>TIGR02912 sulfite_red_C sulfite reductase, subunit C; InterPro: IPR014261 This entry represents subunit C, one of the three subunits of the anaerobic sulphite reductase of Salmonella, and close homologues from various Clostridium species, where the three-gene neighbourhood is preserved. Two such gene clusters are found in Clostridium perfringens, but it may be that these sets of genes correspond to the distinct assimilatory and dissimilatory forms seen in Clostridium pasteurianum. Note that any one of these enzymes may have secondary substrates such as NH2OH, SeO3(2-), and SO3(2-). Heterologous expression of the anaerobic sulphite reductase of Salmonella confers on Escherichia coli the ability to produce hydrogen sulphide gas from sulphite..

Probab=96.77 E-value=0.00022 Score=47.56 Aligned_cols=54 Identities=19% Similarity=0.419 Sum_probs=36.0 Q ss_pred HHHHHHHHHHHHCCCHHHCCCEEECCCCCCCHHHHHHHHHHHCCCCCCCHHHHHHHHCCCCCCCCCCCCCCHHHHCCCC Q ss_conf 5446688888731313228200102221011478899988516888431388999622866527676647345518997 Q gi|254781044|r 162 QKIDGLYECVMCACCSTSCPSYWWNSDRYLGPAILLQAYRWLIDSRDEFQGERLDNLEDPFRLYRCHTIMNCTQSCPKG 240 (259) Q Consensus 162 ~~~~~~~~CI~CG~C~saCP~~~~~~~~flGP~~l~~a~r~~~D~rD~~~~erl~~l~~~~gi~~C~~C~~C~~vCPkg 240 (259) T Consensus 169 ~~~y~~~rC~gC~ACV~~C~~~~~G------aL~------~~----------N~Kvvr~~~---~CIGCGECv~~CPT~ 222 (323) T TIGR02912 169 EPRYDADRCIGCGACVKVCKKKAVG------ALS------LE----------NYKVVRDES---KCIGCGECVLKCPTG 222 (323) T ss_pred CCCCCCCCCCCCHHHHHHCCCCCCE------EEE------EE----------CCEEEECCC---CEECCCCHHHCCCCC T ss_conf 5442655331324678403432210------223------10----------422565277---500353013208864

HHsearch alignment for GI: 254781044 and conserved domain: TIGR02912