HHsearch results for GI: 254781049 and protein with PDBid: 1e4e_A

>1e4e_A Vancomycin/teicoplanin A-type resistance protein VANA; ligase, cell WALL, antibiotic resistance, membrane, plasmid; HET: ADP PHY; 2.5A {Enterococcus faecium} SCOP: c.30.1.2 d.142.1.1 PDB: 1e4e_B*
Probab=98.71  E-value=4.4e-07  Score=64.92  Aligned_cols=169  Identities=17%  Similarity=0.178  Sum_probs=100.7

Q ss_pred             HHHHHHHHHHCCCCCCCCEEECCHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCEEEEECCHHHHHHHHH
Q ss_conf             79999999986898888157479999999998729986999712136876565655677777770799589999999999
Q gi|254781049|r    5 EYQAKALLRKYNVPVAKGVVISSVHAAESAIKTLPGPLYVVKSQIHAGGRGKGRFKELPADSKGGVRVESSLKSVISDIR   84 (398)
Q Consensus         5 EyqaK~lL~~~GIpvp~g~~a~s~~ea~~~a~~ig~p~~VvKaQV~aGgRGKa~~~~~hk~~~GGV~l~~s~~ea~~~a~   84 (398)
                      =+..|++|+++|||+|++.+....+..  ...++++|+ |||+--  ||            ..-||..+++.++..++.+
T Consensus       133 K~~~k~il~~~gI~tp~~~~~~~~~~~--~~~~~~~P~-vVKP~~--~g------------sS~Gv~~v~~~~el~~~~~  195 (343)
T 1e4e_A          133 KSLTYIVAKNAGIATPAFWVINKDDRP--VAATFTYPV-FVKPAR--SG------------SSFGVKKVNSADELDYAIE  195 (343)
T ss_dssp             HHHHHHHHHHTTCBCCCEEEECTTCCC--CGGGSCSCE-EEEESS--CC------------TTTTCEEECSGGGHHHHHH
T ss_pred             CHHHHHHHHHCCCCCCCHHCCCCHHHH--HHHHCCCCE-EEEECC--CC------------CCCCCCCCCCHHHHHHHHH
T ss_conf             066688999809998702001214288--887538985-788667--77------------7778652465788899999


Q ss_pred             HHCCCCCCCCCCCCCCCCCCCEEECCCCCCCEEEEEEEEEECCCCCE---EEEEECCCCCCHHHHHHHCHHHHE--EEEC
Q ss_conf             86187654421222224433011034555650589999983477804---899844788402455574831220--3321
Q gi|254781049|r   85 EILGSTLITKQTGPTGSRVNCVYVEDGADILRELYLSLLVDRTSGMV---AFIASTQGGMDIEEVAKDYPQKIF--KLLI  159 (398)
Q Consensus        85 ~ilg~~l~t~qt~~~G~~v~~vLVEe~v~~~~E~ylgi~~Dr~~~~~---vii~S~~GGvdIE~va~~~p~~I~--~~~i  159 (398)
                      +.+..             -+.+||||+++ ++|+-+++..+...-.+   .-+....+--+....  ..+....  ...+
T Consensus       196 ~~~~~-------------~~~vlvEefI~-G~E~~v~vl~~~~~~~~~~i~ei~~~~~~~~~~~~--~~~~~~~~~~~~~  259 (343)
T 1e4e_A          196 SARQY-------------DSKILIEQAVS-GCEVGCAVLGNSAALVVGEVDQIRLQYGIFRIHQE--VEPEKGSENAVIT  259 (343)
T ss_dssp             HHTTT-------------CSSEEEEECCC-SEEEEEEEEEETTCCEECCCEEEEESSSCCCGGGS--SSGGGCCSSEEEC
T ss_pred             HHHHH-------------HHHHHHHHCCC-CEEEEEEEECCCCCEEEEECCCCCCCCCCCEEHHH--CCCCCCCCCCEEC
T ss_conf             99863-------------24667874468-74999999658884067611331345664200111--0233577761111


Q ss_pred             CCCCCCCHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCEEEECCCCCEEEEEE
Q ss_conf             44457895788878875198889988599999999899995597510232679905996799400
Q gi|254781049|r  160 DPLIGVTSEDVASLCDMLELQGQARIDGGDLFPNLYKAFCDKDMSLLEINPLIIMKNGRLRVLDS  224 (398)
Q Consensus       160 d~~~gl~~~~~~~l~~~lg~~~~~~~~~~~ii~~L~~~f~e~Da~liEINPLvvt~dg~vvAlDA  224 (398)
                      .|               ..++....+.+.++..+.++++--.+..-+|+   .++++|+++.++.
T Consensus       260 ~P---------------a~~~~~~~~~i~~~A~k~~~~lg~~g~~RvDf---~~d~~g~~yvlEv  306 (343)
T 1e4e_A          260 VP---------------ADLSAEERGRIQETVKKIYKTLGCRGLARVDM---FLQDNGRIVLNEV  306 (343)
T ss_dssp             SS---------------CSSCHHHHHHHHHHHHHHHHHTTCEEEEEEEE---EECTTCCEEEEEE
T ss_pred             CC---------------CCCHHHHHHHHHHHHHHHHHHHCCCEEEEEEE---EEECCCCEEEEEE
T ss_conf             44---------------32348999999999999999839950799899---9948992999985