RPSBLAST alignment for GI: 254781048 and conserved domain: KOG1496

>gnl|CDD|36709 KOG1496, KOG1496, KOG1496, Malate dehydrogenase [Energy production and conversion]. Length = 332
 Score = 67.8 bits (165), Expect = 3e-12
 Identities = 75/255 (29%), Positives = 114/255 (44%), Gaps = 20/255 (7%)

Query: 73  DVCIVTAGIPRKPSMSRDDLLADNLKAIEKVGAGIRKYA-PNSFVICITNPLDAMVWALQ 131
           DV I+   +PR+  M R DLL+ N+K  +  GA + KYA PN  V+ + NP +     L+
Sbjct: 82  DVAILVGAMPRREGMERKDLLSANVKIFKSQGAALEKYAKPNVKVLVVGNPANTNALILK 141

Query: 132 KFSGLPSHMVVGMAGILDSARFRYFLAQEFGVSVESVTALVL-GSHGDSMVPMLRYATVS 190
           KF+             LD  R    LA + GV V  V  +++ G+H  +  P + +ATV+
Sbjct: 142 KFAPSIPEKNFSALTRLDHNRALAQLALKLGVPVSDVKNVIIWGNHSSTQYPDVNHATVN 201

Query: 191 G----IPVSDLVK-LGWTTQEKIDQIVKRTREGGAEIVGLLRSGSAYYAPASSAIAIAES 245
                 PV + VK   W   E I+ + KR    GA ++   +  SA  A  ++   I + 
Sbjct: 202 TNGGEKPVKEAVKDDAWLQGEFIETVQKR----GAAVIKARKLSSAMSAAKAACDHIRDW 257

Query: 246 YLKNKK-NLLPCAAHLSGQYGV-EGFYVGVPVVIGHKGVEKIVELNLSFDE-----KDAF 298
           +    +   +    +  G YG+ +G     PV I   G  KIV+  L  D+      D  
Sbjct: 258 WFGTPEGTFVSMGVYSDGSYGIPDGLIFSFPVTI-KNGDWKIVQ-GLPIDDFSREKMDLT 315

Query: 299 QKSVKATVDLCNSCT 313
            K +K   DL  SC 
Sbjct: 316 AKELKEEKDLAYSCL 330