>cd01574 PBP1_LacI Ligand-binding domain of DNA transcription repressor LacI specific for lactose, a member of the LacI-GalR family of bacterial transcription regulators. Ligand-binding domain of DNA transcription repressor LacI specific for lactose, a member of the LacI-GalR family of bacterial transcription regulators. The ligand-binding domain of LacI is structurally homologous to the periplasmic sugar-binding domain of ABC-type transporters and both domains contain the type I periplasmic binding protein-like fold. The LacI-GalR family repressors are composed of two functional domains: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal ligand-binding domain, which is homologous to the type I periplasmic binding proteins. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcription repressor undergoes a conformational change upon ligand binding which in turn changes the DNA b

Probab=92.20 E-value=0.94 Score=24.64 Aligned_cols=82 Identities=15% Similarity=0.188 Sum_probs=56.1 Q ss_pred CCCCHHHHHHHHHHHHCCCCCCEEEEECCCCHHHHHHHHHHHHHHHHHCCCCCC---EEEECCCCCHHHHHHHHHHCCCC Q ss_conf 888989999999998619986589996358613289999999999997299987---99974898589999999976995 Q gi|254781049|r 301 GGADQDKVAAAFKIITSDSSVKGILINIFGGIMRCDVLVKGILSAVKEVKINIP---LVMRLEGANVDIGNRLIAESGLN 377 (398) Q Consensus 301 G~a~~e~~~~a~~~il~~~~vk~iliNifGGI~~cd~vA~gii~a~~~~~~~~p---ivvRl~Gtn~~~g~~il~~~g~~ 377 (398) T Consensus 155 ~~~~~~~~~~~~~~l~~~~~~~aii~-------~~D~~A~g~i~~l~~~g~~iP~di~iigfd~~~~------~~~~~p~ 221 (264) T cd01574 155 GDWSAESGYRAGRELLREGDPTAVFA-------ANDQMALGVLRALHELGLRVPDDVSVVGFDDIPE------SAYFIPP 221 (264) T ss_pred CCCCHHHHHHHHHHHHHCCCCCEEEE-------CCHHHHHHHHHHHHHHCCCCCCCCEEEEECCCHH------HHHCCCC T ss_conf 68997999999999983799968963-------6429999999999982998898847998688178------8950898 Q ss_pred EE-EECCHHHHHHHHHHHH Q ss_conf 89-9499899999999985 Q gi|254781049|r 378 VI-TAIDLDDAAQKIVHAV 395 (398) Q Consensus 378 ~~-~~~~~~~A~~~~v~~~ 395 (398) T Consensus 222 lTtI~~~~~~~g~~A~~~l 240 (264) T cd01574 222 LTTVRQDFAALGRRAVELL 240 (264) T ss_pred EEEEEECHHHHHHHHHHHH T ss_conf 5899819999999999999

HHsearch alignment for GI: 254781049 and conserved domain: cd01574