Query gi|254781045|ref|YP_003065458.1| outer membrane lipoprotein omp19 [Candidatus Liberibacter asiaticus str. psy62] Match_columns 162 No_of_seqs 57 out of 59 Neff 4.3 Searched_HMMs 39220 Date Mon May 30 04:12:27 2011 Command /home/congqian_1/programs/hhpred/hhsearch -i 254781045.hhm -d /home/congqian_1/database/cdd/Cdd.hhm No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM 1 pfam06604 consensus 100.0 0 0 368.6 15.4 160 1-162 1-181 (181) 2 pfam02974 Inh Protease inhibit 99.9 5.8E-22 1.5E-26 154.9 9.8 95 66-162 2-98 (98) 3 pfam06474 MLTD_N MLTD_N. 88.8 0.55 1.4E-05 26.1 3.7 18 13-30 8-25 (93) 4 PRK11138 outer membrane protei 88.8 1.9 4.9E-05 22.8 10.1 26 1-27 1-26 (394) 5 PRK12407 flgH flagellar basal 87.5 0.82 2.1E-05 25.1 3.9 17 8-24 3-19 (220) 6 PRK13684 Ycf48-like protein; P 81.9 4.2 0.00011 20.8 6.6 30 4-34 8-37 (333) 7 PRK09859 multidrug efflux syst 81.0 2.1 5.5E-05 22.5 3.6 23 1-23 1-23 (385) 8 PRK10871 nlpD lipoprotein NlpD 80.4 4 0.0001 20.9 4.8 21 2-24 9-29 (374) 9 pfam01299 Lamp Lysosome-associ 79.9 3.4 8.6E-05 21.3 4.3 17 75-91 106-122 (305) 10 PRK09915 putative outer membra 79.0 4.2 0.00011 20.7 4.6 30 2-34 5-34 (488) 11 PRK00249 flgH flagellar basal 78.1 4.5 0.00012 20.5 4.6 23 1-25 1-23 (231) 12 pfam07269 consensus 76.9 1.3 3.2E-05 24.0 1.4 18 5-25 2-19 (55) 13 PRK12701 flgH flagellar basal 76.0 6.1 0.00016 19.7 4.7 22 1-24 1-22 (230) 14 COG3056 Uncharacterized lipopr 75.8 2.4 6.1E-05 22.2 2.6 30 3-33 14-43 (204) 15 COG3317 NlpB Uncharacterized l 74.5 5.4 0.00014 20.1 4.1 22 1-23 1-22 (342) 16 PRK12696 flgH flagellar basal 74.3 6.2 0.00016 19.7 4.4 19 5-24 3-21 (238) 17 PRK10866 outer membrane protei 73.1 2.2 5.7E-05 22.4 1.9 23 1-24 1-23 (243) 18 PRK09967 putative outer membra 72.4 2.4 6.1E-05 22.3 1.9 20 5-24 3-22 (160) 19 pfam04170 NlpE Uncharacterized 71.7 6.3 0.00016 19.7 3.9 45 111-159 40-84 (86) 20 pfam04525 DUF567 Protein of un 71.6 8.2 0.00021 19.0 4.5 28 124-151 52-82 (187) 21 PRK12698 flgH flagellar basal 71.2 7.1 0.00018 19.3 4.1 17 5-24 3-19 (224) 22 PRK10672 rare lipoprotein A; P 70.8 5 0.00013 20.3 3.3 39 5-43 2-41 (369) 23 PRK13883 conjugal transfer pro 70.5 3.9 9.8E-05 21.0 2.6 23 9-31 5-28 (156) 24 PRK10783 mltD membrane-bound l 70.0 8.8 0.00023 18.8 4.6 32 69-103 135-168 (449) 25 TIGR02747 TraV type IV conjuga 67.7 2.9 7.3E-05 21.7 1.5 27 4-30 2-32 (174) 26 COG3417 FlgN Collagen-binding 67.2 7.6 0.00019 19.1 3.6 17 7-23 6-22 (200) 27 PRK12697 flgH flagellar basal 66.7 7.2 0.00018 19.3 3.4 17 9-25 12-28 (227) 28 PRK11189 lipoprotein NlpI; Pro 64.8 4.6 0.00012 20.5 2.1 21 1-23 2-22 (297) 29 PRK11063 metQ DL-methionine tr 63.9 5.3 0.00013 20.1 2.2 25 1-25 1-27 (271) 30 TIGR02722 lp_ uncharacterized 63.8 5.3 0.00013 20.1 2.2 18 8-25 6-23 (215) 31 PRK13859 type IV secretion sys 62.1 4 0.0001 20.9 1.3 18 5-25 2-19 (55) 32 PRK10802 peptidoglycan-associa 61.6 13 0.00033 17.8 4.5 25 1-25 1-26 (173) 33 PRK13835 conjugal transfer pro 61.0 6.9 0.00018 19.4 2.4 16 8-23 4-19 (144) 34 COG4314 NosL Predicted lipopro 60.2 7.2 0.00018 19.3 2.4 30 5-37 2-31 (176) 35 TIGR02377 MocE_fam_FeS Rieske 59.8 9.9 0.00025 18.4 3.0 27 119-147 10-36 (101) 36 PRK10781 rcsF outer membrane l 58.6 11 0.00028 18.2 3.1 126 9-161 4-132 (133) 37 PRK10461 thiamine biosynthesis 58.4 5.2 0.00013 20.2 1.4 20 1-23 3-22 (351) 38 PRK12700 flgH flagellar basal 56.9 16 0.0004 17.3 4.2 20 3-24 6-25 (230) 39 PRK12450 foldase protein PrsA; 56.4 8.9 0.00023 18.7 2.3 24 1-24 1-26 (309) 40 pfam06291 Lambda_Bor Bor prote 55.1 15 0.00038 17.4 3.3 23 5-28 2-26 (97) 41 PRK09837 copper/silver efflux 53.0 16 0.00042 17.1 3.2 29 1-35 1-29 (460) 42 PRK10449 heat-inducible protei 50.9 9.5 0.00024 18.6 1.7 104 8-136 4-132 (140) 43 PRK09578 periplasmic multidrug 50.3 18 0.00045 16.9 3.0 19 4-23 7-25 (385) 44 PRK11679 lipoprotein; Provisio 48.9 21 0.00053 16.5 6.3 87 4-95 8-111 (345) 45 TIGR01004 PulS_OutS lipoprotei 48.3 9 0.00023 18.7 1.3 43 7-50 11-53 (136) 46 pfam08139 LPAM_1 Prokaryotic m 47.7 13 0.00034 17.7 2.1 14 13-26 9-22 (26) 47 PRK10760 murein hydrolase B; P 47.5 22 0.00056 16.3 4.1 12 12-23 8-19 (357) 48 PRK11548 hypothetical protein; 46.7 14 0.00036 17.5 2.1 24 1-25 1-24 (113) 49 PRK12788 flgH flagellar basal 46.4 23 0.00058 16.2 4.8 15 9-23 4-18 (231) 50 pfam07901 DUF1672 Protein of u 44.7 15 0.00039 17.3 2.0 19 5-24 3-21 (304) 51 PRK13731 conjugal transfer sur 44.7 13 0.00033 17.7 1.7 24 1-24 1-24 (243) 52 pfam05590 DUF769 Xylella fasti 44.2 21 0.00055 16.4 2.7 31 9-39 9-40 (279) 53 PRK11443 hypothetical protein; 44.2 13 0.00034 17.6 1.7 13 11-23 6-18 (120) 54 COG3111 Periplasmic protein wi 43.6 25 0.00064 16.0 4.4 38 121-161 70-107 (128) 55 PRK12699 flgH flagellar basal 42.0 27 0.00068 15.8 4.3 28 11-38 23-50 (246) 56 PRK02944 OxaA-like protein pre 40.9 28 0.00071 15.7 2.9 18 8-25 8-25 (255) 57 PRK11627 hypothetical protein; 39.7 17 0.00044 17.0 1.7 18 5-23 3-20 (192) 58 PRK00022 lolB outer membrane l 38.5 19 0.00049 16.7 1.7 12 13-24 10-21 (203) 59 PRK10796 LPS-assembly lipoprot 37.8 22 0.00055 16.4 1.9 27 1-29 1-28 (196) 60 TIGR00495 crvDNA_42K DNA-bindi 37.3 23 0.00059 16.2 2.0 16 127-142 317-332 (407) 61 PRK02463 OxaA-like protein pre 36.4 31 0.00078 15.4 2.5 22 4-25 6-28 (307) 62 pfam05643 DUF799 Putative bact 36.4 22 0.00055 16.4 1.7 19 85-103 105-123 (215) 63 pfam01298 Lipoprotein_5 Transf 36.3 33 0.00084 15.3 4.9 28 1-30 1-29 (589) 64 pfam09347 DUF1989 Domain of un 36.1 33 0.00084 15.2 3.3 12 129-140 66-77 (167) 65 TIGR03300 assembly_YfgL outer 35.5 34 0.00086 15.2 9.4 25 8-33 4-28 (377) 66 pfam02402 Lysis_col Lysis prot 35.1 14 0.00036 17.5 0.6 17 7-23 5-21 (46) 67 COG0386 BtuE Glutathione perox 34.8 30 0.00078 15.5 2.3 25 114-142 122-146 (162) 68 PRK11251 DNA-binding transcrip 34.6 26 0.00068 15.8 1.9 23 7-29 4-26 (109) 69 PRK10525 cytochrome o ubiquino 34.5 35 0.00089 15.1 2.6 24 6-29 10-33 (305) 70 pfam03534 SpvB Salmonella viru 34.0 36 0.00091 15.0 4.8 56 78-146 133-189 (293) 71 PRK10718 hypothetical protein; 33.8 19 0.0005 16.7 1.1 30 2-34 2-32 (191) 72 TIGR00977 LeuA_rel 2-isopropyl 33.4 17 0.00043 17.1 0.7 45 89-136 137-181 (543) 73 PRK09810 entericidin A; Provis 33.1 31 0.00079 15.4 2.1 22 4-26 3-24 (41) 74 TIGR03424 urea_degr_1 urea car 32.9 37 0.00095 14.9 3.5 14 107-120 113-127 (198) 75 pfam06572 DUF1131 Protein of u 32.6 27 0.00069 15.8 1.7 24 11-34 8-32 (192) 76 KOG0175 consensus 32.2 35 0.0009 15.0 2.3 33 113-146 170-203 (285) 77 COG4238 Murein lipoprotein [Ce 32.1 29 0.00075 15.6 1.8 19 5-23 5-23 (78) 78 TIGR02544 III_secr_YscJ type I 32.0 30 0.00076 15.5 1.8 21 10-30 6-28 (203) 79 pfam08085 Entericidin Enterici 32.0 32 0.00081 15.3 2.0 22 7-28 7-28 (42) 80 KOG0263 consensus 30.8 40 0.001 14.7 4.5 47 113-160 557-603 (707) 81 COG4380 Uncharacterized protei 30.4 31 0.0008 15.4 1.7 20 4-24 1-20 (216) 82 COG4594 FecB ABC-type Fe3+-cit 30.4 39 0.001 14.8 2.2 23 7-29 8-30 (310) 83 TIGR01433 CyoA ubiquinol oxida 30.1 23 0.00058 16.3 1.0 20 9-28 1-21 (228) 84 PRK10053 hypothetical protein; 30.1 41 0.0011 14.6 4.2 38 121-161 74-111 (130) 85 TIGR02521 type_IV_pilW type IV 29.5 23 0.00058 16.2 0.9 15 11-25 2-16 (247) 86 COG4259 Uncharacterized protei 29.4 37 0.00093 15.0 1.9 20 4-23 5-24 (121) 87 TIGR01840 esterase_phb esteras 29.0 8.5 0.00022 18.9 -1.4 12 13-24 19-30 (231) 88 COG3133 SlyB Outer membrane li 28.9 32 0.00083 15.3 1.6 31 120-151 109-140 (154) 89 pfam12079 DUF3558 Protein of u 28.9 27 0.00069 15.8 1.2 114 16-132 2-121 (168) 90 pfam04076 BOF Bacterial OB fol 28.4 44 0.0011 14.4 4.0 37 122-161 71-107 (126) 91 COG3521 Predicted component of 27.4 43 0.0011 14.6 2.0 22 1-23 1-22 (159) 92 TIGR02898 spore_YhcN_YlaJ spor 26.7 38 0.00097 14.9 1.6 21 8-28 2-24 (185) 93 PRK10957 iron-enterobactin tra 26.2 49 0.0012 14.2 2.4 21 4-24 4-24 (319) 94 TIGR03302 OM_YfiO outer membra 26.1 43 0.0011 14.6 1.8 17 8-24 4-20 (235) 95 TIGR03659 IsdE heme ABC transp 25.7 46 0.0012 14.4 1.9 19 6-24 4-22 (289) 96 pfam00541 Adeno_knob Adenovira 25.6 50 0.0013 14.1 2.4 52 84-136 15-68 (170) 97 pfam03276 Gag_spuma Spumavirus 25.6 35 0.0009 15.1 1.3 38 73-110 292-329 (582) 98 PRK10523 lipoprotein involved 25.1 51 0.0013 14.1 4.7 44 111-158 84-127 (234) 99 COG5645 Predicted periplasmic 25.0 37 0.00095 14.9 1.3 19 5-24 2-20 (80) 100 COG3107 LppC Putative lipoprot 24.9 51 0.0013 14.1 2.1 50 85-135 358-423 (604) 101 KOG2391 consensus 24.4 52 0.0013 14.0 5.9 38 4-45 120-157 (365) 102 PRK13733 conjugal transfer pro 24.2 32 0.00082 15.3 0.9 26 5-30 3-30 (171) 103 PRK13616 lipoprotein LpqB; Pro 23.8 54 0.0014 13.9 3.8 16 9-24 10-25 (590) 104 COG4939 Major membrane immunog 23.7 54 0.0014 14.0 1.9 24 5-28 3-26 (147) 105 pfam10023 DUF2265 Predicted am 23.6 35 0.00089 15.1 1.0 71 11-83 3-92 (338) 106 PRK10510 putative outer membra 23.5 55 0.0014 13.9 2.6 51 71-121 88-140 (219) 107 PRK04168 hypothetical protein; 22.4 58 0.0015 13.8 2.2 23 2-24 4-26 (336) 108 PRK04405 prsA peptidylprolyl i 22.3 55 0.0014 13.9 1.8 21 3-23 4-26 (298) 109 TIGR02887 spore_ger_x_C germin 21.5 60 0.0015 13.7 2.0 18 6-23 3-20 (400) 110 COG5510 Predicted small secret 21.3 52 0.0013 14.0 1.5 24 6-29 7-30 (44) 111 pfam11873 DUF3393 Domain of un 21.1 42 0.0011 14.6 1.0 16 9-24 4-19 (200) 112 PRK10397 hypothetical protein; 20.5 63 0.0016 13.5 1.8 30 13-42 8-38 (137) 113 TIGR00409 proS_fam_II prolyl-t 20.3 60 0.0015 13.6 1.6 24 113-136 84-110 (620) 114 cd04814 PA_M28_1 PA_M28_1: Pro 20.0 64 0.0016 13.5 1.8 15 119-133 45-59 (142) 115 COG4764 Uncharacterized protei 20.0 60 0.0015 13.6 1.6 13 12-24 11-23 (197) No 1 >pfam06604 consensus Probab=100.00 E-value=0 Score=368.60 Aligned_cols=160 Identities=24% Similarity=0.451 Sum_probs=148.4 Q ss_pred CCCHHHHHHHHHHHHHHHCCCEEECCCCC-------CCCCCCCCCCCCCCCCCCCCCCCC--CCCCCCC----------- Q ss_conf 92002369999999998405412037887-------778766688874345735899888--7788654----------- Q gi|254781045|r 1 MHFYRFILLNLYMLTLFSHGCTQIDFGNI-------FFKKPEISLPPSVESEILLPPIPE--EEFDQDD----------- 60 (162) Q Consensus 1 m~f~~~~~~~l~~~~l~laGCq~~~~~~~-------~~~p~~a~p~~~V~s~~l~pp~~~--~~~~~~~----------- 60 (162) |+|+|+.|+...+++|+|+||||++|+++ +++|++++|+++|+++||+||++. ++|+.+| T Consensus 1 M~~sk~~~~~~~~~v~~laGCq~~~~~~~~~~~~~~~~~Pl~a~P~~~V~s~qL~pp~~~~~~~~~~~p~~~~~~~~~~a 80 (181) T pfam06604 1 MNFSKAGLVAGLAAVLVLAGCQRSRFGNMDDVSPPQQPAPLQAQPAGSVQSGQLPPPAGADPSQFPTAPATAAPGGTQVA 80 (181) T ss_pred CCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC T ss_conf 96206778999999999734453334677887776788875667677534685698998876667679987788875544 Q ss_pred -CCCCCCCCCCCCHHEEEEEEECCCCCEEEEEEECCCCCCCCCCCCCCCCCCHHCCCCEEECCCCEEEEECCCCCEEEEE Q ss_conf -4667632237701136578863689736889713667777145436773000002100333871899982899879999 Q gi|254781045|r 61 -ISVPSKDNNAIRMGIIGAWKVSYRDVDCKMILTLTRFKKNFRGTARSCHGRLASLAAWNIIDEDSFELKNKSGQTIIVF 139 (162) Q Consensus 61 -~~~p~~a~~~~r~sl~G~W~vs~~g~sC~v~Lt~t~~~~Gyra~~~gC~g~L~~i~aW~v~G~~vl~L~D~sG~~v~~l 139 (162) +++|++|.|++|++|+|+|+|+++|++|+||||+|||++||||++|||+++|++|++|||+||| |+|||++|++|++| T Consensus 81 ~~~ppa~a~dl~~~s~~G~W~vs~gg~sC~~~ltlTk~g~GyRAgtrgC~g~l~~v~aW~v~Gkq-v~L~d~sG~~va~L 159 (181) T pfam06604 81 SLPPPAGALDLTKEAVAGVWNASVGGQSCKIATPQTKLGSGSRAGPLGCPGELTAMGSWEVAGKQ-LVLYDRNGGTIARL 159 (181) T ss_pred CCCCCCCCCCCCHHHEEEEEEEECCCCCEEEEEEECCCCCCCCCCCCCCCCCHHCCCEEEECCCE-EEEECCCCCEEEEE T ss_conf 67999865555734705466850389712788533133786545668888201000002533888-99985999999999 Q ss_pred EECCCCCEECCCCCCCCEEEEEC Q ss_conf 95489732201137896188739 Q gi|254781045|r 140 YKTAEQSFEGSFQGESDKVIISR 162 (162) Q Consensus 140 ~~s~~grfeG~t~~~G~pisLsR 162 (162) |+++++||||+|+ +||||+|+| T Consensus 160 yss~~~rf~G~T~-~gqPvsLsR 181 (181) T pfam06604 160 YSSGDARFDGQTN-GGQPVSLSR 181 (181) T ss_pred ECCCCCCEEEEEC-CCCEEEECC T ss_conf 6468863021525-895257329 No 2 >pfam02974 Inh Protease inhibitor Inh. The Inh inhibitor is secreted into the periplasm where its presumed physiological function is to protect periplasmic proteins against the action of secreted proteases. A range of proteases including A, B and C from E. chrysanthemi, alkaline protease from Pseudomonas aeruginosa and the 50 kDa protease from Serratia marcescens are inhibited. Probab=99.87 E-value=5.8e-22 Score=154.92 Aligned_cols=95 Identities=22% Similarity=0.488 Sum_probs=87.6 Q ss_pred CCCCCCCHHEEEEEEECCCCCEEEEEEECCCCCCCCCCCCCCCCCC-HHCC-CCEEECCCCEEEEECCCCCEEEEEEECC Q ss_conf 3223770113657886368973688971366777714543677300-0002-1003338718999828998799999548 Q gi|254781045|r 66 KDNNAIRMGIIGAWKVSYRDVDCKMILTLTRFKKNFRGTARSCHGR-LASL-AAWNIIDEDSFELKNKSGQTIIVFYKTA 143 (162) Q Consensus 66 ~a~~~~r~sl~G~W~vs~~g~sC~v~Lt~t~~~~Gyra~~~gC~g~-L~~i-~aW~v~G~~vl~L~D~sG~~v~~l~~s~ 143 (162) +....++++|+|+|+|+.++++|+|+|++|+++++||++.++|+++ |..+ .+|++++++ |.|+|+.|+.|+.||+++ T Consensus 2 Sl~lp~~a~LaG~W~ls~~~~~C~i~L~~t~~~~~~l~g~~~C~~~~L~~~~~~W~ptpdg-i~L~d~~Gs~va~l~~~~ 80 (98) T pfam02974 2 SLVLPSPASLAGQWQLSKGGQVCDIELTQTKLGQGYLAGDLACLGEWLGEVPSGWRPTPDG-LALTDASGSTVAFLYRSG 80 (98) T ss_pred CCCCCCHHHHCEEEEEECCCCCEEEEEECCCCCCCEECCCCCCCHHHHCCCCCCEEECCCE-EEEECCCCCEEEEEEECC T ss_conf 6446985682206787049982488931372666220477256655652664447526998-999879999899998058 Q ss_pred CCCEECCCCCCCCEEEEEC Q ss_conf 9732201137896188739 Q gi|254781045|r 144 EQSFEGSFQGESDKVIISR 162 (162) Q Consensus 144 ~grfeG~t~~~G~pisLsR 162 (162) +++|+|++. +|+||+|+| T Consensus 81 ~~~y~g~t~-~G~~~~L~R 98 (98) T pfam02974 81 EGRYEGQTP-DGQPLTLSR 98 (98) T ss_pred CCEEEEEEC-CCCEEEEEC T ss_conf 954772808-997788639 No 3 >pfam06474 MLTD_N MLTD_N. Probab=88.84 E-value=0.55 Score=26.15 Aligned_cols=18 Identities=17% Similarity=0.196 Sum_probs=11.5 Q ss_pred HHHHHHCCCEEECCCCCC Q ss_conf 999984054120378877 Q gi|254781045|r 13 MLTLFSHGCTQIDFGNIF 30 (162) Q Consensus 13 ~~~l~laGCq~~~~~~~~ 30 (162) +++++|+|||++...... T Consensus 8 ~~alLLaGCQst~~~~~~ 25 (93) T pfam06474 8 AAALLLVGCQSTQAVSST 25 (93) T ss_pred HHHHHHHHHCCCCCCCCC T ss_conf 999999981379999998 No 4 >PRK11138 outer membrane protein assembly complex subunit YfgL; Provisional Probab=88.81 E-value=1.9 Score=22.83 Aligned_cols=26 Identities=23% Similarity=0.492 Sum_probs=19.4 Q ss_pred CCCHHHHHHHHHHHHHHHCCCEEECCC Q ss_conf 920023699999999984054120378 Q gi|254781045|r 1 MHFYRFILLNLYMLTLFSHGCTQIDFG 27 (162) Q Consensus 1 m~f~~~~~~~l~~~~l~laGCq~~~~~ 27 (162) |.|.|+.+..|..+ ++|+||+..+-+ T Consensus 1 ~~~~~~~~~~l~~~-~ll~gCs~~~~~ 26 (394) T PRK11138 1 MQLRKLLLPGLLSV-ALLSGCSLFDSE 26 (394) T ss_pred CCHHHHHHHHHHHH-HHHHHCCCCCCC T ss_conf 95167799999999-998652378888 No 5 >PRK12407 flgH flagellar basal body L-ring protein; Reviewed Probab=87.53 E-value=0.82 Score=25.09 Aligned_cols=17 Identities=29% Similarity=0.385 Sum_probs=11.7 Q ss_pred HHHHHHHHHHHCCCEEE Q ss_conf 99999999984054120 Q gi|254781045|r 8 LLNLYMLTLFSHGCTQI 24 (162) Q Consensus 8 ~~~l~~~~l~laGCq~~ 24 (162) ++.|+.++|+|+||.+. T Consensus 3 ~l~l~~~~l~LsGC~~~ 19 (220) T PRK12407 3 FLILTPMVLALCGCESP 19 (220) T ss_pred CHHHHHHHHHHHCCCCC T ss_conf 57999999997365888 No 6 >PRK13684 Ycf48-like protein; Provisional Probab=81.92 E-value=4.2 Score=20.76 Aligned_cols=30 Identities=23% Similarity=0.153 Sum_probs=17.8 Q ss_pred HHHHHHHHHHHHHHHCCCEEECCCCCCCCCC Q ss_conf 0236999999999840541203788777876 Q gi|254781045|r 4 YRFILLNLYMLTLFSHGCTQIDFGNIFFKKP 34 (162) Q Consensus 4 ~~~~~~~l~~~~l~laGCq~~~~~~~~~~p~ 34 (162) .+-.++.+ ++.++++||.+++.-..+..|= T Consensus 8 ~~~l~l~~-~~~~~~~~c~~~~~p~~~~~pw 37 (333) T PRK13684 8 LLNLLLLL-ALGLVLSGCSTTRVPMASSSPW 37 (333) T ss_pred HHHHHHHH-HHHHHHCCCCCCCCCCCCCCCC T ss_conf 99999999-9998632235667765578987 No 7 >PRK09859 multidrug efflux system protein MdtE; Provisional Probab=80.98 E-value=2.1 Score=22.53 Aligned_cols=23 Identities=22% Similarity=0.356 Sum_probs=19.9 Q ss_pred CCCHHHHHHHHHHHHHHHCCCEE Q ss_conf 92002369999999998405412 Q gi|254781045|r 1 MHFYRFILLNLYMLTLFSHGCTQ 23 (162) Q Consensus 1 m~f~~~~~~~l~~~~l~laGCq~ 23 (162) |+=.|+.++.|.+.++.|+||.. T Consensus 1 m~~k~~~li~ll~~~~lL~gC~~ 23 (385) T PRK09859 1 MNRRRKLLIPLLFCGAMLTACDD 23 (385) T ss_pred CCCHHHHHHHHHHHHHHHHCCCC T ss_conf 98206789999999999953799 No 8 >PRK10871 nlpD lipoprotein NlpD; Provisional Probab=80.41 E-value=4 Score=20.88 Aligned_cols=21 Identities=33% Similarity=0.624 Sum_probs=14.4 Q ss_pred CCHHHHHHHHHHHHHHHCCCEEE Q ss_conf 20023699999999984054120 Q gi|254781045|r 2 HFYRFILLNLYMLTLFSHGCTQI 24 (162) Q Consensus 2 ~f~~~~~~~l~~~~l~laGCq~~ 24 (162) +|-|++++.| +.+.|+||+.. T Consensus 9 ~~~~~~~~~~--~~~~l~gcs~~ 29 (374) T PRK10871 9 TVRRIAALSL--VSLWLAGCTNT 29 (374) T ss_pred HHHHHHHHHH--HHHHHECCCCC T ss_conf 7789999999--99860103788 No 9 >pfam01299 Lamp Lysosome-associated membrane glycoprotein (Lamp). Probab=79.89 E-value=3.4 Score=21.32 Aligned_cols=17 Identities=18% Similarity=0.503 Sum_probs=14.0 Q ss_pred EEEEEEECCCCCEEEEE Q ss_conf 36578863689736889 Q gi|254781045|r 75 IIGAWKVSYRDVDCKMI 91 (162) Q Consensus 75 l~G~W~vs~~g~sC~v~ 91 (162) -+|.|+|+.+++.|-+. T Consensus 106 ~~G~Y~V~~~n~tClLA 122 (305) T pfam01299 106 AVGNYSVTNGNGTCLLA 122 (305) T ss_pred CCCEEEEECCCCEEHHH T ss_conf 85458997899667654 No 10 >PRK09915 putative outer membrane efflux protein MdtP; Provisional Probab=79.02 E-value=4.2 Score=20.74 Aligned_cols=30 Identities=17% Similarity=0.171 Sum_probs=22.5 Q ss_pred CCHHHHHHHHHHHHHHHCCCEEECCCCCCCCCC Q ss_conf 200236999999999840541203788777876 Q gi|254781045|r 2 HFYRFILLNLYMLTLFSHGCTQIDFGNIFFKKP 34 (162) Q Consensus 2 ~f~~~~~~~l~~~~l~laGCq~~~~~~~~~~p~ 34 (162) +++|+.+..+...+++|+||.. +..+.+|. T Consensus 5 ~~~r~~~~~~l~~~~lLagC~~---~p~~~~p~ 34 (488) T PRK09915 5 QLSRLLLCSILGSTTLISGCAL---VRKDSAPH 34 (488) T ss_pred HHHHHHHHHHHHHHHHHCCCCC---CCCCCCCC T ss_conf 7769999999999999752668---99999999 No 11 >PRK00249 flgH flagellar basal body L-ring protein; Reviewed Probab=78.10 E-value=4.5 Score=20.53 Aligned_cols=23 Identities=35% Similarity=0.512 Sum_probs=15.2 Q ss_pred CCCHHHHHHHHHHHHHHHCCCEEEC Q ss_conf 9200236999999999840541203 Q gi|254781045|r 1 MHFYRFILLNLYMLTLFSHGCTQID 25 (162) Q Consensus 1 m~f~~~~~~~l~~~~l~laGCq~~~ 25 (162) |++.++.++.+ ++++|+||.+.. T Consensus 1 ~~~~~~~~~~~--~~~~LsgCa~~~ 23 (231) T PRK00249 1 MAMMLIALALL--LLLLLSGCASIP 23 (231) T ss_pred CCCHHHHHHHH--HHHHHHHCCCCC T ss_conf 93389999999--999987534899 No 12 >pfam07269 consensus Probab=76.91 E-value=1.3 Score=23.96 Aligned_cols=18 Identities=39% Similarity=0.628 Sum_probs=12.6 Q ss_pred HHHHHHHHHHHHHHCCCEEEC Q ss_conf 236999999999840541203 Q gi|254781045|r 5 RFILLNLYMLTLFSHGCTQID 25 (162) Q Consensus 5 ~~~~~~l~~~~l~laGCq~~~ 25 (162) ||.++.| ++.|||||+.+ T Consensus 2 Ky~ll~l---~l~LAgC~T~d 19 (55) T pfam07269 2 KYCLLLL---ILALAGCQTND 19 (55) T ss_pred HHHHHHH---HHHHHHCCCCC T ss_conf 0149999---99987511467 No 13 >PRK12701 flgH flagellar basal body L-ring protein; Reviewed Probab=75.99 E-value=6.1 Score=19.73 Aligned_cols=22 Identities=23% Similarity=0.383 Sum_probs=13.6 Q ss_pred CCCHHHHHHHHHHHHHHHCCCEEE Q ss_conf 920023699999999984054120 Q gi|254781045|r 1 MHFYRFILLNLYMLTLFSHGCTQI 24 (162) Q Consensus 1 m~f~~~~~~~l~~~~l~laGCq~~ 24 (162) |+=.+++++-| .+++|+||+.. T Consensus 1 m~r~~~~~~~l--a~~lL~GC~~~ 22 (230) T PRK12701 1 MNRLNIAVSCL--ATALLFGCEAL 22 (230) T ss_pred CCHHHHHHHHH--HHHHHHCCCCC T ss_conf 92589999999--99997556688 No 14 >COG3056 Uncharacterized lipoprotein [Cell envelope biogenesis, outer membrane] Probab=75.85 E-value=2.4 Score=22.24 Aligned_cols=30 Identities=20% Similarity=0.228 Sum_probs=17.1 Q ss_pred CHHHHHHHHHHHHHHHCCCEEECCCCCCCCC Q ss_conf 0023699999999984054120378877787 Q gi|254781045|r 3 FYRFILLNLYMLTLFSHGCTQIDFGNIFFKK 33 (162) Q Consensus 3 f~~~~~~~l~~~~l~laGCq~~~~~~~~~~p 33 (162) ..+.+++.| ...++|+|||+..-.-...+| T Consensus 14 ~t~k~L~~l-aa~~lLagC~a~~~tl~~tpp 43 (204) T COG3056 14 MTKKILFPL-AAIFLLAGCAAPPTTLIVTPP 43 (204) T ss_pred HHHHHHHHH-HHHHHHHHCCCCCCEEECCCC T ss_conf 899999999-999999753799750313699 No 15 >COG3317 NlpB Uncharacterized lipoprotein [Cell envelope biogenesis, outer membrane] Probab=74.50 E-value=5.4 Score=20.05 Aligned_cols=22 Identities=23% Similarity=0.421 Sum_probs=16.8 Q ss_pred CCCHHHHHHHHHHHHHHHCCCEE Q ss_conf 92002369999999998405412 Q gi|254781045|r 1 MHFYRFILLNLYMLTLFSHGCTQ 23 (162) Q Consensus 1 m~f~~~~~~~l~~~~l~laGCq~ 23 (162) |.|++..++++ ++++.|+||++ T Consensus 1 ~k~~~~lv~~a-l~v~~LaaCSs 22 (342) T COG3317 1 MKSSAKLVLGA-LLVLLLAACSS 22 (342) T ss_pred CCHHHHHHHHH-HHHHHHHHCCC T ss_conf 91178899999-99998741468 No 16 >PRK12696 flgH flagellar basal body L-ring protein; Reviewed Probab=74.29 E-value=6.2 Score=19.72 Aligned_cols=19 Identities=26% Similarity=0.419 Sum_probs=12.2 Q ss_pred HHHHHHHHHHHHHHCCCEEE Q ss_conf 23699999999984054120 Q gi|254781045|r 5 RFILLNLYMLTLFSHGCTQI 24 (162) Q Consensus 5 ~~~~~~l~~~~l~laGCq~~ 24 (162) |..++.+ ..+++|+||.+. T Consensus 3 ~~~l~~~-~~~~~L~GC~~~ 21 (238) T PRK12696 3 RKLLAAS-CAVLLLSGCNAA 21 (238) T ss_pred HHHHHHH-HHHHHHHCCCCC T ss_conf 8999999-999995165688 No 17 >PRK10866 outer membrane protein assembly complex subunit YfiO; Provisional Probab=73.14 E-value=2.2 Score=22.41 Aligned_cols=23 Identities=26% Similarity=0.582 Sum_probs=18.3 Q ss_pred CCCHHHHHHHHHHHHHHHCCCEEE Q ss_conf 920023699999999984054120 Q gi|254781045|r 1 MHFYRFILLNLYMLTLFSHGCTQI 24 (162) Q Consensus 1 m~f~~~~~~~l~~~~l~laGCq~~ 24 (162) ||=.|+.+..+ .+.|+|+||+.. T Consensus 1 m~~~k~l~~~~-~l~l~l~gCs~~ 23 (243) T PRK10866 1 MTRMKYLVAAA-TLSLFLAGCSGS 23 (243) T ss_pred CCHHHHHHHHH-HHHHHHHHCCCC T ss_conf 94589999999-999999876899 No 18 >PRK09967 putative outer membrane lipoprotein; Provisional Probab=72.43 E-value=2.4 Score=22.26 Aligned_cols=20 Identities=20% Similarity=0.476 Sum_probs=16.3 Q ss_pred HHHHHHHHHHHHHHCCCEEE Q ss_conf 23699999999984054120 Q gi|254781045|r 5 RFILLNLYMLTLFSHGCTQI 24 (162) Q Consensus 5 ~~~~~~l~~~~l~laGCq~~ 24 (162) |..++.+++..|+|+|||+. T Consensus 3 k~~~~~~l~~~l~lsgC~s~ 22 (160) T PRK09967 3 KHLVAPLIFTSLILTGCQSP 22 (160) T ss_pred HHHHHHHHHHHHHHHHCCCC T ss_conf 78999999999999845899 No 19 >pfam04170 NlpE Uncharacterized lipoprotein NlpE involved in copper resistance. This family represents a bacterial outer membrane lipoprotein that is necessary for signalling by the Cpx pathway. This pathway responds to cell envelope disturbances and increases the expression of periplasmic protein folding and degradation factors. While the molecular function of the NlpE protein is unknown, it may be involved in detecting bacterial adhesion to abiotic surfaces. In Escherichia coli and Salmonella typhi, NlpE is also known to confer copper tolerance in copper-sensitive strains of Escherichia coli, and may be involved in copper efflux and delivery of copper to copper-dependent enzymes. Probab=71.75 E-value=6.3 Score=19.67 Aligned_cols=45 Identities=22% Similarity=0.390 Sum_probs=34.2 Q ss_pred CHHCCCCEEECCCCEEEEECCCCCEEEEEEECCCCCEECCCCCCCCEEE Q ss_conf 0000210033387189998289987999995489732201137896188 Q gi|254781045|r 111 RLASLAAWNIIDEDSFELKNKSGQTIIVFYKTAEQSFEGSFQGESDKVI 159 (162) Q Consensus 111 ~L~~i~aW~v~G~~vl~L~D~sG~~v~~l~~s~~grfeG~t~~~G~pis 159 (162) .......|+..| ++++|.|..|+ .+.|+...+..+=.-. +|+||. T Consensus 40 ~~~g~~~W~~~~-~~i~L~~~~~~--~~~y~v~~~~L~~LD~-~G~~I~ 84 (86) T pfam04170 40 TFAGYGTWNRTG-DKITLTDSEGE--KTQYFVGENRLEMLDR-EGKRIT 84 (86) T ss_pred EEEEEEEEECCC-CEEEEECCCCC--EEEEEECCCEEEEECC-CCCCCC T ss_conf 687689997589-99999438998--7799987998982446-999687 No 20 >pfam04525 DUF567 Protein of unknown function (DUF567). Family of uncharacterized proteins. This family contains both plant and bacterial members. Probab=71.55 E-value=8.2 Score=18.97 Aligned_cols=28 Identities=18% Similarity=0.256 Sum_probs=15.0 Q ss_pred CEEEEECCCCCEEEEEEEC---CCCCEECCC Q ss_conf 1899982899879999954---897322011 Q gi|254781045|r 124 DSFELKNKSGQTIIVFYKT---AEQSFEGSF 151 (162) Q Consensus 124 ~vl~L~D~sG~~v~~l~~s---~~grfeG~t 151 (162) +.++|.|..|+++..+.+- =.++|++.+ T Consensus 52 ~~~~LmD~~G~~LltirrK~lsl~~~W~~y~ 82 (187) T pfam04525 52 DERVLMDSSGKPLLTIRRKKLSLHDRWEVYR 82 (187) T ss_pred CEEEEECCCCCEEEEEEEHHCCCCCEEEEEC T ss_conf 8699997999998999963301245799995 No 21 >PRK12698 flgH flagellar basal body L-ring protein; Reviewed Probab=71.22 E-value=7.1 Score=19.33 Aligned_cols=17 Identities=47% Similarity=0.948 Sum_probs=11.2 Q ss_pred HHHHHHHHHHHHHHCCCEEE Q ss_conf 23699999999984054120 Q gi|254781045|r 5 RFILLNLYMLTLFSHGCTQI 24 (162) Q Consensus 5 ~~~~~~l~~~~l~laGCq~~ 24 (162) ||+++.+ +++|+||..+ T Consensus 3 r~~l~~~---~l~L~gCa~~ 19 (224) T PRK12698 3 RYILLAL---ALLLAGCSST 19 (224) T ss_pred HHHHHHH---HHHHHCCCCC T ss_conf 7999999---9998365688 No 22 >PRK10672 rare lipoprotein A; Provisional Probab=70.77 E-value=5 Score=20.27 Aligned_cols=39 Identities=13% Similarity=-0.013 Sum_probs=25.3 Q ss_pred HHHHHHHHHHHHHHCCCEEECCCCCC-CCCCCCCCCCCCC Q ss_conf 23699999999984054120378877-7876668887434 Q gi|254781045|r 5 RFILLNLYMLTLFSHGCTQIDFGNIF-FKKPEISLPPSVE 43 (162) Q Consensus 5 ~~~~~~l~~~~l~laGCq~~~~~~~~-~~p~~a~p~~~V~ 43 (162) |.-.|.+.+++++|+||.+.+-.... .+|.++.+.++|+ T Consensus 2 r~~wl~~~~~~~ll~~c~~~~~~~~~~~~p~~~~~~~p~~ 41 (369) T PRK10672 2 RKQWLGICIAAGLLAACTSDDGQQQTVSQPQPAVCNGPTV 41 (369) T ss_pred CHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCC T ss_conf 3335899999999865258864556667898767887612 No 23 >PRK13883 conjugal transfer protein TrbH; Provisional Probab=70.48 E-value=3.9 Score=20.97 Aligned_cols=23 Identities=35% Similarity=0.639 Sum_probs=16.7 Q ss_pred HHHHHHHHHHCCCE-EECCCCCCC Q ss_conf 99999999840541-203788777 Q gi|254781045|r 9 LNLYMLTLFSHGCT-QIDFGNIFF 31 (162) Q Consensus 9 ~~l~~~~l~laGCq-~~~~~~~~~ 31 (162) +.+++++++|+||- +..|||+-. T Consensus 5 ~~~all~laL~gCAtt~~YGNFv~ 28 (156) T PRK13883 5 LSLALLALALGGCATTSQYGNFVQ 28 (156) T ss_pred HHHHHHHHHHHCCCCCCCCCCCCC T ss_conf 999999999703313578877358 No 24 >PRK10783 mltD membrane-bound lytic murein transglycosylase D; Provisional Probab=70.00 E-value=8.8 Score=18.76 Aligned_cols=32 Identities=19% Similarity=0.237 Sum_probs=17.8 Q ss_pred CCCCHHEEEEEEEC--CCCCEEEEEEECCCCCCCCCC Q ss_conf 37701136578863--689736889713667777145 Q gi|254781045|r 69 NAIRMGIIGAWKVS--YRDVDCKMILTLTRFKKNFRG 103 (162) Q Consensus 69 ~~~r~sl~G~W~vs--~~g~sC~v~Lt~t~~~~Gyra 103 (162) +.++..-+|-|..- +| + ...|..+.|-++=|- T Consensus 135 A~S~a~AaGlWQFmp~Tg-r--~yGL~~n~w~DeRrD 168 (449) T PRK10783 135 ATSGANAAGIWQIIPSTG-R--NYGLKQTRWYDARRD 168 (449) T ss_pred CCCCCCCCCCCCCCHHHH-H--HCCCCCCCCCCCCCC T ss_conf 836988830010267679-8--759873664213589 No 25 >TIGR02747 TraV type IV conjugative transfer system protein TraV; InterPro: IPR014118 This entry includes TraV, which is a component of conjugative type IV secretion system. TraV is an outer membrane lipoprotein that is believed to interact with the secretin TraK , , . The alignment contains three conserved cysteines in the N-terminal half.. Probab=67.66 E-value=2.9 Score=21.74 Aligned_cols=27 Identities=26% Similarity=0.509 Sum_probs=18.4 Q ss_pred HHHHHHHHHHHHHH-HCCCEE-ECC--CCCC Q ss_conf 02369999999998-405412-037--8877 Q gi|254781045|r 4 YRFILLNLYMLTLF-SHGCTQ-IDF--GNIF 30 (162) Q Consensus 4 ~~~~~~~l~~~~l~-laGCq~-~~~--~~~~ 30 (162) -|+.+|.++.+++| |+||+. .-+ +.+| T Consensus 2 mr~~~L~~~~~~~f~LtGCsa~~g~i~~~~f 32 (174) T TIGR02747 2 MRLKVLLLLACVAFLLTGCSASLGLIHNSDF 32 (174) T ss_pred CHHHHHHHHHHHHHHHHHHHHHCCCCCCCCC T ss_conf 0678999999998720025774565258897 No 26 >COG3417 FlgN Collagen-binding surface adhesin SpaP (antigen I/II family) [General function prediction only] Probab=67.25 E-value=7.6 Score=19.14 Aligned_cols=17 Identities=35% Similarity=0.831 Sum_probs=12.6 Q ss_pred HHHHHHHHHHHHCCCEE Q ss_conf 69999999998405412 Q gi|254781045|r 7 ILLNLYMLTLFSHGCTQ 23 (162) Q Consensus 7 ~~~~l~~~~l~laGCq~ 23 (162) ++..++.+++++.||+. T Consensus 6 ~~~~il~~al~l~GCs~ 22 (200) T COG3417 6 IYASILLLALFLSGCSS 22 (200) T ss_pred HHHHHHHHHHHHHHCCC T ss_conf 99999999999841136 No 27 >PRK12697 flgH flagellar basal body L-ring protein; Reviewed Probab=66.67 E-value=7.2 Score=19.31 Aligned_cols=17 Identities=29% Similarity=0.403 Sum_probs=12.2 Q ss_pred HHHHHHHHHHCCCEEEC Q ss_conf 99999999840541203 Q gi|254781045|r 9 LNLYMLTLFSHGCTQID 25 (162) Q Consensus 9 ~~l~~~~l~laGCq~~~ 25 (162) -..++.+|+|+||..+. T Consensus 12 ~~~al~~l~LsGCa~~~ 28 (227) T PRK12697 12 AACALAALALAGCAQIP 28 (227) T ss_pred HHHHHHHHHHHCCCCCC T ss_conf 99999999972656789 No 28 >PRK11189 lipoprotein NlpI; Provisional Probab=64.82 E-value=4.6 Score=20.50 Aligned_cols=21 Identities=24% Similarity=0.561 Sum_probs=14.2 Q ss_pred CCCHHHHHHHHHHHHHHHCCCEE Q ss_conf 92002369999999998405412 Q gi|254781045|r 1 MHFYRFILLNLYMLTLFSHGCTQ 23 (162) Q Consensus 1 m~f~~~~~~~l~~~~l~laGCq~ 23 (162) |.|.|+.++.+ .++.|+||.+ T Consensus 2 ~~~~r~~~~~~--~~l~LsGC~s 22 (297) T PRK11189 2 KPFLRWCFVAT--AALLLAGCAS 22 (297) T ss_pred CHHHHHHHHHH--HHHHHHHHCC T ss_conf 51899999999--9999986405 No 29 >PRK11063 metQ DL-methionine transporter substrate-binding subunit; Provisional Probab=63.87 E-value=5.3 Score=20.12 Aligned_cols=25 Identities=24% Similarity=0.260 Sum_probs=17.9 Q ss_pred CCCHHHHHHHH--HHHHHHHCCCEEEC Q ss_conf 92002369999--99999840541203 Q gi|254781045|r 1 MHFYRFILLNL--YMLTLFSHGCTQID 25 (162) Q Consensus 1 m~f~~~~~~~l--~~~~l~laGCq~~~ 25 (162) |.|.+..|+.+ .+++++|+||...+ T Consensus 1 m~~~~k~~~~~~~l~~~l~l~gCg~~~ 27 (271) T PRK11063 1 MAFKFKTFAAVGALIGSLALVGCGQDE 27 (271) T ss_pred CCHHHHHHHHHHHHHHHHHHCCCCCCC T ss_conf 960299999999999999750058985 No 30 >TIGR02722 lp_ uncharacterized lipoprotein; InterPro: IPR014094 Members of this protein family are restricted to the Proteobacteria, and all are predicted lipoproteins. In genomes that contain the thiK gene for the salvage enzyme thiamin kinase, the member of this family is encoded nearby.. Probab=63.83 E-value=5.3 Score=20.13 Aligned_cols=18 Identities=28% Similarity=0.565 Sum_probs=14.1 Q ss_pred HHHHHHHHHHHCCCEEEC Q ss_conf 999999999840541203 Q gi|254781045|r 8 LLNLYMLTLFSHGCTQID 25 (162) Q Consensus 8 ~~~l~~~~l~laGCq~~~ 25 (162) +..++.++|+|+||+..+ T Consensus 6 l~~~~~~Al~L~GC~~~~ 23 (215) T TIGR02722 6 LIFVALLALLLSGCVSQR 23 (215) T ss_pred HHHHHHHHHHHHCCCCCC T ss_conf 899999999985468872 No 31 >PRK13859 type IV secretion system lipoprotein VirB7; Provisional Probab=62.11 E-value=4 Score=20.89 Aligned_cols=18 Identities=39% Similarity=0.689 Sum_probs=12.1 Q ss_pred HHHHHHHHHHHHHHCCCEEEC Q ss_conf 236999999999840541203 Q gi|254781045|r 5 RFILLNLYMLTLFSHGCTQID 25 (162) Q Consensus 5 ~~~~~~l~~~~l~laGCq~~~ 25 (162) ||-+| .+++.|++||+.+ T Consensus 2 KY~lL---~l~l~La~CqT~D 19 (55) T PRK13859 2 KYCLL---CLALALAGCQTND 19 (55) T ss_pred CHHHH---HHHHHHHHCCCCC T ss_conf 01399---9999998600468 No 32 >PRK10802 peptidoglycan-associated outer membrane lipoprotein; Provisional Probab=61.63 E-value=13 Score=17.76 Aligned_cols=25 Identities=8% Similarity=0.170 Sum_probs=14.0 Q ss_pred CCCHHHHHHH-HHHHHHHHCCCEEEC Q ss_conf 9200236999-999999840541203 Q gi|254781045|r 1 MHFYRFILLN-LYMLTLFSHGCTQID 25 (162) Q Consensus 1 m~f~~~~~~~-l~~~~l~laGCq~~~ 25 (162) |.|.|+.-.. +++.+++|++|+++. T Consensus 1 M~~nk~~K~l~ia~~~l~LaACSS~~ 26 (173) T PRK10802 1 MQLNKVLKGLMIALPVMAIAACSSNK 26 (173) T ss_pred CCHHHHHHHHHHHHHHHHHHHCCCCC T ss_conf 96078999999999999998557999 No 33 >PRK13835 conjugal transfer protein TrbH; Provisional Probab=61.03 E-value=6.9 Score=19.41 Aligned_cols=16 Identities=38% Similarity=0.727 Sum_probs=12.2 Q ss_pred HHHHHHHHHHHCCCEE Q ss_conf 9999999998405412 Q gi|254781045|r 8 LLNLYMLTLFSHGCTQ 23 (162) Q Consensus 8 ~~~l~~~~l~laGCq~ 23 (162) ++...+++++|+|||+ T Consensus 4 ll~~~i~a~~lsgCqt 19 (144) T PRK13835 4 LLAACILALLLSGCQT 19 (144) T ss_pred HHHHHHHHHHHHHCCC T ss_conf 9999999998640413 No 34 >COG4314 NosL Predicted lipoprotein involved in nitrous oxide reduction [Energy production and conversion] Probab=60.25 E-value=7.2 Score=19.30 Aligned_cols=30 Identities=20% Similarity=0.178 Sum_probs=18.0 Q ss_pred HHHHHHHHHHHHHHCCCEEECCCCCCCCCCCCC Q ss_conf 236999999999840541203788777876668 Q gi|254781045|r 5 RFILLNLYMLTLFSHGCTQIDFGNIFFKKPEIS 37 (162) Q Consensus 5 ~~~~~~l~~~~l~laGCq~~~~~~~~~~p~~a~ 37 (162) |-.+|....+.++||||++.+ ..++|+|.+ T Consensus 2 kr~Lla~la~~~llAgC~~~e---d~~~p~P~~ 31 (176) T COG4314 2 KRTLLAILAVTALLAGCRQAE---DGAPPLPRQ 31 (176) T ss_pred CHHHHHHHHHHHHHHHCCHHH---CCCCCCCCC T ss_conf 403799999999987534311---389998702 No 35 >TIGR02377 MocE_fam_FeS Rieske [2Fe-2S] domain protein, MocE subfamily; InterPro: IPR012747 This entry describes a subfamily of the Rieske-like [2Fe-2S] family of ferredoxins that includes MocE, part of the rhizopine (3-O-methyl-scyllo-inosamine) catabolic cluster in Rhizobium. Members are related to, yet distinct from, the small subunit of nitrite reductase [NAD(P)H].. Probab=59.83 E-value=9.9 Score=18.45 Aligned_cols=27 Identities=22% Similarity=0.610 Sum_probs=19.1 Q ss_pred EECCCCEEEEECCCCCEEEEEEECCCCCE Q ss_conf 33387189998289987999995489732 Q gi|254781045|r 119 NIIDEDSFELKNKSGQTIIVFYKTAEQSF 147 (162) Q Consensus 119 ~v~G~~vl~L~D~sG~~v~~l~~s~~grf 147 (162) +|--++++|+ ||+||+.|.| +++++.+ T Consensus 10 di~~Edv~Rf-DHgGRtfAIy-R~pDD~y 36 (101) T TIGR02377 10 DIDREDVIRF-DHGGRTFAIY-RTPDDEY 36 (101) T ss_pred CCCCCCCEEE-CCCCCEEEEE-ECCCCCE T ss_conf 6576661686-2799505887-2789854 No 36 >PRK10781 rcsF outer membrane lipoprotein; Reviewed Probab=58.64 E-value=11 Score=18.16 Aligned_cols=126 Identities=13% Similarity=0.157 Sum_probs=56.9 Q ss_pred HHHHHHHHHHCCCEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHEEE-EEEE-C-CCC Q ss_conf 999999998405412037887778766688874345735899888778865446676322377011365-7886-3-689 Q gi|254781045|r 9 LNLYMLTLFSHGCTQIDFGNIFFKKPEISLPPSVESEILLPPIPEEEFDQDDISVPSKDNNAIRMGIIG-AWKV-S-YRD 85 (162) Q Consensus 9 ~~l~~~~l~laGCq~~~~~~~~~~p~~a~p~~~V~s~~l~pp~~~~~~~~~~~~~p~~a~~~~r~sl~G-~W~v-s-~~g 85 (162) |-+.+++|+++||+-.++....+.. +-.. ++..++.-+.++-+.|.. +--..++++| -++. . ..| T Consensus 4 lpi~llal~ltGCs~l~~~p~~~~~----------~~~~-~~~~~~~~~k~~r~apVk-lY~~~e~L~g~pf~~LG~V~G 71 (133) T PRK10781 4 LPICLLALMLTGCSMLSRSPVEPVQ----------STAP-PPKAEPAKPKAPRAAPVR-IYTNAEELVGKPFRDLGEVSG 71 (133) T ss_pred HHHHHHHHHHHCCCCCCCCCCCCCC----------CCCC-CCCCCCCCCCCCCCCCEE-EECCHHHHCCCCCHHCCEEEC T ss_conf 8999999998431344548876444----------6678-777678777778888668-766877865897223034656 Q ss_pred CEEEEEEECCCCCCCCCCCCCCCCCCHHCCCCEEECCCCEEEEECCCCCEEEEEEECCCCCEECCCCCCCCEEEEE Q ss_conf 7368897136677771454367730000021003338718999828998799999548973220113789618873 Q gi|254781045|r 86 VDCKMILTLTRFKKNFRGTARSCHGRLASLAAWNIIDEDSFELKNKSGQTIIVFYKTAEQSFEGSFQGESDKVIIS 161 (162) Q Consensus 86 ~sC~v~Lt~t~~~~Gyra~~~gC~g~L~~i~aW~v~G~~vl~L~D~sG~~v~~l~~s~~grfeG~t~~~G~pisLs 161 (162) .+|+.....-+- +---|. ....+++=+++. |.|+|+.- . ..+...|=|.-..- .|++|.++ T Consensus 72 esCQ~~~qd~Pa-si~~AR------t~ar~~AA~m~A-Navll~~C--~----i~~~~~gC~s~aiC-~G~Al~v~ 132 (133) T PRK10781 72 ESCQASNQDSPP-SIPTAR------KRMQINASKMKA-NAVLLHSC--E----ITSGTPGCYRQAVC-IGSALNIS 132 (133) T ss_pred CCCCCCCCCCCC-CHHHHH------HHHHHHHHHCCC-CEEEEEEE--E----EECCCCCHHHHHEE-EEEEEEEC T ss_conf 201157778998-679999------999999985579-86999765--7----75388653454414-00365412 No 37 >PRK10461 thiamine biosynthesis lipoprotein ApbE; Provisional Probab=58.41 E-value=5.2 Score=20.18 Aligned_cols=20 Identities=45% Similarity=0.715 Sum_probs=15.3 Q ss_pred CCCHHHHHHHHHHHHHHHCCCEE Q ss_conf 92002369999999998405412 Q gi|254781045|r 1 MHFYRFILLNLYMLTLFSHGCTQ 23 (162) Q Consensus 1 m~f~~~~~~~l~~~~l~laGCq~ 23 (162) |+|.|++||.+ .+++.||+. T Consensus 3 ~~~~~~~ll~~---~~~l~gC~~ 22 (351) T PRK10461 3 MTFTRVALLAA---ALLLVGCDQ 22 (351) T ss_pred CHHHHHHHHHH---HHHHHHHCC T ss_conf 30799999999---999987248 No 38 >PRK12700 flgH flagellar basal body L-ring protein; Reviewed Probab=56.86 E-value=16 Score=17.25 Aligned_cols=20 Identities=25% Similarity=0.484 Sum_probs=11.8 Q ss_pred CHHHHHHHHHHHHHHHCCCEEE Q ss_conf 0023699999999984054120 Q gi|254781045|r 3 FYRFILLNLYMLTLFSHGCTQI 24 (162) Q Consensus 3 f~~~~~~~l~~~~l~laGCq~~ 24 (162) -.|+.+.. ++.++|+||+.. T Consensus 6 ~~Rl~~~~--~~~~ll~GCa~~ 25 (230) T PRK12700 6 VLRLPVCA--ALLALAAGCAMI 25 (230) T ss_pred HHHHHHHH--HHHHHHHCCCCC T ss_conf 99999999--999997444689 No 39 >PRK12450 foldase protein PrsA; Reviewed Probab=56.45 E-value=8.9 Score=18.75 Aligned_cols=24 Identities=8% Similarity=0.144 Sum_probs=17.7 Q ss_pred CCCHHHHHHHHH--HHHHHHCCCEEE Q ss_conf 920023699999--999984054120 Q gi|254781045|r 1 MHFYRFILLNLY--MLTLFSHGCTQI 24 (162) Q Consensus 1 m~f~~~~~~~l~--~~~l~laGCq~~ 24 (162) |.-.|..+++++ ..+|+|+||+.. T Consensus 1 m~~mKK~~~~~~~~~svl~LaAC~s~ 26 (309) T PRK12450 1 MKQMNKLITGVVTLATVVTLSACQSS 26 (309) T ss_pred CCHHHHHHHHHHHHHHHHHHHHHCCC T ss_conf 91799999999999999999860589 No 40 >pfam06291 Lambda_Bor Bor protein. This family consists of several Bacteriophage lambda Bor and Escherichia coli Iss proteins. Expression of bor significantly increases the survival of the Escherichia coli host cell in animal serum. This property is a well known bacterial virulence determinant indeed, bor and its adjacent sequences are highly homologous to the iss serum resistance locus of the plasmid ColV2-K94, which confers virulence in animals. It has been suggested that lysogeny may generally have a role in bacterial survival in animal hosts, and perhaps in pathogenesis. Probab=55.06 E-value=15 Score=17.38 Aligned_cols=23 Identities=35% Similarity=0.683 Sum_probs=14.0 Q ss_pred HHHHHHHHHHHHHHCCCEE--ECCCC Q ss_conf 2369999999998405412--03788 Q gi|254781045|r 5 RFILLNLYMLTLFSHGCTQ--IDFGN 28 (162) Q Consensus 5 ~~~~~~l~~~~l~laGCq~--~~~~~ 28 (162) |..++.. +++|+|+||.+ ...++ T Consensus 2 Kk~~~~~-~~allLtgCa~QT~~~~~ 26 (97) T pfam06291 2 KKMLFAA-ALALLITGCAQQTFTVGN 26 (97) T ss_pred HHHHHHH-HHHHHHCCCCCEEEEECC T ss_conf 2259999-999997213304999357 No 41 >PRK09837 copper/silver efflux system outer membrane protein CusC; Provisional Probab=53.00 E-value=16 Score=17.10 Aligned_cols=29 Identities=14% Similarity=0.314 Sum_probs=17.8 Q ss_pred CCCHHHHHHHHHHHHHHHCCCEEECCCCCCCCCCC Q ss_conf 92002369999999998405412037887778766 Q gi|254781045|r 1 MHFYRFILLNLYMLTLFSHGCTQIDFGNIFFKKPE 35 (162) Q Consensus 1 m~f~~~~~~~l~~~~l~laGCq~~~~~~~~~~p~~ 35 (162) |+=+|+..+. ++++|+||. .++.|..|.. T Consensus 1 ~~~~rll~l~---~~l~L~gC~---~~P~y~~P~~ 29 (460) T PRK09837 1 MSPCKLLPFC---VALALTGCS---LAPDYQRPAM 29 (460) T ss_pred CCHHHHHHHH---HHHHHCCCC---CCCCCCCCCC T ss_conf 9757899999---999982477---8999999699 No 42 >PRK10449 heat-inducible protein; Provisional Probab=50.92 E-value=9.5 Score=18.57 Aligned_cols=104 Identities=18% Similarity=0.154 Sum_probs=50.5 Q ss_pred HHHHHHHHHHHCCCEEECCCCCCCCCCCCCCCCCCCCCCCCC-------CCCCCCCCCC-CCC----CCCCCCCCCCHHE Q ss_conf 999999999840541203788777876668887434573589-------9888778865-446----6763223770113 Q gi|254781045|r 8 LLNLYMLTLFSHGCTQIDFGNIFFKKPEISLPPSVESEILLP-------PIPEEEFDQD-DIS----VPSKDNNAIRMGI 75 (162) Q Consensus 8 ~~~l~~~~l~laGCq~~~~~~~~~~p~~a~p~~~V~s~~l~p-------p~~~~~~~~~-~~~----~p~~a~~~~r~sl 75 (162) ++.+..+.++++||++..-. +|..++|.. .++.+...++ +++ ..-.+-..+=+.. T Consensus 4 ~l~l~~~~llLagC~s~~~~-------------~vs~~~Lq~h~wvL~svdG~~v~~~~~~p~l~F~e~~~vsg~gCN~f 70 (140) T PRK10449 4 VVALVALSLLMAGCVSSGKI-------------SVTPEQLQHHRFVLESVNGKPVTSDKNPPEISFGEKMHISGSMCNRF 70 (140) T ss_pred HHHHHHHHHHHHHCCCCCCC-------------CCCHHHCCCCEEEEEEECCEECCCCCCCCEEEECCCCEEEECCCCCE T ss_conf 49999999999752389988-------------76978837854899997895367889996279867864800234650 Q ss_pred EEEEEECCCCCEEEEEEECCCCCCCCCCCCC-CCCCC-H-----------HCCCCEEECCCCEEEEECCCCCEE Q ss_conf 6578863689736889713667777145436-77300-0-----------002100333871899982899879 Q gi|254781045|r 76 IGAWKVSYRDVDCKMILTLTRFKKNFRGTAR-SCHGR-L-----------ASLAAWNIIDEDSFELKNKSGQTI 136 (162) Q Consensus 76 ~G~W~vs~~g~sC~v~Lt~t~~~~Gyra~~~-gC~g~-L-----------~~i~aW~v~G~~vl~L~D~sG~~v 136 (162) .|..+++.+ .|+-.+ =|.+| -|+++ + ...+.-++++ +.|.|.+....-+ T Consensus 71 ~G~~~l~~~------~L~v~~-----lasT~m~C~dp~l~~~E~~i~~~L~~~a~v~l~~-~~LtL~~~~~tL~ 132 (140) T PRK10449 71 SGEGKLSDG------ELTVKG-----LAMTRMMCADPQLNELDNTISEMLKKGAQVDLTA-NQLTLATAEQTLV 132 (140) T ss_pred EEEEEECCC------EEEECH-----HHCCCCCCCCHHHHHHHHHHHHHHHCCCEEEEEC-CEEEEECCCCEEE T ss_conf 603898598------799830-----1100546898689999999999962476799948-9899956985899 No 43 >PRK09578 periplasmic multidrug efflux lipoprotein precursor; Reviewed Probab=50.32 E-value=18 Score=16.93 Aligned_cols=19 Identities=26% Similarity=0.473 Sum_probs=12.6 Q ss_pred HHHHHHHHHHHHHHHCCCEE Q ss_conf 02369999999998405412 Q gi|254781045|r 4 YRFILLNLYMLTLFSHGCTQ 23 (162) Q Consensus 4 ~~~~~~~l~~~~l~laGCq~ 23 (162) .|++++.| +.+++|+||+. T Consensus 7 ~~~~l~~l-~~~~~L~gC~~ 25 (385) T PRK09578 7 RRLALAAL-VAAFALAGCGK 25 (385) T ss_pred HHHHHHHH-HHHHHHHCCCC T ss_conf 99999999-99999816799 No 44 >PRK11679 lipoprotein; Provisional Probab=48.87 E-value=21 Score=16.47 Aligned_cols=87 Identities=17% Similarity=0.135 Sum_probs=38.7 Q ss_pred HHHHHHHHHHHHHHHCCCEEE---------CCCCCCCCCCCCCCCC-----CCCCCCCCCCCCCCC---CCCCCCCCCCC Q ss_conf 023699999999984054120---------3788777876668887-----434573589988877---88654466763 Q gi|254781045|r 4 YRFILLNLYMLTLFSHGCTQI---------DFGNIFFKKPEISLPP-----SVESEILLPPIPEEE---FDQDDISVPSK 66 (162) Q Consensus 4 ~~~~~~~l~~~~l~laGCq~~---------~~~~~~~~p~~a~p~~-----~V~s~~l~pp~~~~~---~~~~~~~~p~~ 66 (162) ++...+.-.+++++|++|++. +|.+...+|++.--+| +.++....=|..+.. ...-++-||.. T Consensus 8 ~~~~~v~~~~lv~~L~ACss~~~~rrQa~gd~~Yl~~~~~~~L~vPagl~~P~~~~~Y~IP~~~~~g~vGk~lDIRpP~q 87 (345) T PRK11679 8 SRLAKVAGVSLVLLLAACSSDQRYKRQVSGDESYLEAPPLKELHAPAGMILPVQNGDYDIPVGNGSGAVGKALDIRPPAQ 87 (345) T ss_pred HHHHHHHHHHHHHHHHHCCCCHHHHHHHCCCCCHHCCCCCCCCCCCCCCCCCCCCCCEECCCCCCCCCCCCCCCCCCHHH T ss_conf 03777888999999986079757777635982110188886654898757778898420687666665442357688647 Q ss_pred CCCCCCHHEEEEEEECCCCCEEEEEEECC Q ss_conf 22377011365788636897368897136 Q gi|254781045|r 67 DNNAIRMGIIGAWKVSYRDVDCKMILTLT 95 (162) Q Consensus 67 a~~~~r~sl~G~W~vs~~g~sC~v~Lt~t 95 (162) +..+. -|++ +-.++..-++++... T Consensus 88 vL~l~----~gsr-~e~~g~~~~~lv~~~ 111 (345) T PRK11679 88 PLALI----SGAR-TQFNGDTATLLLENG 111 (345) T ss_pred HHCCC----CCCE-EEECCCEEEEEEECC T ss_conf 64547----8836-873797179998378 No 45 >TIGR01004 PulS_OutS lipoprotein, PulS/OutS family; InterPro: IPR005699 This family comprises lipoproteins from four gamma proteobacterial species: PulS protein of Klebsiella pneumoniae (P20440 from SWISSPROT), the OutS protein of Erwinia chrysanthemi (Q01567 from SWISSPROT) and Pectobacterium chrysanthemi, and the functionally uncharacterised E. coli protein EtpO. PulS and OutS have been shown to interact with and facilitate insertion of secretins into the outer membrane, suggesting a chaperone-like, or piloting function for members of this family.; GO: 0008565 protein transporter activity, 0006886 intracellular protein transport. Probab=48.29 E-value=9 Score=18.70 Aligned_cols=43 Identities=19% Similarity=0.260 Sum_probs=19.6 Q ss_pred HHHHHHHHHHHHCCCEEECCCCCCCCCCCCCCCCCCCCCCCCCC Q ss_conf 69999999998405412037887778766688874345735899 Q gi|254781045|r 7 ILLNLYMLTLFSHGCTQIDFGNIFFKKPEISLPPSVESEILLPP 50 (162) Q Consensus 7 ~~~~l~~~~l~laGCq~~~~~~~~~~p~~a~p~~~V~s~~l~pp 50 (162) .++.+ ++++.++|||+..---+-+.-..|+=+++-|=+||.+. T Consensus 11 ~~~~~-~~~v~lsgCqtPaPvqn~~~~~~a~Vp~~eQleQlAS~ 53 (136) T TIGR01004 11 VVLSL-LVVVLLSGCQTPAPVQNRAIRKAAAVPASEQLEQLASV 53 (136) T ss_pred HHHHH-HHHHHHHHCCCCCCCCCCCCCCCCCCCHHHHHHHHHHH T ss_conf 99999-99998640478998888755557878877789999999 No 46 >pfam08139 LPAM_1 Prokaryotic membrane lipoprotein lipid attachment site. In prokaryotes, membrane lipoproteins are synthesized with a precursor signal peptide, which is cleaved by a specific lipoprotein signal peptidase (signal peptidase II). The peptidase recognizes a conserved sequence and cuts upstream of a cysteine residue to which a glyceride-fatty acid lipid is attached. Probab=47.70 E-value=13 Score=17.69 Aligned_cols=14 Identities=21% Similarity=0.531 Sum_probs=9.3 Q ss_pred HHHHHHCCCEEECC Q ss_conf 99998405412037 Q gi|254781045|r 13 MLTLFSHGCTQIDF 26 (162) Q Consensus 13 ~~~l~laGCq~~~~ 26 (162) .+.++|+||++... T Consensus 9 ~~~l~LagCas~~~ 22 (26) T pfam08139 9 LALLLLAGCASXXX 22 (26) T ss_pred HHHHHHHCCCCCCC T ss_conf 99999823320013 No 47 >PRK10760 murein hydrolase B; Provisional Probab=47.49 E-value=22 Score=16.33 Aligned_cols=12 Identities=17% Similarity=0.390 Sum_probs=9.1 Q ss_pred HHHHHHHCCCEE Q ss_conf 999998405412 Q gi|254781045|r 12 YMLTLFSHGCTQ 23 (162) Q Consensus 12 ~~~~l~laGCq~ 23 (162) ..+.++|++|++ T Consensus 8 ~~~~~~l~~css 19 (357) T PRK10760 8 LPLFVLLAACSS 19 (357) T ss_pred HHHHHHHHHHCC T ss_conf 999999998518 No 48 >PRK11548 hypothetical protein; Provisional Probab=46.67 E-value=14 Score=17.48 Aligned_cols=24 Identities=17% Similarity=0.476 Sum_probs=13.9 Q ss_pred CCCHHHHHHHHHHHHHHHCCCEEEC Q ss_conf 9200236999999999840541203 Q gi|254781045|r 1 MHFYRFILLNLYMLTLFSHGCTQID 25 (162) Q Consensus 1 m~f~~~~~~~l~~~~l~laGCq~~~ 25 (162) |+.-+.....+ ++.++++||+..+ T Consensus 1 m~~k~l~~a~l-l~~lllsgCS~~~ 24 (113) T PRK11548 1 MRCKTLTAAAA-VLLMLTAGCSTLE 24 (113) T ss_pred CCHHHHHHHHH-HHHHHHCCCCCCC T ss_conf 92578899999-9999980115787 No 49 >PRK12788 flgH flagellar basal body L-ring protein; Reviewed Probab=46.39 E-value=23 Score=16.23 Aligned_cols=15 Identities=27% Similarity=0.428 Sum_probs=10.2 Q ss_pred HHHHHHHHHHCCCEE Q ss_conf 999999998405412 Q gi|254781045|r 9 LNLYMLTLFSHGCTQ 23 (162) Q Consensus 9 ~~l~~~~l~laGCq~ 23 (162) +.+.+.+++|+||.. T Consensus 4 l~~~~a~l~LsGCa~ 18 (231) T PRK12788 4 LVAILACLALAGCAN 18 (231) T ss_pred HHHHHHHHHHHHHCC T ss_conf 999999999764038 No 50 >pfam07901 DUF1672 Protein of unknown function (DUF1672). This family is composed of hypothetical bacterial proteins of unknown function. Probab=44.74 E-value=15 Score=17.29 Aligned_cols=19 Identities=37% Similarity=0.672 Sum_probs=13.4 Q ss_pred HHHHHHHHHHHHHHCCCEEE Q ss_conf 23699999999984054120 Q gi|254781045|r 5 RFILLNLYMLTLFSHGCTQI 24 (162) Q Consensus 5 ~~~~~~l~~~~l~laGCq~~ 24 (162) |++...| +..|+|.||+.. T Consensus 3 K~i~~il-~~~llL~GCs~m 21 (304) T pfam07901 3 KLIKLIL-IATLLLSGCSTT 21 (304) T ss_pred HHHHHHH-HHHHHHCCCCCC T ss_conf 1899999-999997133445 No 51 >PRK13731 conjugal transfer surface exclusion protein TraT; Provisional Probab=44.67 E-value=13 Score=17.71 Aligned_cols=24 Identities=25% Similarity=0.455 Sum_probs=20.5 Q ss_pred CCCHHHHHHHHHHHHHHHCCCEEE Q ss_conf 920023699999999984054120 Q gi|254781045|r 1 MHFYRFILLNLYMLTLFSHGCTQI 24 (162) Q Consensus 1 m~f~~~~~~~l~~~~l~laGCq~~ 24 (162) |..-|+.+..|+..+|+|.||..+ T Consensus 1 m~~kk~~~~~~~~~~l~lsGC~a~ 24 (243) T PRK13731 1 MKTKKLMMVALVSSTLALSGCGAM 24 (243) T ss_pred CCHHHHHHHHHHHHHHHHCCHHHH T ss_conf 933775799999999997156876 No 52 >pfam05590 DUF769 Xylella fastidiosa protein of unknown function (DUF769). This family consists of several uncharacterized hypothetical proteins of unknown function from Xylella fastidiosa, the organism that causes Pierce's disease in plants. Probab=44.15 E-value=21 Score=16.39 Aligned_cols=31 Identities=16% Similarity=0.039 Sum_probs=16.7 Q ss_pred HHHHHHHHHHCCCEEE-CCCCCCCCCCCCCCC Q ss_conf 9999999984054120-378877787666888 Q gi|254781045|r 9 LNLYMLTLFSHGCTQI-DFGNIFFKKPEISLP 39 (162) Q Consensus 9 ~~l~~~~l~laGCq~~-~~~~~~~~p~~a~p~ 39 (162) .+|...-|+|+||++- -.++.--+|..|-|= T Consensus 9 ~SllaAslLLagCSsgPpIDsrTGKPMmagPw 40 (279) T pfam05590 9 CSLLAASLLLAGCSSGPPIDSRTGKPMMAGPW 40 (279) T ss_pred HHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCC T ss_conf 69999999972378899866777984336886 No 53 >PRK11443 hypothetical protein; Provisional Probab=44.15 E-value=13 Score=17.63 Aligned_cols=13 Identities=31% Similarity=0.618 Sum_probs=10.0 Q ss_pred HHHHHHHHCCCEE Q ss_conf 9999998405412 Q gi|254781045|r 11 LYMLTLFSHGCTQ 23 (162) Q Consensus 11 l~~~~l~laGCq~ 23 (162) +.+++|+|+|||- T Consensus 6 ~~~~~lll~GCq~ 18 (120) T PRK11443 6 APLLALLVSGCQI 18 (120) T ss_pred HHHHHHHHHCCCC T ss_conf 9999999966678 No 54 >COG3111 Periplasmic protein with OB-fold [Function unknown] Probab=43.59 E-value=25 Score=15.96 Aligned_cols=38 Identities=24% Similarity=0.452 Sum_probs=30.0 Q ss_pred CCCCEEEEECCCCCEEEEEEECCCCCEECCCCCCCCEEEEE Q ss_conf 38718999828998799999548973220113789618873 Q gi|254781045|r 121 IDEDSFELKNKSGQTIIVFYKTAEQSFEGSFQGESDKVIIS 161 (162) Q Consensus 121 ~G~~vl~L~D~sG~~v~~l~~s~~grfeG~t~~~G~pisLs 161 (162) .|+|.++|.|.+|+..... .+.+|.|++-..-+.|.|. T Consensus 70 i~~D~y~FrD~sGeI~VeI---dd~~w~g~tv~P~dkV~I~ 107 (128) T COG3111 70 IGDDRYVFRDASGEINVDI---DDKVWNGQTVTPKDKVRIQ 107 (128) T ss_pred ECCCEEEEECCCCCEEEEE---CCCCCCCCCCCCCCEEEEE T ss_conf 0783699975896199981---6011389706856689997 No 55 >PRK12699 flgH flagellar basal body L-ring protein; Reviewed Probab=41.99 E-value=27 Score=15.81 Aligned_cols=28 Identities=11% Similarity=0.083 Sum_probs=14.8 Q ss_pred HHHHHHHHCCCEEECCCCCCCCCCCCCC Q ss_conf 9999998405412037887778766688 Q gi|254781045|r 11 LYMLTLFSHGCTQIDFGNIFFKKPEISL 38 (162) Q Consensus 11 l~~~~l~laGCq~~~~~~~~~~p~~a~p 38 (162) |.++.++|+||....=....-.|..+.| T Consensus 23 ~~~~~~~l~gC~~~~~~p~~~~p~~a~p 50 (246) T PRK12699 23 LIVMLALVGGCSLPTPAPKVQQPMSARP 50 (246) T ss_pred HHHHHHHHCCCCCCCCCCCCCCCCCCCC T ss_conf 9999998604468999876788754689 No 56 >PRK02944 OxaA-like protein precursor; Validated Probab=40.91 E-value=28 Score=15.71 Aligned_cols=18 Identities=22% Similarity=0.510 Sum_probs=12.1 Q ss_pred HHHHHHHHHHHCCCEEEC Q ss_conf 999999999840541203 Q gi|254781045|r 8 LLNLYMLTLFSHGCTQID 25 (162) Q Consensus 8 ~~~l~~~~l~laGCq~~~ 25 (162) +..+.+++++|+||.+++ T Consensus 8 ~~~~~~~~~~lsgC~~~~ 25 (255) T PRK02944 8 LAMVVALMAILAGCSEVN 25 (255) T ss_pred HHHHHHHHHHHHCCCCCC T ss_conf 999999999996246889 No 57 >PRK11627 hypothetical protein; Provisional Probab=39.72 E-value=17 Score=16.96 Aligned_cols=18 Identities=28% Similarity=0.575 Sum_probs=12.6 Q ss_pred HHHHHHHHHHHHHHCCCEE Q ss_conf 2369999999998405412 Q gi|254781045|r 5 RFILLNLYMLTLFSHGCTQ 23 (162) Q Consensus 5 ~~~~~~l~~~~l~laGCq~ 23 (162) |..++.| ...++|+||++ T Consensus 3 kk~~~~l-~a~~lL~gCas 20 (192) T PRK11627 3 KKILFPL-VALFMLAGCAT 20 (192) T ss_pred HHHHHHH-HHHHHHHHHCC T ss_conf 8799999-99999986069 No 58 >PRK00022 lolB outer membrane lipoprotein LolB; Provisional Probab=38.46 E-value=19 Score=16.68 Aligned_cols=12 Identities=25% Similarity=0.750 Sum_probs=9.3 Q ss_pred HHHHHHCCCEEE Q ss_conf 999984054120 Q gi|254781045|r 13 MLTLFSHGCTQI 24 (162) Q Consensus 13 ~~~l~laGCq~~ 24 (162) +++++|+||+++ T Consensus 10 ~~~llLsgCat~ 21 (203) T PRK00022 10 LAALLLAGCASL 21 (203) T ss_pred HHHHHHHHCCCC T ss_conf 999998661489 No 59 >PRK10796 LPS-assembly lipoprotein RlpB; Provisional Probab=37.77 E-value=22 Score=16.38 Aligned_cols=27 Identities=26% Similarity=0.488 Sum_probs=15.7 Q ss_pred CCCHHHHHHHHHHHHHHHCCCE-EECCCCC Q ss_conf 9200236999999999840541-2037887 Q gi|254781045|r 1 MHFYRFILLNLYMLTLFSHGCT-QIDFGNI 29 (162) Q Consensus 1 m~f~~~~~~~l~~~~l~laGCq-~~~~~~~ 29 (162) |-|-+-.|++| .+|+++||- ..+.... T Consensus 1 ~r~l~~l~l~l--avll~agCGFhLRg~~~ 28 (196) T PRK10796 1 MRYLATLLLSL--AVLVTAGCGWHLRGTTQ 28 (196) T ss_pred CHHHHHHHHHH--HHHHHCCCCCEECCCCC T ss_conf 95699999999--99997476715768999 No 60 >TIGR00495 crvDNA_42K DNA-binding protein, 42 kDa; InterPro: IPR004545 Proteins of this family have been identified in a number of species as a nuclear (but not nucleolar) protein with a cell cycle dependence. Various names given to members of this family have included cell cycle protein p38-2G4, DNA-binding protein GBP16, and proliferation-associated protein 1. The proteins are closely related to methionine aminopeptidase, a cobalt-binding protein. This group sequences are classified as non-peptidase homologues in MEROPS peptidase family M24 (clan MG). . Probab=37.28 E-value=23 Score=16.18 Aligned_cols=16 Identities=31% Similarity=0.353 Sum_probs=13.7 Q ss_pred EEECCCCCEEEEEEEC Q ss_conf 9982899879999954 Q gi|254781045|r 127 ELKNKSGQTIIVFYKT 142 (162) Q Consensus 127 ~L~D~sG~~v~~l~~s 142 (162) +|+|+.|..|+.|+.+ T Consensus 317 VLydk~G~~Vaqfk~T 332 (407) T TIGR00495 317 VLYDKDGEFVAQFKFT 332 (407) T ss_pred CCCCCCCCEEEEEEEE T ss_conf 3122799889988878 No 61 >PRK02463 OxaA-like protein precursor; Provisional Probab=36.39 E-value=31 Score=15.44 Aligned_cols=22 Identities=27% Similarity=0.449 Sum_probs=13.6 Q ss_pred HHHHHHHH-HHHHHHHCCCEEEC Q ss_conf 02369999-99999840541203 Q gi|254781045|r 4 YRFILLNL-YMLTLFSHGCTQID 25 (162) Q Consensus 4 ~~~~~~~l-~~~~l~laGCq~~~ 25 (162) -|+.++++ ..++++|+||.+++ T Consensus 6 k~~~~~~~~~~~~l~LsgC~~~~ 28 (307) T PRK02463 6 KRILFSGLALSMLLTLTGCVGRD 28 (307) T ss_pred HHHHHHHHHHHHHHHHHCCCCCC T ss_conf 99999999999999996346899 No 62 >pfam05643 DUF799 Putative bacterial lipoprotein (DUF799). This family consists of several bacterial proteins of unknown function. Some of the family members are described as putative lipoproteins. Probab=36.38 E-value=22 Score=16.39 Aligned_cols=19 Identities=16% Similarity=0.363 Sum_probs=16.6 Q ss_pred CCEEEEEEECCCCCCCCCC Q ss_conf 9736889713667777145 Q gi|254781045|r 85 DVDCKMILTLTRFKKNFRG 103 (162) Q Consensus 85 g~sC~v~Lt~t~~~~Gyra 103 (162) |..+.++++-++|+..|.- T Consensus 105 GADAvLYvtI~~ygt~Y~V 123 (215) T pfam05643 105 GNDAVLYITVTEYGTSYQI 123 (215) T ss_pred CCCEEEEEEEECCCCEEEE T ss_conf 8776899871024737999 No 63 >pfam01298 Lipoprotein_5 Transferrin binding protein-like solute binding protein. This family of proteins are distantly related to other families of solute binding proteins. Probab=36.28 E-value=33 Score=15.26 Aligned_cols=28 Identities=18% Similarity=0.136 Sum_probs=15.8 Q ss_pred CCCH-HHHHHHHHHHHHHHCCCEEECCCCCC Q ss_conf 9200-23699999999984054120378877 Q gi|254781045|r 1 MHFY-RFILLNLYMLTLFSHGCTQIDFGNIF 30 (162) Q Consensus 1 m~f~-~~~~~~l~~~~l~laGCq~~~~~~~~ 30 (162) ||+- +...+.| .+++|.-|.---.++++ T Consensus 1 M~~~l~~~~lal--~~~LLSAC~GGGGGSfd 29 (589) T pfam01298 1 MNIPLNKLALAL--AAGLLSACSGGGGGSFD 29 (589) T ss_pred CCCCCCHHHHHH--HHHHHHHHCCCCCCCCC T ss_conf 965654549999--99999973468898887 No 64 >pfam09347 DUF1989 Domain of unknown function (DUF1989). This family of proteins are functionally uncharacterized. Probab=36.15 E-value=33 Score=15.25 Aligned_cols=12 Identities=8% Similarity=0.324 Sum_probs=4.2 Q ss_pred ECCCCCEEEEEE Q ss_conf 828998799999 Q gi|254781045|r 129 KNKSGQTIIVFY 140 (162) Q Consensus 129 ~D~sG~~v~~l~ 140 (162) +...|++++.+. T Consensus 66 ~S~~~rpm~tIv 77 (167) T pfam09347 66 YSNMGRPMLTIV 77 (167) T ss_pred ECCCCCEEEEEE T ss_conf 818997689998 No 65 >TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL. Members of this protein family are YfgL, a lipoprotein component of a complex that acts protein insertion into the bacterial outer membrane. Other members of this complex are NlpB, YfiO, and YaeT. This protein contains multiple copies of a repeat that, in other contexts, are associated with binding of the coenzyme PQQ. Probab=35.49 E-value=34 Score=15.18 Aligned_cols=25 Identities=16% Similarity=0.175 Sum_probs=14.8 Q ss_pred HHHHHHHHHHHCCCEEECCCCCCCCC Q ss_conf 99999999984054120378877787 Q gi|254781045|r 8 LLNLYMLTLFSHGCTQIDFGNIFFKK 33 (162) Q Consensus 8 ~~~l~~~~l~laGCq~~~~~~~~~~p 33 (162) ++.+ +++++|+||+....+.+-++| T Consensus 4 ~~~~-~~~~~l~gCs~~~~~~~~~~p 28 (377) T TIGR03300 4 ALVI-ALAALLSGCSWFSSKDEEPQP 28 (377) T ss_pred HHHH-HHHHHHHHCCCCCCCCCCCCC T ss_conf 8999-999998556576799887899 No 66 >pfam02402 Lysis_col Lysis protein. These small bacterial proteins are required for colicin release and partial cell lysis. This family contains lysis proteins for several different forms of colicin. Bacillus subtilis lytA has been included in this family, the similarity is not highly significant, however it is also a short protein, that is involved in secretion of other proteins (Bateman A pers. obs.). Probab=35.09 E-value=14 Score=17.53 Aligned_cols=17 Identities=18% Similarity=0.655 Sum_probs=10.7 Q ss_pred HHHHHHHHHHHHCCCEE Q ss_conf 69999999998405412 Q gi|254781045|r 7 ILLNLYMLTLFSHGCTQ 23 (162) Q Consensus 7 ~~~~l~~~~l~laGCq~ 23 (162) .+..+.+++++|++||- T Consensus 5 ~~~~i~~~~~~L~aCQa 21 (46) T pfam02402 5 LFIGILLLTVLLSACQA 21 (46) T ss_pred EEHHHHHHHHHHHHHHH T ss_conf 01399999999998555 No 67 >COG0386 BtuE Glutathione peroxidase [Posttranslational modification, protein turnover, chaperones] Probab=34.76 E-value=30 Score=15.45 Aligned_cols=25 Identities=24% Similarity=0.526 Sum_probs=19.0 Q ss_pred CCCCEEECCCCEEEEECCCCCEEEEEEEC Q ss_conf 02100333871899982899879999954 Q gi|254781045|r 114 SLAAWNIIDEDSFELKNKSGQTIIVFYKT 142 (162) Q Consensus 114 ~i~aW~v~G~~vl~L~D~sG~~v~~l~~s 142 (162) .---|++.- . |.|+.|++|.||-+. T Consensus 122 ~~IkWNFtK---F-Lvdr~G~VV~Rf~p~ 146 (162) T COG0386 122 KDIKWNFTK---F-LVDRDGNVVKRFSPK 146 (162) T ss_pred CCCCEEEEE---E-EECCCCCEEEEECCC T ss_conf 764301378---8-786999689850899 No 68 >PRK11251 DNA-binding transcriptional activator OsmE; Provisional Probab=34.57 E-value=26 Score=15.83 Aligned_cols=23 Identities=22% Similarity=0.303 Sum_probs=14.6 Q ss_pred HHHHHHHHHHHHCCCEEECCCCC Q ss_conf 69999999998405412037887 Q gi|254781045|r 7 ILLNLYMLTLFSHGCTQIDFGNI 29 (162) Q Consensus 7 ~~~~l~~~~l~laGCq~~~~~~~ 29 (162) .+|+.+.....|+||..++-..+ T Consensus 4 ~~l~aaa~~~~LaGCt~~d~~~~ 26 (109) T PRK11251 4 GILSAAAVLTMLAGCTAYDRNPV 26 (109) T ss_pred HHHHHHHHHHHHHHCCCCCCCHH T ss_conf 58899999999971447767813 No 69 >PRK10525 cytochrome o ubiquinol oxidase subunit II; Provisional Probab=34.53 E-value=35 Score=15.09 Aligned_cols=24 Identities=21% Similarity=0.318 Sum_probs=16.8 Q ss_pred HHHHHHHHHHHHHCCCEEECCCCC Q ss_conf 369999999998405412037887 Q gi|254781045|r 6 FILLNLYMLTLFSHGCTQIDFGNI 29 (162) Q Consensus 6 ~~~~~l~~~~l~laGCq~~~~~~~ 29 (162) +.+|.|...+++|+||.-.-+++. T Consensus 10 ~~~l~l~~~~~lLsGC~~~~LdPk 33 (305) T PRK10525 10 LGWLSLFAGTVLLSGCNSALLDPK 33 (305) T ss_pred HHHHHHHHHHHHHCCCCCCCCCCC T ss_conf 999999999998667876328999 No 70 >pfam03534 SpvB Salmonella virulence plasmid 65kDa B protein. Probab=34.04 E-value=36 Score=15.04 Aligned_cols=56 Identities=18% Similarity=0.376 Sum_probs=38.3 Q ss_pred EEEECCCCCEEEEEEECCCCCCCCCCCCC-CCCCCHHCCCCEEECCCCEEEEECCCCCEEEEEEECCCCC Q ss_conf 78863689736889713667777145436-7730000021003338718999828998799999548973 Q gi|254781045|r 78 AWKVSYRDVDCKMILTLTRFKKNFRGTAR-SCHGRLASLAAWNIIDEDSFELKNKSGQTIIVFYKTAEQS 146 (162) Q Consensus 78 ~W~vs~~g~sC~v~Lt~t~~~~Gyra~~~-gC~g~L~~i~aW~v~G~~vl~L~D~sG~~v~~l~~s~~gr 146 (162) -|.+-+.++.+-++ |..+.+| .=|.+-..|..|.+- +.+ |..|+.|-=.|+.|+.. T Consensus 133 fW~v~s~dg~~~~~--------Gk~~~aRIadP~~p~rI~~WLLe--es~---d~~Gn~I~Y~Y~~ED~~ 189 (293) T pfam03534 133 FWLIHSADGQLHLL--------GKTAQARIADPQNPTRIAEWLLE--ESV---SPTGEHIYYQYRAEDDT 189 (293) T ss_pred EEEEECCCCCEEEC--------CCCHHHCCCCCCCCCHHHEEEEE--EEE---CCCCCEEEEEECCCCCC T ss_conf 58998689977977--------68866515698984532146243--378---79999899987066556 No 71 >PRK10718 hypothetical protein; Provisional Probab=33.83 E-value=19 Score=16.66 Aligned_cols=30 Identities=27% Similarity=0.350 Sum_probs=16.3 Q ss_pred CCHHHHHHHHHHHHHHHCCCEEECCCC-CCCCCC Q ss_conf 200236999999999840541203788-777876 Q gi|254781045|r 2 HFYRFILLNLYMLTLFSHGCTQIDFGN-IFFKKP 34 (162) Q Consensus 2 ~f~~~~~~~l~~~~l~laGCq~~~~~~-~~~~p~ 34 (162) .-.|+.++ ...|+|+||++.+.=+ +...|. T Consensus 2 ~~lr~~l~---~~~llLsGCst~s~~sWSsl~P~ 32 (191) T PRK10718 2 KSLRLLLL---ALPLLLTGCSTMSSVNWSAANPW 32 (191) T ss_pred CCCCCHHH---HHHHHHHCCCCCCCCCCCCCCCC T ss_conf 85310231---22476406566688642236861 No 72 >TIGR00977 LeuA_rel 2-isopropylmalate synthase/homocitrate synthase family protein; InterPro: IPR005675 This model represents largely uncharacterised proteins related to 2-isopropylmalate synthases and homocitrate synthases but phylogenetically distinct. ; GO: 0046912 transferase activity transferring acyl groups acyl groups converted into alkyl on transfer, 0019752 carboxylic acid metabolic process. Probab=33.35 E-value=17 Score=17.05 Aligned_cols=45 Identities=18% Similarity=0.282 Sum_probs=31.3 Q ss_pred EEEEECCCCCCCCCCCCCCCCCCHHCCCCEEECCCCEEEEECCCCCEE Q ss_conf 889713667777145436773000002100333871899982899879 Q gi|254781045|r 89 KMILTLTRFKKNFRGTARSCHGRLASLAAWNIIDEDSFELKNKSGQTI 136 (162) Q Consensus 89 ~v~Lt~t~~~~Gyra~~~gC~g~L~~i~aW~v~G~~vl~L~D~sG~~v 136 (162) +|.---+-|.+||||+++= .|.-...=.-.|-|-|+|-|.+|++. T Consensus 137 ~VIyDAEHfFDGYkaN~eY---AL~~L~~A~~aGAdwlVlcDTNGGTL 181 (543) T TIGR00977 137 EVIYDAEHFFDGYKANPEY---ALKTLKVAEKAGADWLVLCDTNGGTL 181 (543) T ss_pred EEEEECCCCCCCCCCCHHH---HHHHHHHHHHCCCCEEEEEECCCCCC T ss_conf 2563020024634578689---99999999846982899950787998 No 73 >PRK09810 entericidin A; Provisional Probab=33.13 E-value=31 Score=15.42 Aligned_cols=22 Identities=27% Similarity=0.454 Sum_probs=15.3 Q ss_pred HHHHHHHHHHHHHHHCCCEEECC Q ss_conf 02369999999998405412037 Q gi|254781045|r 4 YRFILLNLYMLTLFSHGCTQIDF 26 (162) Q Consensus 4 ~~~~~~~l~~~~l~laGCq~~~~ 26 (162) -|.+++.| +...+|+||.+-+. T Consensus 3 krli~lil-~~~~ll~gcntarg 24 (41) T PRK09810 3 KRLIVLVL-LASTLLTGCNTARG 24 (41) T ss_pred HHHHHHHH-HHHHHHHCCCCCCC T ss_conf 89999999-99999825621221 No 74 >TIGR03424 urea_degr_1 urea carboxylase-associated protein 1. A number of bacteria degrade urea as a nitrogen source by the urea carboxylase/allophanate hydrolase pathway, which uses biotin and consumes ATP, rather than my means of the nickel-dependent enzyme urease. This model represents one of a pair of homologous, tandem uncharacterized genes found together with the urea carboxylase and allophanate hydrolase genes. Probab=32.91 E-value=37 Score=14.92 Aligned_cols=14 Identities=21% Similarity=0.705 Sum_probs=5.1 Q ss_pred CCCCC-HHCCCCEEE Q ss_conf 77300-000210033 Q gi|254781045|r 107 SCHGR-LASLAAWNI 120 (162) Q Consensus 107 gC~g~-L~~i~aW~v 120 (162) +|..- +.+++.|.+ T Consensus 113 nC~dNl~~al~~~Gl 127 (198) T TIGR03424 113 ACRDNFLLAIAKYGL 127 (198) T ss_pred CHHHHHHHHHHHHCC T ss_conf 528999999988099 No 75 >pfam06572 DUF1131 Protein of unknown function (DUF1131). This family consists of several hypothetical bacterial proteins of unknown function. Probab=32.60 E-value=27 Score=15.78 Aligned_cols=24 Identities=21% Similarity=0.257 Sum_probs=14.0 Q ss_pred HHHHHHHHCCCEEECCCC-CCCCCC Q ss_conf 999999840541203788-777876 Q gi|254781045|r 11 LYMLTLFSHGCTQIDFGN-IFFKKP 34 (162) Q Consensus 11 l~~~~l~laGCq~~~~~~-~~~~p~ 34 (162) |..+.|+|+||++.+.=+ ++..|. T Consensus 8 l~~~~llL~GCst~s~fsWSslsP~ 32 (192) T pfam06572 8 LLALPLLLTGCSTLSNFSWSSLSPW 32 (192) T ss_pred HHHHHHHHHCCCCCCCCCCCCCCCC T ss_conf 8776688606556688542226872 No 76 >KOG0175 consensus Probab=32.19 E-value=35 Score=15.05 Aligned_cols=33 Identities=12% Similarity=0.277 Sum_probs=24.0 Q ss_pred HCCCCEEECCCCEEEEECCCC-CEEEEEEECCCCC Q ss_conf 002100333871899982899-8799999548973 Q gi|254781045|r 113 ASLAAWNIIDEDSFELKNKSG-QTIIVFYKTAEQS 146 (162) Q Consensus 113 ~~i~aW~v~G~~vl~L~D~sG-~~v~~l~~s~~gr 146 (162) .+|.+||-+|-.++ +.|..| +.-+++.++++|. T Consensus 170 tMi~G~Dk~GP~ly-YVDseG~Rl~G~~FSVGSGs 203 (285) T KOG0175 170 TMIAGWDKKGPGLY-YVDSEGTRLSGDLFSVGSGS 203 (285) T ss_pred EEEEECCCCCCCEE-EECCCCCCCCCCEEEECCCC T ss_conf 15762068898169-98588987047667506898 No 77 >COG4238 Murein lipoprotein [Cell envelope biogenesis, outer membrane] Probab=32.10 E-value=29 Score=15.55 Aligned_cols=19 Identities=21% Similarity=0.466 Sum_probs=15.9 Q ss_pred HHHHHHHHHHHHHHCCCEE Q ss_conf 2369999999998405412 Q gi|254781045|r 5 RFILLNLYMLTLFSHGCTQ 23 (162) Q Consensus 5 ~~~~~~l~~~~l~laGCq~ 23 (162) ++.+..+++..+.|+||.. T Consensus 5 ~m~l~Avvlg~lllAGc~s 23 (78) T COG4238 5 KMTLGAVVLGSLLLAGCSS 23 (78) T ss_pred EHHHHHHHHHHHHHHHCCC T ss_conf 0127899987799970110 No 78 >TIGR02544 III_secr_YscJ type III secretion apparatus lipoprotein, YscJ/HrcJ family; InterPro: IPR003282 Secretion of virulence factors in Gram-negative bacteria involves transportation of the protein across two membranes to reach the cell exterior. There have been four secretion systems described in animal enteropathogens such as Salmonella and Yersinia, with further sequence similarities in plant pathogens like Ralstonia and Erwinia. The type III secretion system is of great interest as it is used to transport virulence factors from the pathogen directly into the host cell and is only triggered when the bacterium comes into close contact with the host. The protein subunits of the system are very similar to those of bacterial flagellar biosynthesis . However, while the latter forms a ring structure to allow secretion of flagellin and is an integral part of the flagellum itself, type III subunits in the outer membrane translocate secreted proteins through a channel-like structure. One of the outer membrane protein subunit families, termed "K" here for nomenclature purposes, aids in the structural assembly of the invasion complex . It is also described as a lipoprotein. Members of this family include the Salmonella PrgK and SsaJ genes, MxiJ from Shigella, YscJ from Yersinia, and from the plant enteropathogens NolT (Rhizobium) and HrcJ Erwinia). The flagellar M-ring protein FliF also shares a low level of similarity, presumably due to evolution of the type III secretion system from the flagellar biosynthetic pathway.; GO: 0009306 protein secretion. Probab=32.05 E-value=30 Score=15.52 Aligned_cols=21 Identities=24% Similarity=0.396 Sum_probs=14.2 Q ss_pred HHHHHHHHHCCCEEEC--CCCCC Q ss_conf 9999999840541203--78877 Q gi|254781045|r 10 NLYMLTLFSHGCTQID--FGNIF 30 (162) Q Consensus 10 ~l~~~~l~laGCq~~~--~~~~~ 30 (162) -+++++++|+||.... |.+.+ T Consensus 6 ~~~~l~llL~GC~~~~~Ly~gL~ 28 (203) T TIGR02544 6 LLLLLLLLLTGCKVDLELYSGLS 28 (203) T ss_pred HHHHHHHHHHCCCCEEEEECCCC T ss_conf 99999999717874056504789 No 79 >pfam08085 Entericidin Entericidin EcnA/B family. This family consists of the entericidin antidote/toxin peptides. The entericidin locus is activated in stationary phase under high osmolarity conditions by rho-S and simultaneously repressed by the osmoregulatory EnvZ/OmpR signal transduction pathway. The entericidin locus encodes tandem paralogous genes (ecnAB) and directs the synthesis of two small cell-envelope lipoproteins which can maintain plasmids in bacterial population by means of post-segregational killing. Probab=31.97 E-value=32 Score=15.34 Aligned_cols=22 Identities=32% Similarity=0.609 Sum_probs=12.9 Q ss_pred HHHHHHHHHHHHCCCEEECCCC Q ss_conf 6999999999840541203788 Q gi|254781045|r 7 ILLNLYMLTLFSHGCTQIDFGN 28 (162) Q Consensus 7 ~~~~l~~~~l~laGCq~~~~~~ 28 (162) .++.+.+..+.|+||-|.+.=+ T Consensus 7 ~~~~l~~~~~~lagCNTv~G~G 28 (42) T pfam08085 7 LLLALLLLALVLAGCNTVAGAG 28 (42) T ss_pred HHHHHHHHHHHHHCCHHHHHCC T ss_conf 9999999999986122211121 No 80 >KOG0263 consensus Probab=30.83 E-value=40 Score=14.71 Aligned_cols=47 Identities=9% Similarity=0.140 Sum_probs=38.6 Q ss_pred HCCCCEEECCCCEEEEECCCCCEEEEEEECCCCCEECCCCCCCCEEEE Q ss_conf 002100333871899982899879999954897322011378961887 Q gi|254781045|r 113 ASLAAWNIIDEDSFELKNKSGQTIIVFYKTAEQSFEGSFQGESDKVII 160 (162) Q Consensus 113 ~~i~aW~v~G~~vl~L~D~sG~~v~~l~~s~~grfeG~t~~~G~pisL 160 (162) .-|.-||+.-.++||+...--.+|.++.-+..|||.+.-.+ ..-|-| T Consensus 557 ~tVRlWDv~~G~~VRiF~GH~~~V~al~~Sp~Gr~LaSg~e-d~~I~i 603 (707) T KOG0263 557 RTVRLWDVSTGNSVRIFTGHKGPVTALAFSPCGRYLASGDE-DGLIKI 603 (707) T ss_pred CEEEEEECCCCCEEEEECCCCCCEEEEEECCCCCEEEECCC-CCCEEE T ss_conf 32898873778579976278886689997578756741465-784899 No 81 >COG4380 Uncharacterized protein conserved in bacteria [Function unknown] Probab=30.41 E-value=31 Score=15.38 Aligned_cols=20 Identities=20% Similarity=0.315 Sum_probs=14.8 Q ss_pred HHHHHHHHHHHHHHHCCCEEE Q ss_conf 023699999999984054120 Q gi|254781045|r 4 YRFILLNLYMLTLFSHGCTQI 24 (162) Q Consensus 4 ~~~~~~~l~~~~l~laGCq~~ 24 (162) +++.++.+ ..+++++|||.. T Consensus 1 ~~~l~~~~-~~vl~ls~c~~~ 20 (216) T COG4380 1 MKPLILGL-AAVLALSACQVQ 20 (216) T ss_pred CHHHHHHH-HHHHHHHHCCCC T ss_conf 90689999-999998653577 No 82 >COG4594 FecB ABC-type Fe3+-citrate transport system, periplasmic component [Inorganic ion transport and metabolism] Probab=30.35 E-value=39 Score=14.77 Aligned_cols=23 Identities=30% Similarity=0.544 Sum_probs=14.7 Q ss_pred HHHHHHHHHHHHCCCEEECCCCC Q ss_conf 69999999998405412037887 Q gi|254781045|r 7 ILLNLYMLTLFSHGCTQIDFGNI 29 (162) Q Consensus 7 ~~~~l~~~~l~laGCq~~~~~~~ 29 (162) +++.|.++.|+++||++++-+.+ T Consensus 8 ~i~~lll~lllva~C~~s~~~~~ 30 (310) T COG4594 8 IILTLLLLLLLVAACSSSDNNQK 30 (310) T ss_pred HHHHHHHHHHHHHHHCCCCCCCC T ss_conf 99999999999977147676555 No 83 >TIGR01433 CyoA ubiquinol oxidase, subunit II; InterPro: IPR006333 Members of this domain catalyze the oxidation of ubiquinol with the concomitant reduction of molecular oxygen to water. This acts as the terminal electron acceptor in the respiratory chain. Subunit II is responsible for binding and oxidation of the ubiquinone substrate. This sequence is closely related to QoxA, which oxidizes quinol in Gram-positive bacteria but which is in complex with subunits which utilise cytochrome a in the reduction of molecular oxygen. Slightly more distantly related is subunit II of cytochrome c oxidase which uses cytochrome c as the oxidant . ; GO: 0016682 oxidoreductase activity acting on diphenols and related substances as donors oxygen as acceptor, 0006118 electron transport, 0016020 membrane. Probab=30.15 E-value=23 Score=16.25 Aligned_cols=20 Identities=25% Similarity=0.539 Sum_probs=12.9 Q ss_pred HHHHHHHHHHCCCE-EECCCC Q ss_conf 99999999840541-203788 Q gi|254781045|r 9 LNLYMLTLFSHGCT-QIDFGN 28 (162) Q Consensus 9 ~~l~~~~l~laGCq-~~~~~~ 28 (162) |.++.+.++|.||+ .-=+++ T Consensus 1 L~~~~~~~lLsGCNn~~LL~P 21 (228) T TIGR01433 1 LSLILASLLLSGCNNLVLLDP 21 (228) T ss_pred CHHHHHHHHHHCCCCCCCCCC T ss_conf 857789998612567655388 No 84 >PRK10053 hypothetical protein; Provisional Probab=30.14 E-value=41 Score=14.64 Aligned_cols=38 Identities=18% Similarity=0.407 Sum_probs=29.9 Q ss_pred CCCCEEEEECCCCCEEEEEEECCCCCEECCCCCCCCEEEEE Q ss_conf 38718999828998799999548973220113789618873 Q gi|254781045|r 121 IDEDSFELKNKSGQTIIVFYKTAEQSFEGSFQGESDKVIIS 161 (162) Q Consensus 121 ~G~~vl~L~D~sG~~v~~l~~s~~grfeG~t~~~G~pisLs 161 (162) .|+|.+.|+|.+|...... ...+|.|++-.-...|.|. T Consensus 74 lg~d~Y~FrD~TG~I~VeI---d~~~W~G~~VtP~d~V~I~ 111 (130) T PRK10053 74 KGDDRYVFRDKSGEINVII---PAAVFDGREVQPDQMININ 111 (130) T ss_pred CCCCEEEEECCCCCEEEEE---CHHHCCCCCCCCCCEEEEE T ss_conf 4883489977997599996---7777489785999878998 No 85 >TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW; InterPro: IPR013360 Proteins in this entry are designated PilF and PilW . This outer membrane protein is required both for pilus stability and for pilus functions such as adherence to human cells. Members of this family contain copies of the TPR (tetratricopeptide repeat) domain.. Probab=29.52 E-value=23 Score=16.25 Aligned_cols=15 Identities=27% Similarity=0.428 Sum_probs=10.8 Q ss_pred HHHHHHHHCCCEEEC Q ss_conf 999999840541203 Q gi|254781045|r 11 LYMLTLFSHGCTQID 25 (162) Q Consensus 11 l~~~~l~laGCq~~~ 25 (162) +++++++|+||++.. T Consensus 2 ~l~~~~~l~GC~~~~ 16 (247) T TIGR02521 2 ALVLLLALTGCVTTP 16 (247) T ss_pred HHHHHHHHHCCCCCC T ss_conf 887846785157887 No 86 >COG4259 Uncharacterized protein conserved in bacteria [Function unknown] Probab=29.44 E-value=37 Score=14.97 Aligned_cols=20 Identities=20% Similarity=0.245 Sum_probs=14.0 Q ss_pred HHHHHHHHHHHHHHHCCCEE Q ss_conf 02369999999998405412 Q gi|254781045|r 4 YRFILLNLYMLTLFSHGCTQ 23 (162) Q Consensus 4 ~~~~~~~l~~~~l~laGCq~ 23 (162) .+.+-+.|.+.+++|+||.. T Consensus 5 ktlsr~al~~av~~LagC~~ 24 (121) T COG4259 5 KTLSRLALLLAVAALAGCGG 24 (121) T ss_pred HHHHHHHHHHHHHHHHHCCC T ss_conf 88999999999999988057 No 87 >TIGR01840 esterase_phb esterase, PHB depolymerase family; InterPro: IPR010126 This entry describes a group of lipases of the ab-hydrolase family. They include bacterial depolymerases for poly(3-hydroxybutyrate) (PHB) and related polyhydroxyalkanoates (PHA), as well as acetyl xylan esterases, and feruloyl esterases from fungi.; GO: 0005576 extracellular region. Probab=28.97 E-value=8.5 Score=18.87 Aligned_cols=12 Identities=50% Similarity=0.778 Sum_probs=8.3 Q ss_pred HHHHHHCCCEEE Q ss_conf 999984054120 Q gi|254781045|r 13 MLTLFSHGCTQI 24 (162) Q Consensus 13 ~~~l~laGCq~~ 24 (162) -|+|+||||.+| T Consensus 19 aLV~~LHGC~QT 30 (231) T TIGR01840 19 ALVLALHGCGQT 30 (231) T ss_pred CEEEEECCCCCC T ss_conf 347762277411 No 88 >COG3133 SlyB Outer membrane lipoprotein [Cell envelope biogenesis, outer membrane] Probab=28.92 E-value=32 Score=15.29 Aligned_cols=31 Identities=29% Similarity=0.508 Sum_probs=23.0 Q ss_pred ECCCCEEEEECCCCCEEEEEEECCCCCEE-CCC Q ss_conf 33871899982899879999954897322-011 Q gi|254781045|r 120 IIDEDSFELKNKSGQTIIVFYKTAEQSFE-GSF 151 (162) Q Consensus 120 v~G~~vl~L~D~sG~~v~~l~~s~~grfe-G~t 151 (162) +.|.+ |..+--+|+.+...++....+|- |++ T Consensus 109 ~~Gve-l~IrkDdG~~i~vvQk~d~~~~~vGeR 140 (154) T COG3133 109 TQGVE-LEIRKDDGQTIVVVQKQDQTRFSVGER 140 (154) T ss_pred CCCEE-EEEEECCCCEEEEEEECCCCCCCCCCE T ss_conf 78648-999945994899998328731477648 No 89 >pfam12079 DUF3558 Protein of unknown function (DUF3558). This family of proteins is functionally uncharacterized. This protein is found in bacteria. Proteins in this family are typically between 177 to 195 amino acids in length. Probab=28.88 E-value=27 Score=15.78 Aligned_cols=114 Identities=11% Similarity=0.050 Sum_probs=49.0 Q ss_pred HHHCCCEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCC--CC-CCCCCCCCHHEEEEEEECCCCCEEEEE Q ss_conf 984054120378877787666888743457358998887-78865446--67-632237701136578863689736889 Q gi|254781045|r 16 LFSHGCTQIDFGNIFFKKPEISLPPSVESEILLPPIPEE-EFDQDDIS--VP-SKDNNAIRMGIIGAWKVSYRDVDCKMI 91 (162) Q Consensus 16 l~laGCq~~~~~~~~~~p~~a~p~~~V~s~~l~pp~~~~-~~~~~~~~--~p-~~a~~~~r~sl~G~W~vs~~g~sC~v~ 91 (162) +.|+||.++.-+.-.+....+.|.++=+..+.+|-+.+= ..+.+.+. .. .......+....=.|.....-.-=.|. T Consensus 2 ~~laGCg~~~~G~a~~~~~~~~~~~~~~~~~~~p~f~~C~~ltd~~l~~~~g~~~~~~~~~~g~gC~W~~~~~~~g~~vs 81 (168) T pfam12079 2 VVLAGCGSTVSGTASPTGSAAAPDPSDSAAQFGPFFDPCGGITDDTLAELTGVDPLVPVSFSGAGCSWDAAGAIGGPDVS 81 (168) T ss_pred EEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCCCCCCEEEEECCCCCCCCEEE T ss_conf 58841578768972777778888885433458754555579887999998487765333131836788358986663189 Q ss_pred EECCCCCCCCCCCCCCCCCCH--HCCCCEEECCCCEEEEECCC Q ss_conf 713667777145436773000--00210033387189998289 Q gi|254781045|r 92 LTLTRFKKNFRGTARSCHGRL--ASLAAWNIIDEDSFELKNKS 132 (162) Q Consensus 92 Lt~t~~~~Gyra~~~gC~g~L--~~i~aW~v~G~~vl~L~D~s 132 (162) + .|..|.....+.=..++ ..+.-.++.|-+-++-++.. T Consensus 82 ~---~w~~g~~~~~ER~~~~~~~~~v~~i~I~G~~gf~a~~~~ 121 (168) T pfam12079 82 F---SWYRGSTVDRERELAELAGYEVTDIEIGGRPGFVARDEG 121 (168) T ss_pred E---EEECCCCCHHHHHHHHHCCCCCEEEEECCCCCEEEECCC T ss_conf 8---873478606677788761784103687483354885699 No 90 >pfam04076 BOF Bacterial OB fold (BOF) protein. Proteins in this family form an OB-fold. Analysis of the predicted binding site of BOF family proteins implies that they lack nucleic acid-binding properties. They contain an predicted N-terminal signal peptide which indicates that they localize in the periplasm where they may function to bind proteins, small molecules, or other typical OB-fold ligands. As hypothesized for the distantly related OB-fold containing bacterial enterotoxins, the loss of nucleotide-binding function and the rapid evolution of the BOF ligand-binding site may be associated with the presence of BOF proteins in mobile genetic elements and their potential role in bacterial pathogenicity. Probab=28.36 E-value=44 Score=14.45 Aligned_cols=37 Identities=24% Similarity=0.458 Sum_probs=28.3 Q ss_pred CCCEEEEECCCCCEEEEEEECCCCCEECCCCCCCCEEEEE Q ss_conf 8718999828998799999548973220113789618873 Q gi|254781045|r 122 DEDSFELKNKSGQTIIVFYKTAEQSFEGSFQGESDKVIIS 161 (162) Q Consensus 122 G~~vl~L~D~sG~~v~~l~~s~~grfeG~t~~~G~pisLs 161 (162) |+|-++|.|.+|+.... -.+.+|.|+.-.....|.|. T Consensus 71 ~~d~Y~F~D~TG~I~Ve---Id~~~w~G~~v~p~~kVrI~ 107 (126) T pfam04076 71 GDDEYEFRDASGTIKVD---IDDRVWNGQEVQPKDKVKIT 107 (126) T ss_pred CCCEEEEECCCCCEEEE---ECHHHCCCCCCCCCCEEEEE T ss_conf 89538997899639999---68888389817999989999 No 91 >COG3521 Predicted component of the type VI protein secretion system [Intracellular trafficking, secretion, and vesicular transport] Probab=27.43 E-value=43 Score=14.56 Aligned_cols=22 Identities=32% Similarity=0.480 Sum_probs=12.7 Q ss_pred CCCHHHHHHHHHHHHHHHCCCEE Q ss_conf 92002369999999998405412 Q gi|254781045|r 1 MHFYRFILLNLYMLTLFSHGCTQ 23 (162) Q Consensus 1 m~f~~~~~~~l~~~~l~laGCq~ 23 (162) |+-++..++-+ ++.+.++||++ T Consensus 1 M~~~~~a~~~l-~al~~~sgCss 22 (159) T COG3521 1 MNSSRKAVLAL-FALLVLSGCSS 22 (159) T ss_pred CCHHHHHHHHH-HHHHHHHHHCC T ss_conf 94257789999-99998524125 No 92 >TIGR02898 spore_YhcN_YlaJ sporulation lipoprotein, YhcN/YlaJ family; InterPro: IPR014247 This entry contains YhcN and YlaJ, which are predicted lipoproteins that have been detected as spore proteins but not vegetative proteins in Bacillus subtilis. Both appear to be expressed under control of the RNA polymerase sigma-G factor. The YlaJ-like members of this family have a low-complexity, strongly acidic, 40-residue C-terminal domain. . Probab=26.74 E-value=38 Score=14.87 Aligned_cols=21 Identities=29% Similarity=0.524 Sum_probs=12.2 Q ss_pred HHHHHHHHHHH--CCCEEECCCC Q ss_conf 99999999984--0541203788 Q gi|254781045|r 8 LLNLYMLTLFS--HGCTQIDFGN 28 (162) Q Consensus 8 ~~~l~~~~l~l--aGCq~~~~~~ 28 (162) |+.+.++.|+| .||+--+-++ T Consensus 2 l~~~ll~~~~l~~tgC~~~~~~~ 24 (185) T TIGR02898 2 LFIILLLLLLLLATGCTNAQKKS 24 (185) T ss_pred HHHHHHHHHHHHHHCCCCCCCCC T ss_conf 68899999999873134100146 No 93 >PRK10957 iron-enterobactin transporter periplasmic binding protein; Provisional Probab=26.16 E-value=49 Score=14.21 Aligned_cols=21 Identities=24% Similarity=0.290 Sum_probs=14.8 Q ss_pred HHHHHHHHHHHHHHHCCCEEE Q ss_conf 023699999999984054120 Q gi|254781045|r 4 YRFILLNLYMLTLFSHGCTQI 24 (162) Q Consensus 4 ~~~~~~~l~~~~l~laGCq~~ 24 (162) -+.-.|.|.+++++++||+.. T Consensus 4 ~~~~~~~~~~~~~~~~g~~~~ 24 (319) T PRK10957 4 APLYRLALLLLGLLLSGIAAA 24 (319) T ss_pred HHHHHHHHHHHHHHHCCCCCC T ss_conf 378999999999997478755 No 94 >TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO. Members of this protein family include YfiO, a near-essential protein of the outer membrane, part of a complex involved in protein insertion into the bacterial outer membrane. Many proteins in this family are annotated as ComL, based on the involvement of this protein in natural transformation with exogenous DNA in Neisseria gonorrhoeae. This protein family shows sequence similarity to, but is distinct from, the tol-pal system protein YbgF (TIGR02795). Probab=26.14 E-value=43 Score=14.56 Aligned_cols=17 Identities=35% Similarity=0.600 Sum_probs=10.7 Q ss_pred HHHHHHHHHHHCCCEEE Q ss_conf 99999999984054120 Q gi|254781045|r 8 LLNLYMLTLFSHGCTQI 24 (162) Q Consensus 8 ~~~l~~~~l~laGCq~~ 24 (162) ++.+..+.+++.||+.. T Consensus 4 ~~~~~~~~~~l~sCs~~ 20 (235) T TIGR03302 4 LILLLALLLLLAGCSSK 20 (235) T ss_pred HHHHHHHHHHHHHCCCC T ss_conf 99999999999873899 No 95 >TIGR03659 IsdE heme ABC transporter, heme-binding protein isdE. This family of ABC substrate-binding proteins is observed primarily in close proximity with proteins localized to the cell wall and bearing the NEAT (NEAr Transporter, pfam05031) heme-binding domain. IsdE has been shown to bind heme and is involved in the process of scavenging heme for the purpose of obtaining iron. Probab=25.71 E-value=46 Score=14.38 Aligned_cols=19 Identities=32% Similarity=0.501 Sum_probs=13.9 Q ss_pred HHHHHHHHHHHHHCCCEEE Q ss_conf 3699999999984054120 Q gi|254781045|r 6 FILLNLYMLTLFSHGCTQI 24 (162) Q Consensus 6 ~~~~~l~~~~l~laGCq~~ 24 (162) .+++.+.+++++++||... T Consensus 4 ~~~~~~~~~~~~l~~C~~~ 22 (289) T TIGR03659 4 LSLILLALLSLGLTGCSSS 22 (289) T ss_pred HHHHHHHHHHHHHHHCCCC T ss_conf 9999999999998432899 No 96 >pfam00541 Adeno_knob Adenoviral fibre protein (knob domain). Specific attachment of adenovirus is achieved through interactions between host-cell receptors and the adenovirus fibre protein and is mediated by the globular carboxy-terminal domain of the adenovirus fibre protein, termed the carboxy-terminal knob domain. Probab=25.60 E-value=50 Score=14.14 Aligned_cols=52 Identities=21% Similarity=0.240 Sum_probs=22.4 Q ss_pred CCCEEEEEEECCCCCCCCCCCC--CCCCCCHHCCCCEEECCCCEEEEECCCCCEE Q ss_conf 8973688971366777714543--6773000002100333871899982899879 Q gi|254781045|r 84 RDVDCKMILTLTRFKKNFRGTA--RSCHGRLASLAAWNIIDEDSFELKNKSGQTI 136 (162) Q Consensus 84 ~g~sC~v~Lt~t~~~~Gyra~~--~gC~g~L~~i~aW~v~G~~vl~L~D~sG~~v 136 (162) ..+.|+++|.|||-|+---|.- .+-.|.+..|..= ..--++..+.|+.|+-. T Consensus 15 ~~~D~KLtL~LTK~Gs~Vlgtvsl~~vkg~~~~i~~~-~~~~~i~L~FD~~G~L~ 68 (170) T pfam00541 15 TEKDSKLTLVLTKCGSQVLGTVSLLGVKGTLNNITNT-TNSISIKLLFDSNGVLL 68 (170) T ss_pred CCCCEEEEEEEECCCCEEEEEEEEEEECCCEEECCCC-CEEEEEEEEECCCCCCC T ss_conf 1787179999985499899999999952420541688-34799999987999792 No 97 >pfam03276 Gag_spuma Spumavirus gag protein. Probab=25.60 E-value=35 Score=15.06 Aligned_cols=38 Identities=24% Similarity=0.399 Sum_probs=33.9 Q ss_pred HHEEEEEEECCCCCEEEEEEECCCCCCCCCCCCCCCCC Q ss_conf 11365788636897368897136677771454367730 Q gi|254781045|r 73 MGIIGAWKVSYRDVDCKMILTLTRFKKNFRGTARSCHG 110 (162) Q Consensus 73 ~sl~G~W~vs~~g~sC~v~Lt~t~~~~Gyra~~~gC~g 110 (162) .++-|++-+.+.+--|+|.-.++-.--|...++.+|.. T Consensus 292 ~AieGvfP~~t~d~r~RvvNAl~~~~~Gl~L~p~ec~t 329 (582) T pfam03276 292 PAIEGVFPVTTPDLRCRVVNALTGGHPGLALTPNECGS 329 (582) T ss_pred HHHCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCHHHCC T ss_conf 33222235788017788898987278764448110035 No 98 >PRK10523 lipoprotein involved with copper homeostasis and adhesion; Provisional Probab=25.06 E-value=51 Score=14.08 Aligned_cols=44 Identities=20% Similarity=0.297 Sum_probs=23.9 Q ss_pred CHHCCCCEEECCCCEEEEECCCCCEEEEEEECCCCCEECCCCCCCCEE Q ss_conf 000021003338718999828998799999548973220113789618 Q gi|254781045|r 111 RLASLAAWNIIDEDSFELKNKSGQTIIVFYKTAEQSFEGSFQGESDKV 158 (162) Q Consensus 111 ~L~~i~aW~v~G~~vl~L~D~sG~~v~~l~~s~~grfeG~t~~~G~pi 158 (162) .++..+.|.-++ +.++|.|..|+.---+.+ ++..+=.-. +|.|| T Consensus 84 ~F~e~GrW~rta-dklvLt~s~gek~yfr~~--g~~L~mLD~-~G~pI 127 (234) T PRK10523 84 SFASYGTWARTA-DKLVLTDSKGEKSYYRAK--GDALEMLDR-EGNPI 127 (234) T ss_pred CHHHCCEEEECC-CEEEEECCCCCEEEEEEC--CCEEEEECC-CCCCC T ss_conf 332246036328-858974799874013562--880467156-89802 No 99 >COG5645 Predicted periplasmic lipoprotein [General function prediction only] Probab=24.99 E-value=37 Score=14.92 Aligned_cols=19 Identities=47% Similarity=0.840 Sum_probs=12.9 Q ss_pred HHHHHHHHHHHHHHCCCEEE Q ss_conf 23699999999984054120 Q gi|254781045|r 5 RFILLNLYMLTLFSHGCTQI 24 (162) Q Consensus 5 ~~~~~~l~~~~l~laGCq~~ 24 (162) |.+++.+++. +.+.||.+. T Consensus 2 r~i~l~l~v~-lllSGC~SV 20 (80) T COG5645 2 RNILLSLMVL-LLLSGCGSV 20 (80) T ss_pred CEEHHHHHHH-HHHCCCCEE T ss_conf 1532789999-983764103 No 100 >COG3107 LppC Putative lipoprotein [General function prediction only] Probab=24.94 E-value=51 Score=14.07 Aligned_cols=50 Identities=22% Similarity=0.321 Sum_probs=26.6 Q ss_pred CCEEEEEEECCC---------CCCCCCC----CCCCCCCC---HHCCCCEEECCCCEEEEECCCCCE Q ss_conf 973688971366---------7777145----43677300---000210033387189998289987 Q gi|254781045|r 85 DVDCKMILTLTR---------FKKNFRG----TARSCHGR---LASLAAWNIIDEDSFELKNKSGQT 135 (162) Q Consensus 85 g~sC~v~Lt~t~---------~~~Gyra----~~~gC~g~---L~~i~aW~v~G~~vl~L~D~sG~~ 135 (162) ...|-..|+-+. |.+|+|- .+++--|+ -+..-.|--.|+..| ++.+.|.+ T Consensus 358 ~~~cyfaLSPEDEa~~AA~~l~~qG~R~plvlvPr~~lG~Rv~~AF~~~Wq~~gg~~v-~~~~fg~~ 423 (604) T COG3107 358 AQLCYFALSPEDEARDAANHLWDQGKRNPLVLVPRNDLGDRVANAFNQEWQKLGGGTV-LQQKFGST 423 (604) T ss_pred CCCEEEECCHHHHHHHHHHHHHHCCCCCCEEEECCHHHHHHHHHHHHHHHHHHCCCCH-HHHHCCCH T ss_conf 5322552483377999999998706647158855047789999999999998517711-67632768 No 101 >KOG2391 consensus Probab=24.43 E-value=52 Score=14.01 Aligned_cols=38 Identities=13% Similarity=0.043 Sum_probs=18.3 Q ss_pred HHHHHHHHHHHHHHHCCCEEECCCCCCCCCCCCCCCCCCCCC Q ss_conf 023699999999984054120378877787666888743457 Q gi|254781045|r 4 YRFILLNLYMLTLFSHGCTQIDFGNIFFKKPEISLPPSVESE 45 (162) Q Consensus 4 ~~~~~~~l~~~~l~laGCq~~~~~~~~~~p~~a~p~~~V~s~ 45 (162) -.+-+++|+-.++++.+---.. +.++++..|.|.-+.+ T Consensus 120 pssdLv~Liq~l~a~f~~~pP~----ys~~~~~~p~p~p~~~ 157 (365) T KOG2391 120 PSSDLVGLIQELIAAFSEDPPV----YSRSLPSPPPPYPQTE 157 (365) T ss_pred CCCHHHHHHHHHHHHHCCCCCC----CCCCCCCCCCCCCCCC T ss_conf 5125999999999983679964----4677899999988666 No 102 >PRK13733 conjugal transfer protein TraV; Provisional Probab=24.21 E-value=32 Score=15.30 Aligned_cols=26 Identities=27% Similarity=0.373 Sum_probs=18.5 Q ss_pred HHHHHHHHHHHHHHCCCE--EECCCCCC Q ss_conf 236999999999840541--20378877 Q gi|254781045|r 5 RFILLNLYMLTLFSHGCT--QIDFGNIF 30 (162) Q Consensus 5 ~~~~~~l~~~~l~laGCq--~~~~~~~~ 30 (162) |+.||.+...+|+|.||- .++|+=+. T Consensus 3 ~~~~l~~l~~~llLtGCAG~nSdFdCna 30 (171) T PRK13733 3 KISLLIPLLGTLLLSGCAGTNSEFECNA 30 (171) T ss_pred EEEEEHHHCCEEEEECCCCCCCCCCCCC T ss_conf 1675112026002602457775454699 No 103 >PRK13616 lipoprotein LpqB; Provisional Probab=23.76 E-value=54 Score=13.93 Aligned_cols=16 Identities=25% Similarity=0.627 Sum_probs=10.9 Q ss_pred HHHHHHHHHHCCCEEE Q ss_conf 9999999984054120 Q gi|254781045|r 9 LNLYMLTLFSHGCTQI 24 (162) Q Consensus 9 ~~l~~~~l~laGCq~~ 24 (162) ..+..++++|+||.+. T Consensus 10 ~~~~~~~~llaGCasl 25 (590) T PRK13616 10 AALLAVALLVAGCASL 25 (590) T ss_pred HHHHHHHHHHHHCCCC T ss_conf 9999999986120368 No 104 >COG4939 Major membrane immunogen, membrane-anchored lipoprotein [Function unknown] Probab=23.72 E-value=54 Score=13.95 Aligned_cols=24 Identities=17% Similarity=0.441 Sum_probs=17.9 Q ss_pred HHHHHHHHHHHHHHCCCEEECCCC Q ss_conf 236999999999840541203788 Q gi|254781045|r 5 RFILLNLYMLTLFSHGCTQIDFGN 28 (162) Q Consensus 5 ~~~~~~l~~~~l~laGCq~~~~~~ 28 (162) ||.+...++..++|.+|...+|.. T Consensus 3 k~g~~~~~~~~~LL~aCg~sd~s~ 26 (147) T COG4939 3 KYGLVGMIVALSLLTACGKSDFSK 26 (147) T ss_pred EEHHHHHHHHHHHHHHHCCCCCCC T ss_conf 303659999999998706664455 No 105 >pfam10023 DUF2265 Predicted aminopeptidase (DUF2265). Members of this family of bacterial proteins comprise various hypothetical proteins and putative aminopeptidases. Their exact function, has not, as yet, been defined. Probab=23.58 E-value=35 Score=15.10 Aligned_cols=71 Identities=17% Similarity=0.252 Sum_probs=36.2 Q ss_pred HHHHHHHHCCCEEECCCCCCCCC-----CCCCCCCCCCCCCCCCCC---------CCCCCCCCCCCCCCCC-----CCCC Q ss_conf 99999984054120378877787-----666888743457358998---------8877886544667632-----2377 Q gi|254781045|r 11 LYMLTLFSHGCTQIDFGNIFFKK-----PEISLPPSVESEILLPPI---------PEEEFDQDDISVPSKD-----NNAI 71 (162) Q Consensus 11 l~~~~l~laGCq~~~~~~~~~~p-----~~a~p~~~V~s~~l~pp~---------~~~~~~~~~~~~p~~a-----~~~~ 71 (162) |..+++.++||++..|-.-...- ..+.|+..|-..+-.|+. ..-.|.......|.+. .|+. T Consensus 3 ll~~~l~l~gC~~~~Yy~Qa~~Gq~~ll~~~~pi~~~l~dp~t~~~Lr~kL~~~~~ir~FA~~~L~Lp~~~sY~~Y~dl~ 82 (338) T pfam10023 3 LLALALLLAGCQTLGYYWQSIGGQLQLMAAARPVDDVLADPATDAKLRQRLALAQQIREFASTELALPDNASYRRYADLG 82 (338) T ss_pred HHHHHHHHCCCCCHHHHHHHHHHHHHHHHCCCCHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHCC T ss_conf 99999998688630259999977999997179799996199999999999999999999999855999998704387549 Q ss_pred CHHEEEEEEECC Q ss_conf 011365788636 Q gi|254781045|r 72 RMGIIGAWKVSY 83 (162) Q Consensus 72 r~sl~G~W~vs~ 83 (162) |..+ .|+|.. T Consensus 83 r~~v--vwnV~A 92 (338) T pfam10023 83 RPYV--VWNVVA 92 (338) T ss_pred CCCE--EEEEEE T ss_conf 9857--999985 No 106 >PRK10510 putative outer membrane lipoprotein; Provisional Probab=23.49 E-value=55 Score=13.90 Aligned_cols=51 Identities=12% Similarity=0.001 Sum_probs=29.3 Q ss_pred CCHHEEEE-EEECCCCCEEEEEEECCCCCCCCCCCCC-CCCCCHHCCCCEEEC Q ss_conf 70113657-8863689736889713667777145436-773000002100333 Q gi|254781045|r 71 IRMGIIGA-WKVSYRDVDCKMILTLTRFKKNFRGTAR-SCHGRLASLAAWNII 121 (162) Q Consensus 71 ~r~sl~G~-W~vs~~g~sC~v~Lt~t~~~~Gyra~~~-gC~g~L~~i~aW~v~ 121 (162) .|++|.|. -++...+.+-.+.|+..-...-=++..+ .+-..|..|+.+--+ T Consensus 88 lr~~l~~~gv~v~r~gd~l~l~mp~~I~F~~dsa~l~p~~~~~L~~vA~~L~~ 140 (219) T PRK10510 88 LRDKMRGTGVSVTRSGDNIILNMPNNVTFDSSSATLKPAGANTLTGVAMVLKE 140 (219) T ss_pred HHHHHCCCCCEEEECCCEEEEECCCCCEEECCCHHCCHHHHHHHHHHHHHHHH T ss_conf 99985128928998687789967888566188521296789999999999998 No 107 >PRK04168 hypothetical protein; Provisional Probab=22.37 E-value=58 Score=13.76 Aligned_cols=23 Identities=22% Similarity=0.453 Sum_probs=17.3 Q ss_pred CCHHHHHHHHHHHHHHHCCCEEE Q ss_conf 20023699999999984054120 Q gi|254781045|r 2 HFYRFILLNLYMLTLFSHGCTQI 24 (162) Q Consensus 2 ~f~~~~~~~l~~~~l~laGCq~~ 24 (162) ...++.+..++.++++++||... T Consensus 4 ~~~~~~~~~~~~~~~~~~g~~~~ 26 (336) T PRK04168 4 GRRKIVIVILLLLALVFLGCVNT 26 (336) T ss_pred CCEEHHHHHHHHHHHHHCCCCCC T ss_conf 53220379999999997055577 No 108 >PRK04405 prsA peptidylprolyl isomerase; Provisional Probab=22.29 E-value=55 Score=13.89 Aligned_cols=21 Identities=24% Similarity=0.169 Sum_probs=11.6 Q ss_pred CHHHHHHHHH--HHHHHHCCCEE Q ss_conf 0023699999--99998405412 Q gi|254781045|r 3 FYRFILLNLY--MLTLFSHGCTQ 23 (162) Q Consensus 3 f~~~~~~~l~--~~~l~laGCq~ 23 (162) +-|..++.++ +++++|+||+. T Consensus 4 ~MKK~~l~~~~~~~~l~LaaCss 26 (298) T PRK04405 4 KMKKWALAAASAGLLLSLAGCSS 26 (298) T ss_pred HHHHHHHHHHHHHHHHHHHHCCC T ss_conf 78999999999999999987179 No 109 >TIGR02887 spore_ger_x_C germination protein, Ger(x)C family; InterPro: IPR008844 The GerAA, -AB, and -AC proteins of the Bacillus subtilis spore are required for the germination response to L-alanine as the sole germinant. Members of GerAC family are thought to be located in the inner spore membrane. Although the function of this family is unclear, they are likely to encode the components of the germination apparatus that respond directly to this germinant, mediating the spore's response .; GO: 0009847 spore germination, 0016020 membrane. Probab=21.53 E-value=60 Score=13.66 Aligned_cols=18 Identities=28% Similarity=0.490 Sum_probs=12.2 Q ss_pred HHHHHHHHHHHHHCCCEE Q ss_conf 369999999998405412 Q gi|254781045|r 6 FILLNLYMLTLFSHGCTQ 23 (162) Q Consensus 6 ~~~~~l~~~~l~laGCq~ 23 (162) +.++.++++.++|.||-. T Consensus 3 ~~~~~~~~~~~lL~GCwd 20 (400) T TIGR02887 3 LKILLLILALLLLTGCWD 20 (400) T ss_pred HHHHHHHHHHHHHCCCCC T ss_conf 667899999998326656 No 110 >COG5510 Predicted small secreted protein [Function unknown] Probab=21.26 E-value=52 Score=14.01 Aligned_cols=24 Identities=4% Similarity=0.202 Sum_probs=15.3 Q ss_pred HHHHHHHHHHHHHCCCEEECCCCC Q ss_conf 369999999998405412037887 Q gi|254781045|r 6 FILLNLYMLTLFSHGCTQIDFGNI 29 (162) Q Consensus 6 ~~~~~l~~~~l~laGCq~~~~~~~ 29 (162) -....|.+....|++|-+.+.-+- T Consensus 7 l~i~~vll~s~llaaCNT~rG~G~ 30 (44) T COG5510 7 LLIALVLLASTLLAACNTMRGAGK 30 (44) T ss_pred HHHHHHHHHHHHHHHHHHHHCCCH T ss_conf 999999999999988663002236 No 111 >pfam11873 DUF3393 Domain of unknown function (DUF3393). This domain is functionally uncharacterized. This domain is found in bacteria. This presumed domain is typically between 188 to 206 amino acids in length. This domain is found associated with pfam01464. Probab=21.08 E-value=42 Score=14.61 Aligned_cols=16 Identities=31% Similarity=0.725 Sum_probs=10.8 Q ss_pred HHHHHHHHHHCCCEEE Q ss_conf 9999999984054120 Q gi|254781045|r 9 LNLYMLTLFSHGCTQI 24 (162) Q Consensus 9 ~~l~~~~l~laGCq~~ 24 (162) +.+.+++++|.||++. T Consensus 4 l~~~~~~llL~~Cs~~ 19 (200) T pfam11873 4 LSLLLILLLLSGCSSQ 19 (200) T ss_pred EHHHHHHHHHHHCCCC T ss_conf 0799999998415776 No 112 >PRK10397 hypothetical protein; Provisional Probab=20.48 E-value=63 Score=13.52 Aligned_cols=30 Identities=13% Similarity=0.247 Sum_probs=17.6 Q ss_pred HHHHHHCCCEE-ECCCCCCCCCCCCCCCCCC Q ss_conf 99998405412-0378877787666888743 Q gi|254781045|r 13 MLTLFSHGCTQ-IDFGNIFFKKPEISLPPSV 42 (162) Q Consensus 13 ~~~l~laGCq~-~~~~~~~~~p~~a~p~~~V 42 (162) ..+++|+||-. ..|+..--.|.||-..+-= T Consensus 8 g~~l~LsGCa~v~nY~~vVk~PaPagl~GyW 38 (137) T PRK10397 8 GALMLLAGCAEVENYNNVVKTPAPAGLAGYW 38 (137) T ss_pred HHHHHHHCCCCCCCHHHHHCCCCCCCCCEEE T ss_conf 8999973532441066564489973323044 No 113 >TIGR00409 proS_fam_II prolyl-tRNA synthetase; InterPro: IPR004500 The aminoacyl-tRNA synthetases (6.1.1. from EC) catalyse the attachment of an amino acid to its cognate transfer RNA molecule in a highly specific two-step reaction. These proteins differ widely in size and oligomeric state, and have limited sequence homology . The 20 aminoacyl-tRNA synthetases are divided into two classes, I and II. Class I aminoacyl-tRNA synthetases contain a characteristic Rossman fold catalytic domain and are mostly monomeric . Class II aminoacyl-tRNA synthetases share an anti-parallel beta-sheet fold flanked by alpha-helices , and are mostly dimeric or multimeric, containing at least three conserved regions , , . However, tRNA binding involves an alpha-helical structure that is conserved between class I and class II synthetases. In reactions catalysed by the class I aminoacyl-tRNA synthetases, the aminoacyl group is coupled to the 2'-hydroxyl of the tRNA, while, in class II reactions, the 3'-hydroxyl site is preferred. The synthetases specific for arginine, cysteine, glutamic acid, glutamine, isoleucine, leucine, methionine, tyrosine, tryptophan and valine belong to class I synthetases; these synthetases are further divided into three subclasses, a, b and c, according to sequence homology. The synthetases specific for alanine, asparagine, aspartic acid, glycine, histidine, lysine, phenylalanine, proline, serine, and threonine belong to class-II synthetases . Prolyl-tRNA synthetase (6.1.1.15 from EC) exists in two forms, which are loosely related. The first form, is present in the majority of eubacteria species. The second one, present in some eubacteria, is essentially present in archaea and eukaryota. Prolyl-tRNA synthetase belongs to class IIa. This family includes the enzyme from Escherichia coli that contains all three of the conserved consensus motifs characteristic of class II aminoacyl-tRNA synthetases and the enzyme from the spirochete Borrelia burgdorferi.; GO: 0000166 nucleotide binding, 0004827 proline-tRNA ligase activity, 0005524 ATP binding, 0006412 translation, 0006433 prolyl-tRNA aminoacylation, 0005737 cytoplasm. Probab=20.29 E-value=60 Score=13.65 Aligned_cols=24 Identities=17% Similarity=0.511 Sum_probs=18.7 Q ss_pred HCCCCEEECCC---CEEEEECCCCCEE Q ss_conf 00210033387---1899982899879 Q gi|254781045|r 113 ASLAAWNIIDE---DSFELKNKSGQTI 136 (162) Q Consensus 113 ~~i~aW~v~G~---~vl~L~D~sG~~v 136 (162) -.-+.||--|+ +.++|+|+.++.. T Consensus 84 ~~SGRW~~YG~seGELl~lkDR~~r~f 110 (620) T TIGR00409 84 QESGRWDTYGPSEGELLRLKDRKGREF 110 (620) T ss_pred HHCCCCCCCCCCCCEEEEEEECCCCCC T ss_conf 540753246865433667652688873 No 114 >cd04814 PA_M28_1 PA_M28_1: Protease-associated (PA) domain, peptidase family M28, subfamily-1. A subfamily of PA-domain containing proteins belonging to the peptidase family M28. Family M28 contains aminopeptidases and carboxypeptidases, and has co-catalytic zinc ions. The PA domain is an insert domain in a diverse fraction of proteases. The significance of the PA domain to many of the proteins in which it is inserted is undetermined. It may be a protein-protein interaction domain. At peptidase active sites, the PA domain may participate in substrate binding and/or promoting conformational changes, which influence the stability and accessibility of the site to substrate. Proteins into which the PA domain is inserted include the following members of the peptidase family M28: i) prostate-specific membrane antigen (PSMA), ii) yeast aminopeptidase Y, and ii) human TfR (transferrin receptor)1 and human TfR2. The proteins listed above belong to other subfamilies, relatively little is known a Probab=20.02 E-value=64 Score=13.46 Aligned_cols=15 Identities=13% Similarity=0.206 Sum_probs=6.5 Q ss_pred EECCCCEEEEECCCC Q ss_conf 333871899982899 Q gi|254781045|r 119 NIIDEDSFELKNKSG 133 (162) Q Consensus 119 ~v~G~~vl~L~D~sG 133 (162) ||+||-+|+|.+..+ T Consensus 45 Dv~GKivvvl~ndP~ 59 (142) T cd04814 45 DVKGKVVVVLRNDPQ 59 (142) T ss_pred CCCCCEEEEEECCCC T ss_conf 767978999807999 No 115 >COG4764 Uncharacterized protein conserved in bacteria [Function unknown] Probab=20.02 E-value=60 Score=13.64 Aligned_cols=13 Identities=23% Similarity=0.427 Sum_probs=9.4 Q ss_pred HHHHHHHCCCEEE Q ss_conf 9999984054120 Q gi|254781045|r 12 YMLTLFSHGCTQI 24 (162) Q Consensus 12 ~~~~l~laGCq~~ 24 (162) .++.|+|+||-+- T Consensus 11 ~v~lL~LagCaTa 23 (197) T COG4764 11 AVVLLALAGCATA 23 (197) T ss_pred HHHHHHHHHCCCC T ss_conf 9999997030368 Done!