>cd07019 S49_SppA_1 Signal peptide peptidase A (SppA), a serine protease, has catalytic Ser-Lys dyad. Signal peptide peptidase A (SppA; Peptidase S49; Protease IV): SppAs in this subfamily are found in all three domains of life and are involved in the cleavage of signal peptides after their removal from the precursor proteins by signal peptidases. Site-directed mutagenesis and sequence analysis have shown these bacterial, archaeal and thylakoid SppAs to be serine proteases. The predicted active site serine for members in this family occurs in a transmembrane domain. Mutagenesis studies also suggest that the catalytic center comprises a Ser-Lys dyad (both residues absolutely conserved within bacteria, chloroplast and mitochondrial signal peptidase family members) and not the usual Ser-His-Asp catalytic triad found in the majority of serine proteases. In addition to the carboxyl-terminal protease domain that is conserved in all the S49 family members, the E. coli SppA contains an amino-te

Probab=96.76 E-value=0.0059 Score=39.17 Aligned_cols=80 Identities=24% Similarity=0.293 Sum_probs=49.6 Q ss_pred CEEEEEECCCHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCHHHHHHHHHCCCCCCEEEEEEE-CCCHHH--HHHHHHHH Q ss_conf 679998054147899999997199516764055674467899999999973998728899970-587248--99999999 Q gi|254781050|r 152 SVGILSRSGTLTYEAVFQTSQEGLGQSTAVGIGGDPVKGTEFIDVLELFLADEATESIVMVGE-IGGSAE--EEAAQFLK 228 (300) Q Consensus 152 ~VgivSqSG~l~~e~~~~~~~~g~G~S~~VsiG~D~~~G~~~~d~L~~~~~Dp~T~~Ivl~gE-iGG~~E--~~aa~fi~ 228 (300) T Consensus 1 ~iaVi~~~G~I~~~---------~~~~~--~~~~~-----~i~~~l~~A~~d~~Vkavvl~InSpGG~~~~s~~i~~~i~ 64 (211) T cd07019 1 SIGVVFANGAIVDG---------EETQG--NVGGD-----TTAAQIRDARLDPKVKAIVLRVNSPGGSVTASEVIRAELA 64 (211) T ss_pred CEEEEEEEEEECCC---------CCCCC--CCCHH-----HHHHHHHHHHHCCCCCEEEEEEECCCCCHHHHHHHHHHHH T ss_conf 98999988788379---------88788--75899-----9999999995289973899997696976899999999999 Q ss_pred HHHHCCCCCCEEEEEEEECCC Q ss_conf 864226755268998430157 Q gi|254781050|r 229 DEAKRGRKKPIVGFVAGKTAP 249 (300) Q Consensus 229 ~~~~~~~~KPVva~~~GrtAp 249 (300) T Consensus 65 ~~~--~~~KPVva~~~~~aaS 83 (211) T cd07019 65 AAR--AAGKPVVVSAGGAAAS 83 (211) T ss_pred HHH--HCCCCEEEEECCCCCH T ss_conf 986--4699799997784434

HHsearch alignment for GI: 254781050 and conserved domain: cd07019