Query gi|254781046|ref|YP_003065459.1| hypothetical protein CLIBASIA_04740 [Candidatus Liberibacter asiaticus str. psy62] Match_columns 41 No_of_seqs 1 out of 3 Neff 1.0 Searched_HMMs 39220 Date Mon May 30 03:21:27 2011 Command /home/congqian_1/programs/hhpred/hhsearch -i 254781046.hhm -d /home/congqian_1/database/cdd/Cdd.hhm No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM 1 TIGR02535 hyp_Hser_kinase prop 75.3 1.6 4.1E-05 23.9 1.6 27 2-29 271-297 (431) 2 TIGR00006 TIGR00006 S-adenosyl 53.5 5.6 0.00014 21.3 0.9 14 11-24 242-255 (323) 3 COG0275 Predicted S-adenosylme 34.3 21 0.00053 18.5 1.3 14 12-25 236-249 (314) 4 COG1973 HypE Hydrogenase matur 31.8 15 0.00039 19.1 0.3 41 1-41 269-309 (449) 5 TIGR00834 ae anion exchange pr 28.8 11 0.00028 19.9 -0.8 19 8-36 842-860 (987) 6 PRK00050 mraW S-adenosyl-methy 24.4 39 0.00099 17.2 1.3 18 8-25 228-245 (309) 7 pfam01795 Methyltransf_5 MraW 22.7 44 0.0011 16.9 1.3 15 11-25 232-246 (310) 8 TIGR00972 3a0107s01c2 phosphat 12.5 1E+02 0.0026 15.1 1.2 10 7-16 212-221 (248) 9 pfam08288 PIGA PIGA (GPI ancho 9.9 1.9E+02 0.0049 13.8 2.2 24 2-26 38-61 (90) 10 PRK11566 hdeB acid-resistance 9.7 1.1E+02 0.0028 15.0 0.6 18 1-18 1-18 (108) No 1 >TIGR02535 hyp_Hser_kinase proposed homoserine kinase; InterPro: IPR013371 The genes encoding proteins in this entry are largely adjacent to genes involved in the biosynthesis of threonine (aspartate kinase, homoserine dehydrogenase and threonine synthase) in genomes which are lacking any other known homoserine kinase, and in which the presence of a homoserine kinase would indicate a complete pathway for the biosynthesis of threonine. These proteins are homologous to the archaeal form of 2,3-bisphosphoglycerate-independent phosphoglycerate mutase and form part of a superfamily of metalloenzymes including phosphopentomutases, alkaline phosphatases and sulphatases. The proposal that these proteins encode a kinase is based on analogy to phosphomutases which are intramolecular phosphotransferases. A mutase active site could evolve to bring together homoserine and a phosphate donor such as phosphoenolpyruvate, resulting in kinase activity.; GO: 0004619 phosphoglycerate mutase activity. Probab=75.29 E-value=1.6 Score=23.92 Aligned_cols=27 Identities=41% Similarity=0.757 Sum_probs=24.3 Q ss_pred CHHHHHHHHHHHCCEEEEEEECCCCCCC Q ss_conf 6899999999614045789821334001 Q gi|254781046|r 2 NVDLIRKIFIYMGRLTIIKFHSATGFKN 29 (41) Q Consensus 2 nvdlirkifiymgrltiikfhsatgfkn 29 (41) .|||||-|=+||| |.+|..+-|||+-| T Consensus 271 AVDLlkGlG~~aG-l~~i~V~GATGYLD 297 (431) T TIGR02535 271 AVDLLKGLGIYAG-LEVIEVEGATGYLD 297 (431) T ss_pred HHHHHHHHHHHCC-CCCCCCCCCCCCCC T ss_conf 6477899999808-88521366347756 No 2 >TIGR00006 TIGR00006 S-adenosyl-methyltransferase MraW; InterPro: IPR002903 This is a family of methyltransferases. Methyltransferases are responsible for the transfer of methyl groups between two molecules.; GO: 0008168 methyltransferase activity. Probab=53.48 E-value=5.6 Score=21.30 Aligned_cols=14 Identities=50% Similarity=0.698 Sum_probs=11.5 Q ss_pred HHHCCEEEEEEECC Q ss_conf 96140457898213 Q gi|254781046|r 11 IYMGRLTIIKFHSA 24 (41) Q Consensus 11 iymgrltiikfhsa 24 (41) ---|||.||-|||- T Consensus 242 ~~~Grl~vIsFHSL 255 (323) T TIGR00006 242 KPGGRLSVISFHSL 255 (323) T ss_pred CCCCEEEEEEHHHH T ss_conf 78971898740005 No 3 >COG0275 Predicted S-adenosylmethionine-dependent methyltransferase involved in cell envelope biogenesis [Cell envelope biogenesis, outer membrane] Probab=34.32 E-value=21 Score=18.52 Aligned_cols=14 Identities=50% Similarity=0.724 Sum_probs=11.5 Q ss_pred HHCCEEEEEEECCC Q ss_conf 61404578982133 Q gi|254781046|r 12 YMGRLTIIKFHSAT 25 (41) Q Consensus 12 ymgrltiikfhsat 25 (41) --|||.+|.|||-- T Consensus 236 ~~GRl~VIsFHSLE 249 (314) T COG0275 236 PGGRLAVISFHSLE 249 (314) T ss_pred CCCEEEEEEECCHH T ss_conf 89679999953428 No 4 >COG1973 HypE Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones] Probab=31.84 E-value=15 Score=19.15 Aligned_cols=41 Identities=37% Similarity=0.398 Sum_probs=33.3 Q ss_pred CCHHHHHHHHHHHCCEEEEEEECCCCCCCCCCCCCCCCCCC Q ss_conf 96899999999614045789821334001202366100039 Q gi|254781046|r 1 MNVDLIRKIFIYMGRLTIIKFHSATGFKNGIQFGDTTEITK 41 (41) Q Consensus 1 mnvdlirkifiymgrltiikfhsatgfkngiqfgdtteitk 41 (41) .|||.||..-..+-.--+-+.||-|...||=--||..||.| T Consensus 269 lnv~fi~a~eai~~s~L~~~vhsMTDVTNGGiRgDA~EISk 309 (449) T COG1973 269 LNVDFIRACEAIVRSGLLSDVHSMTDVTNGGIRGDALEISK 309 (449) T ss_pred CCHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHH T ss_conf 27489999999998505665345430547761443787655 No 5 >TIGR00834 ae anion exchange protein; InterPro: IPR003020 Bicarbonate (HCO_3^-) transport mechanisms are the principal regulators of pH in animal cells. Such transport also plays a vital role in acid-base movements in the stomach, pancreas, intestine, kidney, reproductive organs and the central nervous system. Functional studies have suggested four different HCO_3^- transport modes. Anion exchanger proteins exchange HCO_3^- for Cl^- in a reversible, electroneutral manner . Na^+/HCO_3^- co-transport proteins mediate the coupled movement of Na^+ and HCO_3^- across plasma membranes, often in an electrogenic manner . Na^- driven Cl^-/HCO_3^- exchange and K^+/HCO_3^- exchange activities have also been detected in certain cell types, although the molecular identities of the proteins responsible remain to be determined. Sequence analysis of the two families of HCO_3^- transporters that have been cloned to date (the anion exchangers and Na^+/HCO_3^- co-transporters) reveals that they are homologous. This is not entirely unexpected, given that they both transport HCO_3^- and are inhibited by a class of pharmacological agents called disulphonic stilbenes . They share around ~25-30equence identity, which is distributed along their entire sequence length, and have similar predicted membrane topologies, suggesting they have ~10 transmembrane (TM) domains. ; GO: 0005452 inorganic anion exchanger activity, 0006820 anion transport, 0016020 membrane. Probab=28.83 E-value=11 Score=19.86 Aligned_cols=19 Identities=47% Similarity=0.754 Sum_probs=10.7 Q ss_pred HHHHHHCCEEEEEEECCCCCCCCCCCCCC Q ss_conf 99996140457898213340012023661 Q gi|254781046|r 8 KIFIYMGRLTIIKFHSATGFKNGIQFGDT 36 (41) Q Consensus 8 kifiymgrltiikfhsatgfkngiqfgdt 36 (41) -||.|||--. -|||||=|- T Consensus 842 GiFLYMGvtS----------L~GIQl~DR 860 (987) T TIGR00834 842 GIFLYMGVTS----------LSGIQLFDR 860 (987) T ss_pred HHHHHHHHHH----------HHHHHHHHH T ss_conf 4688877886----------101469999 No 6 >PRK00050 mraW S-adenosyl-methyltransferase MraW; Provisional Probab=24.35 E-value=39 Score=17.19 Aligned_cols=18 Identities=39% Similarity=0.682 Sum_probs=13.6 Q ss_pred HHHHHHCCEEEEEEECCC Q ss_conf 999961404578982133 Q gi|254781046|r 8 KIFIYMGRLTIIKFHSAT 25 (41) Q Consensus 8 kifiymgrltiikfhsat 25 (41) ++.---|||.+|-|||-- T Consensus 228 ~~L~~gGrl~vISfHSLE 245 (309) T PRK00050 228 EVLAPGGRLSVISFHSLE 245 (309) T ss_pred HHHHCCCEEEEEEECCHH T ss_conf 998507539999843325 No 7 >pfam01795 Methyltransf_5 MraW methylase family. Members of this family are probably SAM dependent methyltransferases based on Escherichia coli mraW. This family appears to be related to pfam01596. Probab=22.74 E-value=44 Score=16.94 Aligned_cols=15 Identities=47% Similarity=0.678 Sum_probs=12.0 Q ss_pred HHHCCEEEEEEECCC Q ss_conf 961404578982133 Q gi|254781046|r 11 IYMGRLTIIKFHSAT 25 (41) Q Consensus 11 iymgrltiikfhsat 25 (41) ---|||.+|-|||-- T Consensus 232 ~~gGrl~VISFHSLE 246 (310) T pfam01795 232 APGGRLSVISFHSLE 246 (310) T ss_pred CCCCEEEEEEECCHH T ss_conf 899689999854346 No 8 >TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein; InterPro: IPR005670 This is a family of phosphate transport system permease proteins.; GO: 0005315 inorganic phosphate transmembrane transporter activity, 0015114 phosphate transmembrane transporter activity, 0006817 phosphate transport, 0016020 membrane. Probab=12.45 E-value=1e+02 Score=15.11 Aligned_cols=10 Identities=50% Similarity=0.926 Sum_probs=7.2 Q ss_pred HHHHHHHCCE Q ss_conf 9999961404 Q gi|254781046|r 7 RKIFIYMGRL 16 (41) Q Consensus 7 rkifiymgrl 16 (41) |-+|.|+|+| T Consensus 212 ~tAFF~~G~L 221 (248) T TIGR00972 212 RTAFFYDGEL 221 (248) T ss_pred HHHHHHCCEE T ss_conf 9988656725 No 9 >pfam08288 PIGA PIGA (GPI anchor biosynthesis). This domain is found on phosphatidylinositol n-acetylglucosaminyltransferase proteins. These proteins are involved in GPI anchor biosynthesis and are associated with disease the paroxysmal nocturnal haemoglobinuria. Probab=9.94 E-value=1.9e+02 Score=13.78 Aligned_cols=24 Identities=33% Similarity=0.483 Sum_probs=18.0 Q ss_pred CHHHHHHHHHHHCCEEEEEEECCCC Q ss_conf 6899999999614045789821334 Q gi|254781046|r 2 NVDLIRKIFIYMGRLTIIKFHSATG 26 (41) Q Consensus 2 nvdlirkifiymgrltiikfhsatg 26 (41) +..++|.|+| -.+.+|+.-|+|+. T Consensus 38 ~~Pl~R~Ili-RE~I~IVHgH~a~S 61 (90) T pfam08288 38 TFPLFRNILI-RERIDIVHGHQAFS 61 (90) T ss_pred HHHHHHHHHH-HHCCEEEEEEHHHH T ss_conf 4599999998-72621997217777 No 10 >PRK11566 hdeB acid-resistance protein; Provisional Probab=9.73 E-value=1.1e+02 Score=14.98 Aligned_cols=18 Identities=50% Similarity=0.923 Sum_probs=13.8 Q ss_pred CCHHHHHHHHHHHCCEEE Q ss_conf 968999999996140457 Q gi|254781046|r 1 MNVDLIRKIFIYMGRLTI 18 (41) Q Consensus 1 mnvdlirkifiymgrlti 18 (41) ||.--.||++|+||.++- T Consensus 1 m~~~sL~~a~v~~~A~~~ 18 (108) T PRK11566 1 MNISSLRKAFIFMGALAT 18 (108) T ss_pred CCHHHHHHHHHHHHHHHH T ss_conf 954355688999999999 Done!