>cd06271 PBP1_AglR_RafR_like Ligand-binding domain of DNA transcription repressors specific for raffinose (RafR) and alpha-glucosides (AglR) which are members of the LacI-GalR family of bacterial transcription regulators. Ligand-binding domain of DNA transcription repressors specific for raffinose (RafR) and alpha-glucosides (AglR) which are members of the LacI-GalR family of bacterial transcription regulators. The LacI-GalR family repressors are composed of two functional domains: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal ligand-binding domain, which is homologous to the sugar-binding domain of ABC-type transport systems that contain the type I periplasmic binding protein-like fold. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcription repressor undergoes a conformational change upon ligand binding which in turn changes the DNA binding affinity of the represso

Probab=91.40 E-value=1.2 Score=24.07 Aligned_cols=104 Identities=15% Similarity=0.132 Sum_probs=61.7 Q ss_pred HHHHHHCCCCCCEEEECCCCCCHHHHHHHHHHHH-CCCCCCEEEEECCCCHHHHHHHHHHHHHHHHHCCCCCCEEEECCC Q ss_conf 9999965899624884278889899999999986-199865899963586132899999999999972999879997489 Q gi|254781049|r 283 MDIIKLYGGAPANFLDVGGGADQDKVAAAFKIIT-SDSSVKGILINIFGGIMRCDVLVKGILSAVKEVKINIPLVMRLEG 361 (398) Q Consensus 283 mD~i~~~Gg~pANFlD~gG~a~~e~~~~a~~~il-~~~~vk~iliNifGGI~~cd~vA~gii~a~~~~~~~~pivvRl~G 361 (398) T Consensus 143 ~~al~~~gl~~~~~~~~~~~~~~~~~~~~~~~ll~~~~~p~Ai~-------~~nD~~A~g~l~~l~~~g~~vP~Disvig 215 (268) T cd06271 143 RRALAEAGLPLDPALIVSGDMTEEGGYAAAAELLALPDRPTAIV-------CSSELMALGVLAALAEAGLRPGRDVSVVG 215 (268) T ss_pred HHHHHHCCCCCCCCEEEECCCCHHHHHHHHHHHHHCCCCCCEEE-------ECCHHHHHHHHHHHHHCCCCCCCCEEEEE T ss_conf 99999839997711365068757779999999996599986899-------77779999999999982999899979999 Q ss_pred CCHHHHHHHHHHCCCCEEEECCHHHHHHHHHHHH Q ss_conf 8589999999976995899499899999999985 Q gi|254781049|r 362 ANVDIGNRLIAESGLNVITAIDLDDAAQKIVHAV 395 (398) Q Consensus 362 tn~~~g~~il~~~g~~~~~~~~~~~A~~~~v~~~ 395 (398) T Consensus 216 fD~~~~~~~~-~p~LTt-i~~~~~~~g~~A~~~L 247 (268) T cd06271 216 FDDSPPLLFF-SPPLTT-VRSDLRAAGRRLAELL 247 (268) T ss_pred ECCCHHHHHC-CCCEEE-EECCHHHHHHHHHHHH T ss_conf 7882899827-898089-9809999999999999

HHsearch alignment for GI: 254781049 and conserved domain: cd06271