>TIGR02745 ccoG_rdxA_fixG cytochrome c oxidase accessory protein CcoG; InterPro: IPR014116 Member of this ferredoxin-like protein family, include FixG, CcoG and RdxA,. They are found exclusively in species with an operon encoding the cbb3 type of cytochrome c oxidase (cco-cbb3), and near the cco-cbb3 operon in about half the cases. The cco-cbb3 is found in a variety of proteobacteria and almost nowhere else; it is associated with oxygen use under microaerobic conditions. Some (but not all) of these proteobacteria are also nitrogen-fixing, hence the gene symbol fixG. FixG was shown essential for functional cco-cbb3 expression in Bradyrhizobium japonicum..

Probab=96.29 E-value=0.00086 Score=43.84 Aligned_cols=40 Identities=38% Similarity=0.767 Sum_probs=31.3 Q ss_pred HHHHHHHHHCCCHHHCCCEEECCCCCCCHHHHHHHHHHHCCCCCCCHHHHHHHHCCCCCCCCCCCCCCHHHHC Q ss_conf 6688888731313228200102221011478899988516888431388999622866527676647345518 Q gi|254781044|r 165 DGLYECVMCACCSTSCPSYWWNSDRYLGPAILLQAYRWLIDSRDEFQGERLDNLEDPFRLYRCHTIMNCTQSC 237 (259) Q Consensus 165 ~~~~~CI~CG~C~saCP~~~~~~~~flGP~~l~~a~r~~~D~rD~~~~erl~~l~~~~gi~~C~~C~~C~~vC 237 (259) T Consensus 240 ~~~GDCvdC~~CV~VCPTG--------------------IDIRdGlQl-------------ECInC~~CIDAC 279 (474) T TIGR02745 240 KPLGDCVDCNLCVQVCPTG--------------------IDIRDGLQL-------------ECINCGLCIDAC 279 (474) T ss_pred CCCCCCCCCCCCCCCCCCC--------------------EECCCCCHH-------------HHHHHHHHHHHH T ss_conf 7478624776554242572--------------------022334246-------------543177687444

HHsearch alignment for GI: 254781044 and conserved domain: TIGR02745