HHsearch results for GI: 254781050 and protein with PDBid: 1mb4_A

>1mb4_A Aspartate-semialdehyde dehydrogenase; enzyme, complex, oxidoreductase; HET: NDP; 1.84A {Vibrio cholerae} SCOP: c.2.1.3 d.81.1.1 PDB: 1mc4_A
Probab=90.56  E-value=0.89  Score=23.87  Aligned_cols=120  Identities=12%  Similarity=0.072  Sum_probs=76.5

Q ss_pred             EEEEECCCCHHHHHHHHHHHH---HCCCCEEEEECCCCCCEEECCCCCCCCCCCCHH-HHCCCCCCCEEEEECCHHHHHH
Q ss_conf             399988884377999999986---269818997658998868727745775314078-5035788636886212045678
Q gi|254781050|r   10 KVLVQGLTGKAGTFHTEQAIL---YCQTQVVGGIHPKKGSTYWTGGNVNVPVFTTVA-EAKERTAANASVIYVPPSGAGD   85 (300)
Q Consensus        10 ~vivqGitg~~g~~~~~~~~~---y~gt~ivagV~Pgkgg~~~~g~~~~iPvy~sv~-ea~~~~~~D~avI~VP~~~v~d   85 (300)
                      ||-|-|.||--|.--.+..++   .---++++-.+....|+...-.....++++... |..+  ++|+...++|.....+
T Consensus         2 kVaIvGAtGy~G~elirlL~~h~~hp~~el~~~~s~~~aG~~~~~~~~~~~~~~~~~~~~~~--~vDvvF~Alph~~s~~   79 (370)
T 1mb4_A            2 RVGLVGWRGMVGSVLMQRMVEERDFDLIEPVFFSTSQIGVPAPNFGKDAGMLHDAFDIESLK--QLDAVITCQGGSYTEK   79 (370)
T ss_dssp             EEEEESCSSHHHHHHHHHHHHTTGGGGSEEEEEESSCCSSBCCCSSSCCCBCEETTCHHHHT--TCSEEEECSCHHHHHH
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCCCEECCCCCCCCCCCCCHHHHC--CCCEEEECCCCCHHHH
T ss_conf             79999972099999999998557989507999985455897625587200110247842750--5999999999841545


Q ss_pred             HHHHHHHCCCCEEEE-ECCCC----------CHHHHHHHHHHHHCCCCEEEECCCCE
Q ss_conf             899998539958998-05884----------68889999998401771894068510
Q gi|254781050|r   86 AIIESIEAEIPLIVC-ITEGI----------PVLDMVRVKARLEKSSSRLIGPNCPG  131 (300)
Q Consensus        86 ai~Ea~~agik~ivi-iteGi----------p~~d~~~l~~~A~~~g~riiGPNc~G  131 (300)
                      .+.+..++|.+.+|| .+..+          |+....++.+...+..-.+-.|||--
T Consensus        80 ~~~~~~~~g~~~~ViDls~dfR~~~~~~~~~~~~~~~e~~~~~~~~~~~IanPgC~~  136 (370)
T 1mb4_A           80 VYPALRQAGWKGYWIDAASTLRMDKEAIITLDPVNLKQILHGIHHGTKTFVGGNCTV  136 (370)
T ss_dssp             HHHHHHHTTCCSEEEESSSTTTTCTTEEEECHHHHHHHHHHHHHTTCCEEEECCHHH
T ss_pred             HHHHHHHCCCEEEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCCCCCHH
T ss_conf             402456348618999685012554433435776445554233204755201688628