>cd06273 PBP1_GntR_like_1 This group includes the ligand-binding domain of putative DNA transcription repressors which are highly similar to that of the repressor specific for gluconate (GntR), a member of the LacI-GalR family of bacterial transcription regulators. This group includes the ligand-binding domain of putative DNA transcription repressors which are highly similar to that of the repressor specific for gluconate (GntR), a member of the LacI-GalR family of bacterial transcription regulators. The LacI-GalR family repressors are composed of two functional domains: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal ligand-binding domain, which is homologous to the sugar-binding domain of ABC-type transport systems that contain the type I periplasmic binding protein-like fold. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcription repressor undergoes a conformational

Probab=92.78 E-value=0.8 Score=25.11 Aligned_cols=102 Identities=14% Similarity=0.173 Sum_probs=61.7 Q ss_pred HHHHCCCCCCEEEECCCCCCHHHHHHHHHHHHC-CCCCCEEEEECCCCHHHHHHHHHHHHHHHHHCCCCCCEEEECCCCC Q ss_conf 999658996248842788898999999999861-9986589996358613289999999999997299987999748985 Q gi|254781049|r 285 IIKLYGGAPANFLDVGGGADQDKVAAAFKIITS-DSSVKGILINIFGGIMRCDVLVKGILSAVKEVKINIPLVMRLEGAN 363 (398) Q Consensus 285 ~i~~~Gg~pANFlD~gG~a~~e~~~~a~~~il~-~~~vk~iliNifGGI~~cd~vA~gii~a~~~~~~~~pivvRl~Gtn 363 (398) T Consensus 142 al~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~ai~-------~~nd~~A~g~i~~l~~~g~~iP~disvigfd 214 (268) T cd06273 142 ALAEAGLELPELWQVEAPYSIADGRAALRQLLEQPPRPTAVI-------CGNDVLALGALYEARRLGLSVPEDLSIVGFD 214 (268) T ss_pred HHHHHCCCCCHHHEEECCCCHHHHHHHHHHHHHCCCCCCEEE-------ECCHHHHHHHHHHHHHCCCCCCCCEEEEEEC T ss_conf 999809998714203157898999999999984799984899-------7787999999999996399999967999999 Q ss_pred HHHHHHHHHHCCCCEEEECCHHHHHHHHHHHH Q ss_conf 89999999976995899499899999999985 Q gi|254781049|r 364 VDIGNRLIAESGLNVITAIDLDDAAQKIVHAV 395 (398) Q Consensus 364 ~~~g~~il~~~g~~~~~~~~~~~A~~~~v~~~ 395 (398) T Consensus 215 ~~~~~~~~~-p~lTt-i~~~~~~~g~~a~~~L 244 (268) T cd06273 215 DIDGSAELE-PALTT-VRVPAREIGRIAAEAL 244 (268) T ss_pred CHHHHHHHC-CCCEE-EEECHHHHHHHHHHHH T ss_conf 828898418-99479-9919999999999999

HHsearch alignment for GI: 254781049 and conserved domain: cd06273