RPSBLAST alignment for GI: 254781043 and conserved domain: PRK07395

>gnl|CDD|180957 PRK07395, PRK07395, L-aspartate oxidase; Provisional. Length = 553
 Score =  307 bits (789), Expect = 4e-84
 Identities = 188/585 (32%), Positives = 281/585 (48%), Gaps = 78/585 (13%)

Query: 17  SYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLANMTPDSWQ 76
            +DV+VVG+G AGL A L +     +   ITK     S +  AQGGIAA++A    DS +
Sbjct: 9   QFDVLVVGSGAAGLYAALCLPSH-LRVGLITKDTLKTSASDWAQGGIAAAIAPD--DSPK 65

Query: 77  WHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRN--------EAGKIYQRP 128
            H  DT+K    L D +A+++L  +AP+++  L   GV F R+        EA   + RP
Sbjct: 66  LHYEDTLKAGAGLCDPEAVRFLVEQAPEAIASLVEMGVAFDRHGQHLALTLEAA--HSRP 123

Query: 129 FGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQAL-KNNAEFFIEYFALDLIINSE-G 186
                          R   AAD TG AI+ TL  Q L + N E   +  AL L +  E G
Sbjct: 124 ---------------RVLHAADTTGRAIVTTLTEQVLQRPNIEIISQALALSLWLEPETG 168

Query: 187 CCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQD 246
            C G+    L  G+I    A  V+LATGG G+ +   T+    TGDG  +  RAG  L+D
Sbjct: 169 RCQGISL--LYQGQITWLRAGAVILATGGGGQVFAQTTNPAVSTGDGVALAWRAGAQLRD 226

Query: 247 MEFVQFHPTGIYGAGC---LITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRC 303
           +EF QFHPT +   G    LI+E  RGEG +LV+++G RF   Y P A +LA RDVVSR 
Sbjct: 227 LEFFQFHPTALTKPGAPRFLISEAVRGEGAHLVDAQGRRFAFDYHP-AGELAPRDVVSRA 285

Query: 304 MMMEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTV 363
           +   +++      +  H+ L L  +    ++ R P I    + + G+DV ++PIPV P  
Sbjct: 286 IFSHLQK-TATDPATAHVWLDLRPIPAERIRRRFPNIIRVCQKW-GIDVFQEPIPVAPAA 343

Query: 364 HYNMGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFG- 422
           HY MGG+ T+     L+  +       PGL A+GE     VHGANRL SNSL++ +VF  
Sbjct: 344 HYWMGGVVTD-----LNNQTS-----IPGLYAVGETASTGVHGANRLASNSLLECLVFAA 393

Query: 423 RAAVIRASEMIDKSSPIPSLDIS-SCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDA 481
           + A +        S  +P +       +  +  ++++          +R+++   +   A
Sbjct: 394 QLAQLELPIEPPASPDLPPISFIIDASQWKNEQEQIQR---------IRQELPELVWQSA 444

Query: 482 GVFRTQDSLSDGCRNLSCLWDEMADLKVH--------DRSLIWNSDLVET-----LELQN 528
           G+ R  D+L      +     ++A L +          +++ +N    E       E +N
Sbjct: 445 GICREADTLERAIAQVEQWQQQLAALPLSQFLANLPPGQTVSFNGPDAEQQLRLWAETRN 504

Query: 529 LMINAIATVYSAEARKESRGSHAREDFKDGEFGGRDDVNWRKHSL 573
           L+  A   + SA  R ESRG H R D+         D  W+ H+L
Sbjct: 505 LLDIAYLILKSALFRTESRGGHYRLDYPQ------TDPAWQVHTL 543