RPSBLAST alignment for GI: 254781043 and conserved domain: TIGR01816

>gnl|CDD|130875 TIGR01816, sdhA_forward, succinate dehydrogenase, flavoprotein subunit, E. coli/mitochondrial subgroup. Succinate dehydrogenase and fumarate reductase are homologous enzymes reversible in principle but favored under different circumstances. This model represents a narrowly defined clade of the succinate dehydrogenase flavoprotein subunit as found in mitochondria, in Rickettsia, in E. coli and other Proteobacteria, and in a few other lineages. However, this model excludes all known fumarate reductases. It also excludes putative succinate dehydrogenases that appear to diverged before the split between E. coli succinate dehydrogenase and fumarate reductase. Length = 565
 Score =  879 bits (2274), Expect = 0.0
 Identities = 365/576 (63%), Positives = 443/576 (76%), Gaps = 11/576 (1%)

Query: 36  MAEKGFKTACITKVFPTRSHTVAAQGGIAASLANMTPDSWQWHLYDTIKGSDWLGDVDAI 95
           +A+ G  TAC+TK+FPTRSHTVAAQGGI+A+L NM  D+W+WH+YDT+KGSDWLGD DAI
Sbjct: 1   LAKGGVNTACVTKLFPTRSHTVAAQGGISAALGNMEEDNWRWHMYDTVKGSDWLGDQDAI 60

Query: 96  QYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRPFGGHMQNYGEGPPVQRTCAAADRTGHA 155
           +Y+  +AP++V ELEH G+PFSR E GKIYQRPFGGH +++G+G   +R CAAADRTGHA
Sbjct: 61  EYMCKQAPEAVLELEHMGMPFSRTEDGKIYQRPFGGHTRDFGKGGAAERACAAADRTGHA 120

Query: 156 ILHTLYGQALKNNAEFFIEYFALDLIINSEGCCVGVVAWQLETGEIHRFSAKLVVLATGG 215
           ILHTLY Q LK +  FF EYFALDL++  +G C GV+A+ LETGEIHRF AK VVLATGG
Sbjct: 121 ILHTLYQQNLKADTSFFNEYFALDLLME-DGECRGVIAYCLETGEIHRFRAKAVVLATGG 179

Query: 216 YGRAYFSATSAHTCTGDGAGMVARAGLPLQDMEFVQFHPTGIYGAGCLITEGARGEGGYL 275
           YGR YFS T+AHT TGDG GMV RAGLPLQDMEFVQFHPTGI GAGCLITEG RGEGG L
Sbjct: 180 YGRIYFSTTNAHTLTGDGTGMVTRAGLPLQDMEFVQFHPTGIAGAGCLITEGCRGEGGIL 239

Query: 276 VNSKGERFMERYAPSAKDLASRDVVSRCMMMEIREGRGVGKSKDHIHLYLNHLDPAVLQE 335
           +N+ GERFMERYAP+AKDLASRDVVSR M +EIREGRGVG +KDH++L L+HL P VL+ 
Sbjct: 240 INANGERFMERYAPTAKDLASRDVVSRSMTLEIREGRGVGPNKDHVYLDLDHLGPEVLEG 299

Query: 336 RLPGISESARIFAGVDVTRDPIPVIPTVHYNMGGIPTNYWGEVLDANSKNPERFAPGLMA 395
           RLPGISE+AR FAGVD  +DPIPV+PTVHYNMGGIPTNY G+VL  +    ++  PGL A
Sbjct: 300 RLPGISETARTFAGVDPVKDPIPVLPTVHYNMGGIPTNYHGQVL-RDGNGNDQIVPGLYA 358

Query: 396 IGEAGCASVHGANRLGSNSLIDLVVFGRAAVIRASEMIDKSSPIPSLDISSCDRIMDRFD 455
            GEA C SVHGANRLG+NSL+DLVVFGRAA + A+E     S +  +  ++ +  + R D
Sbjct: 359 AGEAACVSVHGANRLGTNSLLDLVVFGRAAGLSAAEYAKPGSDVKPMPPNAGEESVMRLD 418

Query: 456 RLRHADGHVPTAALREKMQRAMQLDAGVFRTQDSLSDGCRNLSCLWDEMADLKVHDRSLI 515
           +LR A G    AALR ++QR+MQ  AGVFRT + L  G   +S L +   ++K++D+S +
Sbjct: 419 KLRFATGGERVAALRLELQRSMQNHAGVFRTGEVLQKGVEKISALKERYKNVKINDKSKV 478

Query: 516 WNSDLVETLELQNLMINAIATVYSAEARKESRGSHAREDFKDGEFGGRDDVNWRKHSLCW 575
           WN+DLVE LELQNL+  A AT  SAEARKESRG+HAREDF +     RDD NW KH+L +
Sbjct: 479 WNTDLVEALELQNLLECAEATAVSAEARKESRGAHAREDFPE-----RDDENWLKHTLSY 533

Query: 576 VDWNTGKIKLDYRPVHTELLCGGVDYSKIAPKARVY 611
           VD NTGK+ L Y+PV  +     +  +   PK RVY
Sbjct: 534 VDINTGKVLLSYKPVIFK----PLTVADFEPKKRVY 565