RPSBLAST alignment for GI: 254781043 and conserved domain: PRK06854

>gnl|CDD|180733 PRK06854, PRK06854, adenylylsulfate reductase subunit alpha; Validated. Length = 608
 Score = 76.5 bits (189), Expect = 2e-14
 Identities = 145/661 (21%), Positives = 242/661 (36%), Gaps = 150/661 (22%)

Query: 14  VDHSYDVVVVGAGGAGLRATLGMAE--KGFKTACITKVFPTRSHTVAAQGGIAASLA--- 68
           V+   D++++G G AG  A     E     K   + K    RS  VA   G++A  A   
Sbjct: 8   VEVDTDILIIGGGMAGCGAAFEAKEWAPDLKVLIVEKANIKRSGAVAQ--GLSAINAYIG 65

Query: 69  -NMTPDSWQWHLYDTIKGSDWLGDV--DAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIY 125
              TP+ +       ++  D +G V  D +  +A      V+  E +G+P  ++E GK Y
Sbjct: 66  EGETPEDY----VRYVRK-DLMGIVREDLVYDIARHVDSVVHLFEEWGLPIWKDENGK-Y 119

Query: 126 QRPFGG---HMQNYGEG--PPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDL 180
            R   G    M N GE   P V    AA    G  +L          N  F  +      
Sbjct: 120 VR--RGRWQIMIN-GESYKPIVAE--AAKKALGDNVL----------NRVFITDL----- 159

Query: 181 IINSEGCCVGVVAWQLETGEIHRFSAKLVVLATGG----Y---------GRAYFSATSAH 227
            +  +    G V + +   + + F AK V++ATGG    Y         GR ++   +  
Sbjct: 160 -LVDDNRIAGAVGFSVRENKFYVFKAKAVIVATGGAAGIYRPRSPGEGRGRMWYPPFN-- 216

Query: 228 TCTGDGAGMVARAG--LPLQDMEFVQFH------PTGIYGAGCLITEGARGEGGYLVNSK 279
             TG G  M  RAG  +   +  F+         P G +                 VN+ 
Sbjct: 217 --TGSGYAMGIRAGAEMTTFENRFIPLRFKDGYGPVGAW---------FLLFKAKAVNAL 265

Query: 280 GERFMERYAPSAKDLASRD---VVSRC-----MMMEIREGRGVGKSKDHIHLYLNH-LDP 330
           GE +  + A   K          +  C      + E + GRG       I++     L  
Sbjct: 266 GEEYEAKNAAELKKYVPYADYKPIPTCLRNYATVEENKAGRG------PIYMDTEEALQD 319

Query: 331 AVLQERL--------PGISESARIFAGVDV--TRDPIPVIPTVHYNMGGIPT--NYW--- 375
             L+  L        PG    A ++A  ++    +   ++ T  Y +G       YW   
Sbjct: 320 KHLESELWEDFLDMTPGQ---ALLWAAQNIEPEEENSEIMGTEPYIVGSHSGASGYWVSG 376

Query: 376 -GEVLDANSK---NPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIRASE 431
             + +    K   N      GL A G+    S H   +  S S  +    GR A   A  
Sbjct: 377 PEDWVPEEYKWGYNRMTTVEGLFAAGDVVGGSPH---KFSSGSFAE----GRIAAKAAVR 429

Query: 432 MI-DKSSPIPSLDISSCDRI-------MDRFDRLRHA-------DGHVPTAALREKMQRA 476
            I D     P +D    + +       ++R++  +           ++    L E++Q+ 
Sbjct: 430 YILDNKDEKPEIDDDQIEELKKEIYAPLERYEEFKDYSTDPDVNPNYISPEQLEERLQKI 489

Query: 477 M-QLDAGV---FRTQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMIN 532
           M +   G+   + T + L +    L  + +E ++ K+  R L    +L+   EL++ ++ 
Sbjct: 490 MDEYAGGISTNYTTNEKLLEIALELLEMLEEDSE-KLAARDL---HELMRCWELKHRLLV 545

Query: 533 AIATVYSAEARKESR--GSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPV 590
           A A +     RKE+R  G + R D+      G+DD NW+       D  TG+  +   P 
Sbjct: 546 AEAHIRHLLFRKETRWPGYYERADYP-----GKDDENWKCFVNSRYDPGTGEWTIRKLPY 600

Query: 591 H 591
           +
Sbjct: 601 Y 601