>cd06272 PBP1_hexuronate_repressor_like Ligand-binding domain of DNA transcription repressor for the hexuronate utilization operon from Bacillus species and its close homologs from other bacteria, all of which are a member of the LacI-GalR family of bacterial transcription regulators. Ligand-binding domain of DNA transcription repressor for the hexuronate utilization operon from Bacillus species and its close homologs from other bacteria, all of which are a member of the LacI-GalR family of bacterial transcription regulators. The LacI-GalR family repressors are composed of two functional domains: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal ligand-binding domain, which is homologous to the sugar-binding domain of ABC-type transport systems that contain the type I periplasmic binding protein-like fold. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcription repressor

Probab=90.85 E-value=1.3 Score=23.73 Aligned_cols=103 Identities=17% Similarity=0.195 Sum_probs=61.0 Q ss_pred HHHHHHCCCCCC-EEEECCCCCCHHHHHHHHHHHHC-CCCCCEEEEECCCCHHHHHHHHHHHHHHHHHCCCCCCEEEECC Q ss_conf 999996589962-48842788898999999999861-9986589996358613289999999999997299987999748 Q gi|254781049|r 283 MDIIKLYGGAPA-NFLDVGGGADQDKVAAAFKIITS-DSSVKGILINIFGGIMRCDVLVKGILSAVKEVKINIPLVMRLE 360 (398) Q Consensus 283 mD~i~~~Gg~pA-NFlD~gG~a~~e~~~~a~~~il~-~~~vk~iliNifGGI~~cd~vA~gii~a~~~~~~~~pivvRl~ 360 (398) T Consensus 134 ~~al~~~g~~~~~~~i~-~~~~~~~~~~~~~~~ll~~~~~p~Ai~-------~~nD~~A~g~~~~l~~~g~~vP~dvsvi 205 (261) T cd06272 134 LETCDENGISISDSHID-VDGLSAEGGDNAAKKLLKESDLPTAII-------CGSYDIALGVLSALNKQGISIPEDIEII 205 (261) T ss_pred HHHHHHCCCCCCCEEEE-ECCCHHHHHHHHHHHHHHCCCCCCCEE-------ECCHHHHHHHHHHHHHHCCCCCCCEEEE T ss_conf 99999859985513898-303103679999999985278986101-------2768999999999998099999955999 Q ss_pred CCCHHHHHHHHHHCCCCEEEECCHHHHHHHHHHHH Q ss_conf 98589999999976995899499899999999985 Q gi|254781049|r 361 GANVDIGNRLIAESGLNVITAIDLDDAAQKIVHAV 395 (398) Q Consensus 361 Gtn~~~g~~il~~~g~~~~~~~~~~~A~~~~v~~~ 395 (398) T Consensus 206 GfDd~~~~~~~~-P~LTt-v~q~~~~ig~~A~~~L 238 (261) T cd06272 206 SYDNIPQMAIID-PPLTA-VDVPIEEIAKKSLELL 238 (261) T ss_pred EECCCHHHHHHC-CCCEE-EEECHHHHHHHHHHHH T ss_conf 988818899509-98479-9809999999999999

HHsearch alignment for GI: 254781049 and conserved domain: cd06272