>cd06283 PBP1_RegR_EndR_KdgR_like Ligand-binding domain of DNA transcription repressor RegR and other putative regulators such as KdgR and EndR. Ligand-binding domain of DNA transcription repressor RegR and other putative regulators such as KdgR and EndR, all of which are members of the LacI-GalR family of bacterial transcription regulators. RegR regulates bacterial competence and the expression of virulence factors, including hyaluronidase. The LacI-GalR family repressors are composed of two functional domains: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal ligand-binding domain, which is homologous to the sugar-binding domain of ABC-type transport systems that contain the type I periplasmic binding protein-like fold. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcription repressor undergoes a conformational change upon ligand binding which in turn changes the DNA b

Probab=95.07 E-value=0.29 Score=27.98 Aligned_cols=105 Identities=16% Similarity=0.238 Sum_probs=64.7 Q ss_pred HHHHHHHHCCCCC-CEEEECCCCCCHHHHHHHHHHHH-CCCCCCEEEEECCCCHHHHHHHHHHHHHHHHHCCCCCCEEEE Q ss_conf 9999999658996-24884278889899999999986-199865899963586132899999999999972999879997 Q gi|254781049|r 281 ATMDIIKLYGGAP-ANFLDVGGGADQDKVAAAFKIIT-SDSSVKGILINIFGGIMRCDVLVKGILSAVKEVKINIPLVMR 358 (398) Q Consensus 281 atmD~i~~~Gg~p-ANFlD~gG~a~~e~~~~a~~~il-~~~~vk~iliNifGGI~~cd~vA~gii~a~~~~~~~~pivvR 358 (398) T Consensus 138 g~~~a~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~l~~~~~~~aii-------~~~D~~A~g~~~~l~~~g~~vP~dis 209 (267) T cd06283 138 GFKEALAEHGIGVNEELIEI-DDEDADELDERLRQLLNKPKKKTAIF-------AANGLILLEVLKALKELGIRIPEDVG 209 (267) T ss_pred HHHHHHHHCCCCCCCEEEEE-CCCCHHHHHHHHHHHHHCCCCCCEEC-------CCCCHHHHHHHHHHHHCCCCCCCCCE T ss_conf 99999997599765148983-35426779999999984799986420-------37709999999999982998898766 Q ss_pred CCCCCHHHHHHHHHHCCCCEEEECCHHHHHHHHHHHH Q ss_conf 4898589999999976995899499899999999985 Q gi|254781049|r 359 LEGANVDIGNRLIAESGLNVITAIDLDDAAQKIVHAV 395 (398) Q Consensus 359 l~Gtn~~~g~~il~~~g~~~~~~~~~~~A~~~~v~~~ 395 (398) T Consensus 210 Vvg~dd~~~~~~~-~p~lTt-v~~~~~~~g~~av~~l 244 (267) T cd06283 210 LIGFDDTEWAELI-GPGITT-IAQPTYEMGKTAAELL 244 (267) T ss_pred EEEECCHHHHHHC-CCCCEE-EECCHHHHHHHHHHHH T ss_conf 8853886999842-999539-9839999999999999

HHsearch alignment for GI: 254781049 and conserved domain: cd06283