RPSBLAST alignment for GI: 254781048 and conserved domain: PLN00106

>gnl|CDD|177723 PLN00106, PLN00106, malate dehydrogenase. Length = 323
 Score = 86.5 bits (215), Expect = 7e-18
 Identities = 93/320 (29%), Positives = 152/320 (47%), Gaps = 51/320 (15%)

Query: 5   KIALIG-SGMIGGTLAHLAVLKKL-GDVVLLDIVDGMPRGKALDIAE---SSPVEGF--- 56
           K+A++G +G IG  L+ L  +  L  ++ L DI    P G A D++     + V GF   
Sbjct: 20  KVAVLGAAGGIGQPLSLLMKMNPLVSELHLYDIA-NTP-GVAADVSHINTPAQVRGFLGD 77

Query: 57  ---GAQLCGTSDYSDIAEADVCIVTAGIPRKPSMSRDDLLADNLKAIEKVGAGIRKYAPN 113
              G  L G         AD+ I+ AG+PRKP M+RDDL   N   ++ +   + K+ PN
Sbjct: 78  DQLGDALKG---------ADLVIIPAGVPRKPGMTRDDLFNINAGIVKTLCEAVAKHCPN 128

Query: 114 SFVICITNPLDAMV----WALQKFSGLPSHMVVGMAGILDSARFRYFLAQEFGVSVESVT 169
           + V  I+NP+++ V      L+K        + G+   LD  R   F+A++ G+    V 
Sbjct: 129 ALVNIISNPVNSTVPIAAEVLKKAGVYDPKKLFGVT-TLDVVRANTFVAEKKGLDPADVD 187

Query: 170 ALVLGSH-GDSMVPMLRYATVSGIPVSDLVKLGWTTQEKIDQIVKRTREGGAEIV----G 224
             V+G H G +++P+L  AT    P          T E+I+ + KR + GG E+V    G
Sbjct: 188 VPVVGGHAGITILPLLSQAT----PKVSF------TDEEIEALTKRIQNGGTEVVEAKAG 237

Query: 225 LLRSGSAYYAPASSAIAIAESYLKNKK---NLLPCAAHLSGQYGVEGFYVGVPVVIGHKG 281
              +GSA  + A +A   A++ L+      +++ C+   S     E  +    V +G  G
Sbjct: 238 ---AGSATLSMAYAAARFADACLRGLNGEADVVECSYVQSEV--TELPFFASKVRLGRNG 292

Query: 282 VEKIVELN-LSFDEKDAFQK 300
           VE+++ L  LS  E+   + 
Sbjct: 293 VEEVLGLGPLSEYEQKGLEA 312