKIYQR
Sbjct: 88  GNMTEDDWRWHAYDTVKGSDWLGDQDAIEHMCRLAPQVVLELESYGLPFSRTKEGKIYQR 147

Query: 128 PFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGC 187
            FGG    +G+G    R  AAADRTGHAILHTLYG +LK +  FFIEYFALDLI++  G 
Sbjct: 148 AFGGQSLKFGKGGQAYRCAAAADRTGHAILHTLYGMSLKYDCLFFIEYFALDLIMDQYGS 207

Query: 188 CVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDM 247
           C GV+A  +E G IHRF A   V+ATGGYGRAY S TSAHTCTGDG GMV+RAGLPLQD+
Sbjct: 208 CKGVIAMSMEDGSIHRFGAHQTVIATGGYGRAYQSCTSAHTCTGDGGGMVSRAGLPLQDL 267

Query: 248 EFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMME 307
           EFVQFHPTGI+ AGCL+TEG RGEGG L NS+GE FM RYAP+AKDLASRDVVSR M +E
Sbjct: 268 EFVQFHPTGIFPAGCLMTEGCRGEGGILRNSEGEPFMARYAPTAKDLASRDVVSRAMTLE 327

Query: 308 IREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNM 367
           IREGRGVG +KDHI+L+L+HL    L+ERLPGISE+A+IFAGVDVT++PIPV+PTVHYNM
Sbjct: 328 IREGRGVGPNKDHIYLHLDHLPAETLRERLPGISETAKIFAGVDVTKEPIPVLPTVHYNM 387

Query: 368 GGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVI 427
           GGIPTN+  + LD  S +P R  PGL+A GEAG ASVHGANRLG+NSL+DLVVFGR A  
Sbjct: 388 GGIPTNWKAQCLDPTSSDPSRIVPGLLAAGEAGSASVHGANRLGANSLLDLVVFGRTAAD 447

Query: 428 RASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQ 487
             +E++  +SP  +L   + +  +DRFD++RHA G V TA LR K+QR MQ  A V+R  
Sbjct: 448 TVAEIVKPNSPPVALPKDAGEATIDRFDKIRHAKGPVSTADLRSKLQRTMQTRAPVYRNG 507

Query: 488 DSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESR 547
           D L  GC  +  +  E  D+ + DR+L+WN+DL+ETLEL+NL+  A  T+ S EARKESR
Sbjct: 508 DDLEKGCEEVREIMKEYKDIGIKDRTLVWNTDLIETLELENLITQAAQTIISGEARKESR 567

Query: 548 GSHAREDFKDGEFGGRDDVNWRKHSLCWV---DWNTGKIKLDYRPVHTELLCGGVDYSKI 604
           G+HAREDF +     RDDV W KHSL +    +     I L YRPV  + L    +   +
Sbjct: 568 GAHAREDFPE-----RDDVEWMKHSLSYQTKHNVEDSDITLKYRPVVDQPL--DSEMHHV 620

Query: 605 APKARVY 611
            P  RVY
Sbjct: 621 PPAKRVY 627


>gi|62857975|ref|NP_001015989.1| succinate dehydrogenase [ubiquinone] flavoprotein subunit,
           mitochondrial precursor [Xenopus (Silurana) tropicalis]
 gi|123892712|sp|Q28ED0|DHSA_XENTR RecName: Full=Succinate dehydrogenase [ubiquinone] flavoprotein
           subunit, mitochondrial; AltName: Full=Flavoprotein
           subunit of complex II; Short=Fp; Flags: Precursor
 gi|89271313|emb|CAJ83256.1| succinate dehydrogenase complex, subunit A, flavoprot