BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254781050|ref|YP_003065463.1| succinyl-CoA synthetase
subunit alpha [Candidatus Liberibacter asiaticus str. psy62]
         (300 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|254781050|ref|YP_003065463.1| succinyl-CoA synthetase subunit alpha [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040727|gb|ACT57523.1| succinyl-CoA synthetase subunit alpha [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 300

 Score =  358 bits (918), Expect = 7e-97,   Method: Composition-based stats.
 Identities = 300/300 (100%), Positives = 300/300 (100%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT
Sbjct: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS
Sbjct: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
           SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA
Sbjct: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV
Sbjct: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGSL 300
           GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGSL
Sbjct: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGSL 300


>gi|114764883|ref|ZP_01444065.1| Succinyl-CoA synthetase, alpha subunit [Pelagibaca bermudensis
           HTCC2601]
 gi|114542769|gb|EAU45792.1| Succinyl-CoA synthetase, alpha subunit [Roseovarius sp. HTCC2601]
          Length = 294

 Score =  357 bits (917), Expect = 1e-96,   Method: Composition-based stats.
 Identities = 194/299 (64%), Positives = 242/299 (80%), Gaps = 5/299 (1%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           M++LVD+NTKV+ QG TG  GTFH+EQAI Y  T++VGG+ P KG     G    +PVF 
Sbjct: 1   MAVLVDENTKVICQGFTGSQGTFHSEQAIAY-GTKMVGGVTPGKGGQEHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           +V EA  +T ANASVIYVPP  A D+I+E+I+AEI LI+CITEGIPVLDM++VK  L  S
Sbjct: 56  SVHEAVHKTEANASVIYVPPPFAADSILEAIDAEIELIICITEGIPVLDMMKVKRALIDS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            SRLIGPNCPG++TPD+CKIGIMPG I ++G VG++SRSGTLTYEAV QT+  GLGQS+A
Sbjct: 116 KSRLIGPNCPGVITPDACKIGIMPGHIHKRGKVGVVSRSGTLTYEAVKQTTDLGLGQSSA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+KGTE IDVL++FL D  TESI+M+GEIGGSAEEEAA+FLK++ K+GR KP  
Sbjct: 176 VGIGGDPIKGTEHIDVLDMFLDDPETESIIMIGEIGGSAEEEAAEFLKEQKKKGRWKPTA 235

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
           GF+AG+TAPPGR MGHAGA+++GGKG AE KI AMK AGI +A SPA +G ++V+ + +
Sbjct: 236 GFIAGRTAPPGRRMGHAGAIVAGGKGDAESKIEAMKSAGIVVADSPATLGEAVVKAMEA 294


>gi|163744280|ref|ZP_02151640.1| succinyl-CoA synthase, alpha subunit [Oceanibulbus indolifex
           HEL-45]
 gi|161381098|gb|EDQ05507.1| succinyl-CoA synthase, alpha subunit [Oceanibulbus indolifex
           HEL-45]
          Length = 295

 Score =  355 bits (912), Expect = 3e-96,   Method: Composition-based stats.
 Identities = 201/299 (67%), Positives = 243/299 (81%), Gaps = 5/299 (1%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           M++LV++NTKV+ QGLTG  GTFHTEQAI Y  T++VGG+ P KG        +++PVF 
Sbjct: 1   MAVLVNENTKVICQGLTGSQGTFHTEQAIAY-GTKMVGGVTPGKGGQTH----LDLPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           +V EAK  T ANASVIYVPP  A D+I+E+I+AE+ LIVCITEGIPVLDM RV   L+ S
Sbjct: 56  SVHEAKHVTEANASVIYVPPPFAADSILEAIDAEMELIVCITEGIPVLDMARVARALQGS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            SRLIGPNCPG++TPD+CKIGIMPG I R+GSVG++SRSGTLTYEAV QT+  GLGQS+A
Sbjct: 116 KSRLIGPNCPGVITPDACKIGIMPGHIHRRGSVGVVSRSGTLTYEAVKQTTDMGLGQSSA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+KGTE IDVLE+FLAD  T+SI+M+GEIGGSAEEEAAQFL DE K+GR KP  
Sbjct: 176 VGIGGDPIKGTEHIDVLEMFLADPETQSIIMIGEIGGSAEEEAAQFLADEKKKGRWKPTA 235

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
           GF+AG+TAPPGR MGHAGA+++GGKG AE KI AMKEAGI +A SPA +G ++ E +  
Sbjct: 236 GFIAGRTAPPGRRMGHAGAIVAGGKGDAESKIEAMKEAGIVVADSPATLGEAVKEAIDK 294


>gi|77464546|ref|YP_354050.1| succinyl-CoA synthetase (ADP-forming) alpha subunit [Rhodobacter
           sphaeroides 2.4.1]
 gi|126463386|ref|YP_001044500.1| succinyl-CoA synthetase, alpha subunit [Rhodobacter sphaeroides
           ATCC 17029]
 gi|221640457|ref|YP_002526719.1| 2-oxoglutarate dehydrogenase E1 component [Rhodobacter sphaeroides
           KD131]
 gi|332559439|ref|ZP_08413761.1| succinyl-CoA synthetase, alpha subunit [Rhodobacter sphaeroides
           WS8N]
 gi|77388964|gb|ABA80149.1| succinyl-CoA synthetase (ADP-forming) alpha subunit [Rhodobacter
           sphaeroides 2.4.1]
 gi|126105050|gb|ABN77728.1| succinyl-CoA synthetase (ADP-forming) alpha subunit [Rhodobacter
           sphaeroides ATCC 17029]
 gi|221161238|gb|ACM02218.1| 2-oxoglutarate dehydrogenase E1 component [Rhodobacter sphaeroides
           KD131]
 gi|332277151|gb|EGJ22466.1| succinyl-CoA synthetase, alpha subunit [Rhodobacter sphaeroides
           WS8N]
          Length = 294

 Score =  355 bits (911), Expect = 5e-96,   Method: Composition-based stats.
 Identities = 203/299 (67%), Positives = 247/299 (82%), Gaps = 5/299 (1%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           M++LV++NTKV+ QG+TG  GTFHTEQAI Y  T++VGG+ P KG +   G    +PVF 
Sbjct: 1   MAVLVNENTKVICQGITGSQGTFHTEQAIAY-GTKMVGGVTPGKGGSEHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           +V EA+E T ANASVIYVPP  A D+I+E+I+AE+ LIVCITEGIPVLDM++VK  L+ S
Sbjct: 56  SVYEAREVTGANASVIYVPPPFAADSILEAIDAEMELIVCITEGIPVLDMMKVKRALQGS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
           SSRLIGPNCPG++TP +CKIGIMPG I ++GSVG++SRSGTLTYEAV QTS  GLGQS+A
Sbjct: 116 SSRLIGPNCPGVITPGACKIGIMPGHIHKRGSVGVVSRSGTLTYEAVKQTSDLGLGQSSA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+KGTE IDVLE+FLAD  T+SI+M+GEIGGSAEEEAAQFL DE KRGR KP  
Sbjct: 176 VGIGGDPIKGTEHIDVLEMFLADPETQSIIMIGEIGGSAEEEAAQFLADEKKRGRWKPTA 235

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
           GF+AG+TAPPGR MGHAGA++SGGKG AE KI AMK AGI +A SPA +G ++++ LG 
Sbjct: 236 GFIAGRTAPPGRRMGHAGAIVSGGKGDAESKIEAMKSAGIVVADSPAHLGEAVMQALGK 294


>gi|146276135|ref|YP_001166294.1| succinyl-CoA synthetase, alpha subunit [Rhodobacter sphaeroides
           ATCC 17025]
 gi|145554376|gb|ABP68989.1| succinyl-CoA synthetase (ADP-forming) alpha subunit [Rhodobacter
           sphaeroides ATCC 17025]
          Length = 294

 Score =  354 bits (909), Expect = 7e-96,   Method: Composition-based stats.
 Identities = 201/299 (67%), Positives = 245/299 (81%), Gaps = 5/299 (1%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           M++LV++NTKV+ QG+TG  GTFHTEQAI Y  T++VGG+ P KG +   G    +PVF 
Sbjct: 1   MAVLVNENTKVICQGITGSQGTFHTEQAIAY-GTKMVGGVTPGKGGSEHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           +V EA++ T ANASVIYVPP  A D+I+E+I+AE+ LIVCITEGIPVLDM++VK  LE S
Sbjct: 56  SVFEARDVTGANASVIYVPPPFAADSILEAIDAEMELIVCITEGIPVLDMMKVKRALEGS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            SRLIGPNCPG++TP +CKIGIMPG I ++GSVG++SRSGTLTYEAV QT+  GLGQS+A
Sbjct: 116 KSRLIGPNCPGVITPGACKIGIMPGHIHKRGSVGVVSRSGTLTYEAVKQTTDLGLGQSSA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+KGTE IDVLE+FLAD  T SI+M+GEIGGSAEEEAAQFL DE KRGR KP  
Sbjct: 176 VGIGGDPIKGTEHIDVLEMFLADPETTSIIMIGEIGGSAEEEAAQFLADEKKRGRWKPTA 235

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
           GF+AG+TAPPGR MGHAGA++SGGKG AE KI AMK AGI +A SPA +G ++++ LG 
Sbjct: 236 GFIAGRTAPPGRRMGHAGAIVSGGKGDAESKIEAMKSAGIVVADSPAHLGEAVMQALGK 294


>gi|297183588|gb|ADI19715.1| hypothetical protein [uncultured bacterium EB000_36F02]
          Length = 291

 Score =  354 bits (909), Expect = 8e-96,   Method: Composition-based stats.
 Identities = 195/299 (65%), Positives = 239/299 (79%), Gaps = 8/299 (2%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+LV+KNTK++ QG TG  GTFH+EQAI Y  T + GG+ PKKG        ++ PVF 
Sbjct: 1   MSVLVNKNTKLICQGFTGSHGTFHSEQAIKY-GTNLAGGVTPKKGGQKH----LDRPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EAK+ T ANAS+IYVP   A  AIIE+I++EI LIVCITEGIPVLDM++VK +L +S
Sbjct: 56  TVEEAKKETGANASMIYVPAKFAASAIIEAIDSEIELIVCITEGIPVLDMLKVKKKLSES 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            SRLIGPNCPGI+TP+ CK+GIMPG I +KGSVGI+SRSGTLTYEAV QT++ GLGQST 
Sbjct: 116 KSRLIGPNCPGIITPEECKVGIMPGKIHKKGSVGIVSRSGTLTYEAVAQTTETGLGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           +GIGGDP+ GT FID L+LFL DE TESI+M+GEIGG+AEEEAA+F+K+      KKP+V
Sbjct: 176 IGIGGDPINGTNFIDCLDLFLNDEETESILMIGEIGGTAEEEAAEFVKNH---KIKKPVV 232

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
           GF+AG TAPPGR MGHAGA+ISGGKGGA+DKI  M+E GI IA SP+ IG++L+  L +
Sbjct: 233 GFIAGITAPPGRRMGHAGAIISGGKGGAKDKIKKMEECGIIIAQSPSEIGKTLLNKLSN 291


>gi|296282622|ref|ZP_06860620.1| succinyl-CoA synthetase, alpha subunit [Citromicrobium
           bathyomarinum JL354]
          Length = 296

 Score =  354 bits (908), Expect = 1e-95,   Method: Composition-based stats.
 Identities = 207/299 (69%), Positives = 242/299 (80%), Gaps = 5/299 (1%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSILV+K+TKV+ QG+TG  GTFHT+QA+ Y  TQ+V G+ P KG T   G    +P F 
Sbjct: 1   MSILVNKDTKVITQGMTGNTGTFHTQQALDY-GTQMVAGVTPGKGGTDHIG----LPQFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EAKE T A AS IYVPP  A DAI E+I+AEI LIVCITEGIPVLDMVR KA LE S
Sbjct: 56  TVKEAKEATGATASCIYVPPPFAADAICEAIDAEIELIVCITEGIPVLDMVRAKAALEGS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            SRLIGPNCPG+LTP+ CKIGIMPGSIF+KGSVG++SRSGTLTYEAV QT+  GLGQ+TA
Sbjct: 116 KSRLIGPNCPGVLTPNECKIGIMPGSIFKKGSVGVVSRSGTLTYEAVHQTTNAGLGQTTA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPV GT FIDVL+LFL D  TES++M+GEIGGSAEEEAAQFL ++ K+GR KP V
Sbjct: 176 VGIGGDPVNGTNFIDVLDLFLDDPETESMIMIGEIGGSAEEEAAQFLAEQKKKGRWKPTV 235

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
           GF+AG+TAPPGR MGHAGA++SGG+GGAEDKI AM+ AGI +A SP+ +G +L  LL  
Sbjct: 236 GFIAGRTAPPGRRMGHAGAIVSGGQGGAEDKIAAMEAAGIRVAQSPSELGTTLAALLKE 294


>gi|327188906|gb|EGE56098.1| succinyl-CoA synthetase protein, alpha subunit [Rhizobium etli
           CNPAF512]
          Length = 343

 Score =  353 bits (907), Expect = 1e-95,   Method: Composition-based stats.
 Identities = 233/299 (77%), Positives = 269/299 (89%), Gaps = 1/299 (0%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVN-VPVF 59
           MSILV+K+TKVLVQGLTGK GTFHTEQA+ Y  TQ+VGGIHPKKG   WTG     +P+F
Sbjct: 44  MSILVNKDTKVLVQGLTGKTGTFHTEQALAYYGTQMVGGIHPKKGGETWTGAKCESLPIF 103

Query: 60  TTVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEK 119
            TVAE KE+T A+A+VIYVPP+GA DAIIE+I+AEIP I CITEGIPV+DMVRVKARL++
Sbjct: 104 ATVAEGKEKTGADATVIYVPPAGAADAIIEAIDAEIPFITCITEGIPVMDMVRVKARLDR 163

Query: 120 SSSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQST 179
           S SRL+GPNCPGILTP+ CKIGIMPGSIFRKGSVGI+SRSGTLTYEAVFQTS EGLGQ+T
Sbjct: 164 SKSRLLGPNCPGILTPEECKIGIMPGSIFRKGSVGIVSRSGTLTYEAVFQTSNEGLGQTT 223

Query: 180 AVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPI 239
           AVGIGGDPVKGTEFIDVLE+FLAD+AT SI+M+GEIGGSAEE+AAQFLKDEAK+GRKKP+
Sbjct: 224 AVGIGGDPVKGTEFIDVLEMFLADDATTSIIMIGEIGGSAEEDAAQFLKDEAKKGRKKPM 283

Query: 240 VGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            GF+AG+TAP GRTMGHAGAV+SGGKG AE KI AM+ AGI ++PSPAR+G++LVE+L 
Sbjct: 284 AGFIAGRTAPKGRTMGHAGAVVSGGKGDAESKIAAMESAGIKVSPSPARLGKTLVEVLK 342


>gi|319790380|ref|YP_004152013.1| succinyl-CoA synthetase, alpha subunit [Thermovibrio ammonificans
           HB-1]
 gi|317114882|gb|ADU97372.1| succinyl-CoA synthetase, alpha subunit [Thermovibrio ammonificans
           HB-1]
          Length = 300

 Score =  353 bits (907), Expect = 1e-95,   Method: Composition-based stats.
 Identities = 172/301 (57%), Positives = 224/301 (74%), Gaps = 7/301 (2%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGN--VNVPV 58
           MS+L+DKNTKV+VQGLTGK G+FH +Q + Y  TQ+V G+ P KG   WT       VPV
Sbjct: 1   MSVLIDKNTKVVVQGLTGKEGSFHAKQCLDY-GTQIVAGVTPGKGGMTWTDDEGKYKVPV 59

Query: 59  FTTVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLE 118
           F TV EA + T ANAS+I+VPP+ A DAI+E+ +A I LIVCITEGIPV DMV+VK  LE
Sbjct: 60  FNTVEEAVKETGANASLIFVPPAFAADAIMEAADAGIKLIVCITEGIPVNDMVKVKRALE 119

Query: 119 KSSSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQS 178
            +  R +GPNCPG++TP+ CK+GIMPG IF+KG VGI+SRSGTLTYEA +Q +  G+GQS
Sbjct: 120 GTGVRYVGPNCPGVITPEECKMGIMPGHIFKKGRVGIVSRSGTLTYEAAYQLTSRGIGQS 179

Query: 179 TAVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKP 238
           T +GIGGDPV GT   + +E+F  D  T++IV++GEIGG+ EEEAA+++K+      KKP
Sbjct: 180 TVIGIGGDPVPGTTHREAVEMFNNDPETDAIVLIGEIGGTMEEEAAEYIKEH----VKKP 235

Query: 239 IVGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           +V ++AG TAPPGR MGHAGA+ISGGKG A+ K+ A++EAG  +  +PA IG  + + L 
Sbjct: 236 VVAYIAGVTAPPGRRMGHAGAIISGGKGDAKSKMEALREAGAYVCNTPAEIGEMVEKALK 295

Query: 299 S 299
            
Sbjct: 296 E 296


>gi|119476710|ref|ZP_01617020.1| succinyl-CoA synthetase alpha subunit [marine gamma proteobacterium
           HTCC2143]
 gi|119449966|gb|EAW31202.1| succinyl-CoA synthetase alpha subunit [marine gamma proteobacterium
           HTCC2143]
          Length = 291

 Score =  353 bits (907), Expect = 1e-95,   Method: Composition-based stats.
 Identities = 176/298 (59%), Positives = 217/298 (72%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL+DKNTKV+ QG TG  GTFH+EQAI Y  T++VGG+ P KG     G    +PVF 
Sbjct: 1   MSILIDKNTKVICQGFTGSQGTFHSEQAIAY-GTKMVGGVTPGKGGQEHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV+EA E T A+ASVIYVP     D+I+E+  + I LIVCITEGIP LDM+  K R ++ 
Sbjct: 56  TVSEAVEATGADASVIYVPAPFCKDSILEAANSGIKLIVCITEGIPTLDMLDCKVRCDQL 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             RLIGPNCPG++TP  CKIGIMPG I   G VGI+SRSGTLTYEAV QT+  G GQST 
Sbjct: 116 GVRLIGPNCPGVITPGECKIGIMPGHIHLPGRVGIVSRSGTLTYEAVKQTTDAGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+LE+F  D ATE+IVM+GEIGG+AEEEAA ++K        KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILEMFQNDPATEAIVMIGEIGGTAEEEAAAYIKAN----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            ++AG TAP G+ MGHAGA+ISGGKG A++K  A+++AG+    S A IG +L EL G
Sbjct: 232 SYIAGVTAPAGKRMGHAGAIISGGKGTADEKFAALQDAGVKTVRSLAEIGDALSELTG 289


>gi|85058857|ref|YP_454559.1| succinyl-CoA synthetase subunit alpha [Sodalis glossinidius str.
           'morsitans']
 gi|84779377|dbj|BAE74154.1| succinyl-CoA synthase alpha subunit [Sodalis glossinidius str.
           'morsitans']
          Length = 290

 Score =  353 bits (906), Expect = 2e-95,   Method: Composition-based stats.
 Identities = 177/299 (59%), Positives = 224/299 (74%), Gaps = 9/299 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL+DKNTKV+ QG TG  GTFH+EQA+ Y  TQ+VGG+ P KG T   G    +PVF 
Sbjct: 1   MSILIDKNTKVICQGFTGSQGTFHSEQALAY-GTQMVGGVTPGKGGTEHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA ++T A ASVIYVP     D+I+E+I+A I LI+CITEGIP LDM+ VKA+LE+S
Sbjct: 56  TVREAVDKTGATASVIYVPAPFCKDSILEAIDAGIELIICITEGIPTLDMLTVKAKLEQS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            +R+IGPNCPG++TP  CKIGIMPG I + G VGI+SRSGTLTYE V QT+  GLGQS+ 
Sbjct: 116 KARMIGPNCPGVITPGECKIGIMPGHIHQPGRVGIVSRSGTLTYEVVKQTTDTGLGQSSC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L+LF  D  TE+IVM+GEIGGSAEEEAA ++KD       KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILKLFEEDPQTEAIVMIGEIGGSAEEEAAAYIKDH----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
           G++AG TAP G+ MGHAGA+I+G KG A++K  A++ AG+    S A IG +L  +L +
Sbjct: 232 GYIAGVTAPKGKRMGHAGAIIAGSKGTADEKFAALEAAGVKTVRSLADIGEALKFILPN 290


>gi|149201197|ref|ZP_01878172.1| succinyl-CoA synthase, alpha subunit [Roseovarius sp. TM1035]
 gi|149202192|ref|ZP_01879165.1| succinyl-CoA synthase, alpha subunit [Roseovarius sp. TM1035]
 gi|149144290|gb|EDM32321.1| succinyl-CoA synthase, alpha subunit [Roseovarius sp. TM1035]
 gi|149145530|gb|EDM33556.1| succinyl-CoA synthase, alpha subunit [Roseovarius sp. TM1035]
          Length = 293

 Score =  353 bits (906), Expect = 2e-95,   Method: Composition-based stats.
 Identities = 209/298 (70%), Positives = 250/298 (83%), Gaps = 5/298 (1%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           M++LVDK+T+V+ QGLTG  GTFH+EQAI Y  TQ+VGG+ P KG T      +++PVF 
Sbjct: 1   MAVLVDKHTRVICQGLTGSQGTFHSEQAIAY-GTQMVGGVTPGKGGTTH----LDLPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           +V EAK  T ANASVIYVPP  A D+I+E+I+AE+ LIVCITEGIPVLDM+RVK  LE S
Sbjct: 56  SVHEAKHVTEANASVIYVPPPFAADSILEAIDAEMELIVCITEGIPVLDMMRVKRALEGS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            SRLIGPNCPGI+TPD+CKIGIMPG I R+GSVG++SRSGTLTYEAV QTS  GLGQST 
Sbjct: 116 KSRLIGPNCPGIITPDACKIGIMPGHIHRRGSVGVVSRSGTLTYEAVKQTSDVGLGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+KGTE IDVLE FLAD+ T+SI+M+GEIGGSAEEEAAQFLKDEAKRGRKKP+ 
Sbjct: 176 VGIGGDPIKGTEHIDVLEWFLADDETQSIIMIGEIGGSAEEEAAQFLKDEAKRGRKKPVA 235

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           GF+AG+TAPPGR MGHAGA+++GGKG AE KI AMK AGI +A SPA +G ++++ +G
Sbjct: 236 GFIAGRTAPPGRRMGHAGAIVAGGKGDAESKIEAMKSAGITVAESPAGLGEAVLKAIG 293


>gi|87199203|ref|YP_496460.1| succinyl-CoA synthetase (ADP-forming) alpha subunit
           [Novosphingobium aromaticivorans DSM 12444]
 gi|87134884|gb|ABD25626.1| succinyl-CoA synthetase (ADP-forming) alpha subunit
           [Novosphingobium aromaticivorans DSM 12444]
          Length = 296

 Score =  353 bits (906), Expect = 2e-95,   Method: Composition-based stats.
 Identities = 218/299 (72%), Positives = 253/299 (84%), Gaps = 5/299 (1%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSILVDKNTKV+ QG+TG  GTFHTEQA+ Y  TQ+VGG+ P KG T   G    +P F 
Sbjct: 1   MSILVDKNTKVITQGMTGATGTFHTEQALAY-GTQMVGGVTPGKGGTTHIG----LPNFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TVAEAK  T A AS IYVPP  A D+I+E+I+AE+ LIVCITEGIPVLDMV+VK  L  S
Sbjct: 56  TVAEAKAATGATASCIYVPPPFAADSILEAIDAEMELIVCITEGIPVLDMVKVKRALSGS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            SRLIGPNCPG+LTP+ CKIGIMPGSIF+KGSVG++SRSGTLTYEAVFQTS  GLGQ+TA
Sbjct: 116 KSRLIGPNCPGVLTPNECKIGIMPGSIFKKGSVGVVSRSGTLTYEAVFQTSNIGLGQTTA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPV GT FIDVLELFLAD+ T+SI+M+GEIGGSAEEEAAQFLKDEAKRGRKKP+V
Sbjct: 176 VGIGGDPVNGTNFIDVLELFLADDETKSIIMIGEIGGSAEEEAAQFLKDEAKRGRKKPMV 235

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
           GF+AG+TAPPGR MGHAGA++SGG+GGAEDKI AM+EAGI ++PSP+ +G +L E+L  
Sbjct: 236 GFIAGRTAPPGRRMGHAGAIVSGGQGGAEDKIAAMEEAGIRVSPSPSLLGETLAEVLKE 294


>gi|88798686|ref|ZP_01114269.1| succinyl-CoA synthetase alpha subunit [Reinekea sp. MED297]
 gi|88778449|gb|EAR09641.1| succinyl-CoA synthetase alpha subunit [Reinekea sp. MED297]
          Length = 290

 Score =  353 bits (905), Expect = 2e-95,   Method: Composition-based stats.
 Identities = 174/298 (58%), Positives = 219/298 (73%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L+DKNTKV+ QG TG  GTFH+EQAI Y  TQ+VGG+ P KG     G    +PVF 
Sbjct: 1   MSVLIDKNTKVICQGFTGSQGTFHSEQAIEY-GTQMVGGVSPGKGGQTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T A A+VIYVP     DAI E+ +A I LIVCITEGIP LDM+  K  +++ 
Sbjct: 56  TVREAVETTGATATVIYVPAPFCKDAICEAADAGIELIVCITEGIPTLDMLEAKEYVDRK 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TP  CKIGIMPG I + G VGI+SRSGTLTYEAV QT+  G GQST 
Sbjct: 116 GVRMIGPNCPGVITPGECKIGIMPGHIHKPGKVGIVSRSGTLTYEAVKQTTDHGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L++F  D +TE+IVM+GEIGG+AEEEAA F+K+       KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILKMFQEDPSTEAIVMIGEIGGTAEEEAAAFIKEN----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            ++AG TAPPG+ MGHAGA+ISGGKG A++K  A+++AG+    S A+IG +L E+ G
Sbjct: 232 SYIAGVTAPPGKRMGHAGAIISGGKGTADEKFAALEDAGVKTVRSLAQIGDALKEVTG 289


>gi|83944437|ref|ZP_00956891.1| Succinyl-CoA synthetase, alpha subunit [Sulfitobacter sp. EE-36]
 gi|83844760|gb|EAP82643.1| Succinyl-CoA synthetase, alpha subunit [Sulfitobacter sp. EE-36]
          Length = 295

 Score =  353 bits (905), Expect = 2e-95,   Method: Composition-based stats.
 Identities = 197/299 (65%), Positives = 244/299 (81%), Gaps = 5/299 (1%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           M++LV++NTKV+ QGLTG  GTFHTEQAI Y  T++VGG+ P KG        +++PVF 
Sbjct: 1   MAVLVNENTKVICQGLTGSQGTFHTEQAIAY-GTKMVGGVTPGKGGQTH----LDLPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           +V EA+  T ANA+VIYVPP  A D+I+E+I+AE+ LI+CITEGIPVLDM+RVK  LE S
Sbjct: 56  SVHEARHVTEANATVIYVPPPFAADSILEAIDAEMELIICITEGIPVLDMMRVKRALEGS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            SRLIGPNCPG++TPD+CKIGIMPG I ++G+ G++SRSGTLTYEAV QTS  GLGQS+A
Sbjct: 116 KSRLIGPNCPGVITPDACKIGIMPGHIHKRGTCGVVSRSGTLTYEAVKQTSDLGLGQSSA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+KG+E ID+LE+FLAD  TESI+M+GEIGGSAEEEAAQFL DE K+GR KP  
Sbjct: 176 VGIGGDPIKGSEHIDILEMFLADPETESIIMIGEIGGSAEEEAAQFLADEKKKGRWKPTA 235

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
           GF+AG+TAPPGR MGHAGA+++GGKG AE KI AMKEAGI +A SPA +G ++ E +  
Sbjct: 236 GFIAGRTAPPGRRMGHAGAIVAGGKGDAESKIAAMKEAGIVVADSPATLGEAVQEAINK 294


>gi|163734165|ref|ZP_02141606.1| succinyl-CoA synthase, alpha subunit [Roseobacter litoralis Och
           149]
 gi|161392701|gb|EDQ17029.1| succinyl-CoA synthase, alpha subunit [Roseobacter litoralis Och
           149]
          Length = 295

 Score =  353 bits (905), Expect = 2e-95,   Method: Composition-based stats.
 Identities = 198/299 (66%), Positives = 246/299 (82%), Gaps = 5/299 (1%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           M++L+D+NTKV+ QGLTG  GTFH+EQAI Y  T++VGG+ P KG        +++PVF 
Sbjct: 1   MAVLIDENTKVICQGLTGSQGTFHSEQAIAY-GTKMVGGVTPGKGGQTH----LDLPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           +V EAK  T ANASVIYVPP  A D+I+E+I+AE+ LIVCITEGIPVLDM++V+  LE S
Sbjct: 56  SVHEAKHATEANASVIYVPPPFAADSILEAIDAEMELIVCITEGIPVLDMMKVQRALEGS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            SRLIGPNCPG++TPD+CKIGIMPG I ++GS G++SRSGTLTYEAV QT+  GLGQSTA
Sbjct: 116 KSRLIGPNCPGVITPDACKIGIMPGHIHKRGSCGVVSRSGTLTYEAVKQTTDLGLGQSTA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+KGTE IDVLE+FLAD  T+SI+M+GEIGGSAEE+AAQFL DE K+GR KP  
Sbjct: 176 VGIGGDPIKGTEHIDVLEMFLADPETQSIIMIGEIGGSAEEDAAQFLADEKKKGRWKPTA 235

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
           GF+AG+TAPPGR MGHAGA+++GGKGGAEDKI+AM+ AGI +A SPA +G ++ E +  
Sbjct: 236 GFIAGRTAPPGRRMGHAGAIVAGGKGGAEDKIDAMRAAGIVVADSPATLGEAVQEAIAK 294


>gi|239947281|ref|ZP_04699034.1| succinyl-CoA ligase [ADP-forming] subunit alpha [Rickettsia
           endosymbiont of Ixodes scapularis]
 gi|239921557|gb|EER21581.1| succinyl-CoA ligase [ADP-forming] subunit alpha [Rickettsia
           endosymbiont of Ixodes scapularis]
          Length = 292

 Score =  353 bits (905), Expect = 2e-95,   Method: Composition-based stats.
 Identities = 181/299 (60%), Positives = 234/299 (78%), Gaps = 8/299 (2%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           M+IL++K TKV+ QG TG  GTFH+EQAI Y  T +VGG+ P KG        +++PV+ 
Sbjct: 1   MAILINKKTKVICQGFTGSQGTFHSEQAIAY-GTNMVGGVTPGKGGHTH----LDLPVYN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EAK +T ANASVIYVPP  A D+I+E+I+AEI ++VCITEGIPVLDMV+VK  L  S
Sbjct: 56  TVHEAKAKTGANASVIYVPPGFAADSILEAIDAEIEVVVCITEGIPVLDMVKVKRALVGS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            +RLIGPNCPG++TP  CKIGIMPG I ++G++GI+SRSGTLTYEAV QT+  GLGQST 
Sbjct: 116 KTRLIGPNCPGVITPGECKIGIMPGHIHKRGTIGIVSRSGTLTYEAVAQTTAVGLGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPV  T F+D +E+FL D+ T++I+M+GEIGG+AEE+AA+F+K       KKPIV
Sbjct: 176 VGIGGDPVNDTNFVDCIEMFLKDDETKAIIMIGEIGGNAEEDAAEFIKQ---SKIKKPIV 232

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
            F+AG TAPPG+ MGHAGA+I+GGKG AEDK+ A++ AG+ I  SPA IG+++++LL  
Sbjct: 233 SFIAGITAPPGKRMGHAGAIIAGGKGSAEDKLEALQSAGVTITRSPADIGKTMLDLLNK 291


>gi|315122388|ref|YP_004062877.1| succinyl-CoA synthetase subunit alpha [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495790|gb|ADR52389.1| succinyl-CoA synthetase subunit alpha [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 300

 Score =  353 bits (905), Expect = 2e-95,   Method: Composition-based stats.
 Identities = 265/300 (88%), Positives = 281/300 (93%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQ+VGGIHPKKG T W GGNVNVPVF 
Sbjct: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQIVGGIHPKKGGTCWVGGNVNVPVFV 60

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           +VAEAKE T ANASVIYVPPSGAGDAIIESI+AEIPLIVCITEGIP LDMVRVKA LE S
Sbjct: 61  SVAEAKEHTGANASVIYVPPSGAGDAIIESIKAEIPLIVCITEGIPFLDMVRVKAYLENS 120

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
           SSRLIGPNCPG+LTP+ CKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA
Sbjct: 121 SSRLIGPNCPGVLTPEECKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPVKG+EFID+LELFLAD+ TESI+MVGEIGGSAEE+AA FLKDEAK GRKKP+V
Sbjct: 181 VGIGGDPVKGSEFIDILELFLADKETESIIMVGEIGGSAEEDAANFLKDEAKCGRKKPVV 240

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGSL 300
           GFVAGKTAPPGRTMGHAGAVI GG+G AEDKI AM+EAGI IA SPAR+G++LVELLG L
Sbjct: 241 GFVAGKTAPPGRTMGHAGAVIYGGQGSAEDKIAAMQEAGIRIASSPARMGKTLVELLGGL 300


>gi|332188903|ref|ZP_08390607.1| succinate-CoA ligase, alpha subunit [Sphingomonas sp. S17]
 gi|332011063|gb|EGI53164.1| succinate-CoA ligase, alpha subunit [Sphingomonas sp. S17]
          Length = 294

 Score =  353 bits (905), Expect = 2e-95,   Method: Composition-based stats.
 Identities = 213/299 (71%), Positives = 253/299 (84%), Gaps = 5/299 (1%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSILV+KNTKV+ QG+TG+ GTFHT+QA+ Y  TQ+VGG+ P KG T   G    +P+F 
Sbjct: 1   MSILVNKNTKVITQGMTGETGTFHTQQALAY-GTQMVGGVTPGKGGTQHIG----LPIFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TVAEAK +T A+ASVIYVPP  A D+I+E+I+AEIPLIV ITEGIPVLDMV+VK  L  S
Sbjct: 56  TVAEAKSKTGADASVIYVPPPFAADSILEAIDAEIPLIVAITEGIPVLDMVKVKRALSGS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            SRLIGPNCPG+LTP  CKIGIMPGSIF+KGSVG++SRSGTLTYEAVFQTS  GLGQ+TA
Sbjct: 116 KSRLIGPNCPGVLTPGECKIGIMPGSIFKKGSVGVVSRSGTLTYEAVFQTSNAGLGQTTA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPV GT FIDVLELFLAD+ T+SI+M+GEIGGSAEEEAAQFL+DEAKRGR KP+ 
Sbjct: 176 VGIGGDPVNGTNFIDVLELFLADDETQSIIMIGEIGGSAEEEAAQFLRDEAKRGRSKPMA 235

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
           GF+AG+TAPPGR MGHAGA++SGG+GGAEDKI AM+ AGI +A SP+ +G +L+ +L  
Sbjct: 236 GFIAGRTAPPGRRMGHAGAIVSGGQGGAEDKIAAMEAAGIKVAASPSELGSTLLSVLNK 294


>gi|258511358|ref|YP_003184792.1| succinyl-CoA synthetase, alpha subunit [Alicyclobacillus
           acidocaldarius subsp. acidocaldarius DSM 446]
 gi|257478084|gb|ACV58403.1| succinyl-CoA synthetase, alpha subunit [Alicyclobacillus
           acidocaldarius subsp. acidocaldarius DSM 446]
          Length = 299

 Score =  353 bits (905), Expect = 2e-95,   Method: Composition-based stats.
 Identities = 182/299 (60%), Positives = 229/299 (76%), Gaps = 9/299 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSILV+K T+V+ QG+TG AG FHT+QA+ Y  T+VVGG  P KG T   G    +PVF 
Sbjct: 1   MSILVNKETRVITQGITGSAGLFHTQQALAY-GTKVVGGTSPGKGGTKVEG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA   T ANASVIYVPP+ A DAI+E++ A I L+VCITEGIP+LDMV+VK  +E  
Sbjct: 56  TVEEAVRETGANASVIYVPPAFAADAIMEAVAAGIELVVCITEGIPILDMVKVKRYMEGK 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            +RLIGPNCPG++TP+ CKIGIMPG I   G +G++SRSGTLTYEAV+Q +Q GLGQSTA
Sbjct: 116 KTRLIGPNCPGVITPNECKIGIMPGYIHTPGKIGVVSRSGTLTYEAVYQLTQLGLGQSTA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPV GT F+DVL++F  D  TE+++M+GEIGGSAEEEAA+++K       KKP+V
Sbjct: 176 VGIGGDPVNGTNFVDVLKMFNDDPDTEAVIMIGEIGGSAEEEAAEWIKANM----KKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
           GF+AG TAPPGR MGHAGA++SGG G A+ KI  MK  GI +AP+P+ +G +L ++L  
Sbjct: 232 GFIAGATAPPGRRMGHAGAIVSGGSGTAQSKIEKMKACGIRVAPTPSEMGSTLYQVLEE 290


>gi|50120303|ref|YP_049470.1| succinyl-CoA synthetase subunit alpha [Pectobacterium atrosepticum
           SCRI1043]
 gi|49610829|emb|CAG74274.1| succinyl-CoA synthetase alpha chain [Pectobacterium atrosepticum
           SCRI1043]
          Length = 290

 Score =  353 bits (905), Expect = 2e-95,   Method: Composition-based stats.
 Identities = 175/298 (58%), Positives = 222/298 (74%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL++KNTKV+ QG TG  GTFH+EQA+ Y  TQ+VGG+ P KG T   G    +PVF 
Sbjct: 1   MSILINKNTKVICQGFTGSQGTFHSEQALAY-GTQMVGGVTPGKGGTEHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T A ASVIYVP     D+I+E+I+A I LI+CITEGIP LDM+ VK +L++S
Sbjct: 56  TVREAVEATGATASVIYVPAPFCKDSILEAIDAGIELIICITEGIPTLDMLTVKVKLDQS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TP  CKIGIMPG I   G VGI+SRSGTLTYEAV QT+  GLGQS+ 
Sbjct: 116 GVRMIGPNCPGVITPGECKIGIMPGHIHLPGKVGIVSRSGTLTYEAVKQTTDAGLGQSSC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L+LF  D  TE+IVM+GEIGG+AEEEAA+++K+       KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILKLFEQDPQTEAIVMIGEIGGTAEEEAAEYIKEH----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           G++AG TAP G+ MGHAGA+I+GGKG A+DK  A++ AG+    S A IG ++  +L 
Sbjct: 232 GYIAGVTAPKGKRMGHAGAIIAGGKGTADDKFAALEAAGVKTVRSLADIGDAVKAILA 289


>gi|87119163|ref|ZP_01075061.1| succinyl-CoA synthetase alpha subunit [Marinomonas sp. MED121]
 gi|86165554|gb|EAQ66821.1| succinyl-CoA synthetase alpha subunit [Marinomonas sp. MED121]
          Length = 290

 Score =  353 bits (905), Expect = 2e-95,   Method: Composition-based stats.
 Identities = 174/298 (58%), Positives = 213/298 (71%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+TKV+ QG TG  GTFH+EQAI Y  T++VGG+ P KG     G    +PVF 
Sbjct: 1   MSVLINKDTKVICQGFTGGQGTFHSEQAIAY-GTKMVGGVTPGKGGQTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T A ASVIYVP     D+I+E+  + I LIVCITEGIP LDM+  K   ++ 
Sbjct: 56  TVREAVEETGAEASVIYVPAPFCKDSILEAANSGIKLIVCITEGIPTLDMLDCKVACDEL 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             RLIGPNCPG++TP  CKIGIMPG I   G VGI+SRSGTLTYEAV QT+  G GQST 
Sbjct: 116 GVRLIGPNCPGVITPGECKIGIMPGHIHLPGKVGIVSRSGTLTYEAVKQTTDAGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ GT FIDVLELF  D  TE+IVM+GEIGG+AEEEAA ++K        KP+V
Sbjct: 176 VGIGGDPIPGTNFIDVLELFQNDPKTEAIVMIGEIGGTAEEEAAAYIKAN----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            ++AG TAP G+ MGHAGA+ISGGKG A++K  A+++AG+    S A IG +L EL G
Sbjct: 232 SYIAGVTAPAGKRMGHAGAIISGGKGTADEKFAALEDAGVKTVRSLADIGDALKELTG 289


>gi|84684236|ref|ZP_01012138.1| succinyl-CoA synthase, alpha subunit [Maritimibacter alkaliphilus
           HTCC2654]
 gi|84667989|gb|EAQ14457.1| succinyl-CoA synthase, alpha subunit [Rhodobacterales bacterium
           HTCC2654]
          Length = 295

 Score =  353 bits (905), Expect = 3e-95,   Method: Composition-based stats.
 Identities = 202/298 (67%), Positives = 251/298 (84%), Gaps = 5/298 (1%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           M++LVD+NTKV+ QG TG  GTFH+EQAI Y  T++VGG+ P KG        +++PVF 
Sbjct: 1   MAVLVDENTKVICQGFTGSQGTFHSEQAIAY-GTKMVGGVTPGKGGQTH----LDLPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           +V EAK +T ANASVIYVPP  A D+I+E+I+AE+ LIVCITEGIPV+DM++VK  LE S
Sbjct: 56  SVHEAKHKTEANASVIYVPPPFAADSILEAIDAEMELIVCITEGIPVMDMMKVKRALEGS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
           SS LIGPNCPG++TPD+CKIGIMPG I ++G+VG++SRSGTLTYEAV QT+  GLGQS+ 
Sbjct: 116 SSILIGPNCPGVITPDACKIGIMPGHIHKRGTVGVVSRSGTLTYEAVKQTTDVGLGQSSC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+KGTE IDVLE FLAD+ TESI+M+GEIGGSAEEEAAQFLKDEAK+GRKKP+ 
Sbjct: 176 VGIGGDPIKGTEHIDVLEWFLADDETESIIMIGEIGGSAEEEAAQFLKDEAKKGRKKPVA 235

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           GF+AG+TAPPGR MGHAGA+++GGKGGAEDKI AMK AGI +A SPA++G +++E + 
Sbjct: 236 GFIAGRTAPPGRRMGHAGAIVAGGKGGAEDKIEAMKSAGIVVAESPAQLGEAVLEAIK 293


>gi|83953478|ref|ZP_00962200.1| Succinyl-CoA synthetase, alpha subunit [Sulfitobacter sp. NAS-14.1]
 gi|83842446|gb|EAP81614.1| Succinyl-CoA synthetase, alpha subunit [Sulfitobacter sp. NAS-14.1]
          Length = 295

 Score =  352 bits (904), Expect = 3e-95,   Method: Composition-based stats.
 Identities = 196/299 (65%), Positives = 244/299 (81%), Gaps = 5/299 (1%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           M++LV++NTKV+ QGLTG  GTFHTEQAI Y  T++VGG+ P KG        +++PVF 
Sbjct: 1   MAVLVNENTKVICQGLTGSQGTFHTEQAIAY-GTKMVGGVTPGKGGQTH----LDLPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           +V EA+  T ANA+VIYVPP  A D+I+E+I+AE+ LI+CITEGIPVLDM+RVK  LE S
Sbjct: 56  SVHEARHVTEANATVIYVPPPFAADSILEAIDAEMELIICITEGIPVLDMMRVKRALEGS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            SRLIGPNCPG++TPD+CKIGIMPG I ++G+ G++SRSGTLTYEAV QTS  GLGQS+A
Sbjct: 116 KSRLIGPNCPGVITPDACKIGIMPGHIHKRGTCGVVSRSGTLTYEAVKQTSDLGLGQSSA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+KG+E ID+LE+FLAD  T+SI+M+GEIGGSAEEEAAQFL DE K+GR KP  
Sbjct: 176 VGIGGDPIKGSEHIDILEMFLADPETQSIIMIGEIGGSAEEEAAQFLADEKKKGRWKPTA 235

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
           GF+AG+TAPPGR MGHAGA+++GGKG AE KI AMKEAGI +A SPA +G ++ E +  
Sbjct: 236 GFIAGRTAPPGRRMGHAGAIVAGGKGDAESKIAAMKEAGIVVADSPATLGEAVQEAINK 294


>gi|317491189|ref|ZP_07949625.1| succinate-CoA ligase [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|316920736|gb|EFV42059.1| succinate-CoA ligase [Enterobacteriaceae bacterium 9_2_54FAA]
          Length = 289

 Score =  352 bits (904), Expect = 3e-95,   Method: Composition-based stats.
 Identities = 173/297 (58%), Positives = 221/297 (74%), Gaps = 9/297 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL++K+TKV+ QG TG  GTFH+EQA+ Y  T++VGG+ P KG T   G    +PVF 
Sbjct: 1   MSILINKDTKVICQGFTGSQGTFHSEQALAY-GTKLVGGVTPGKGGTEHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T A ASVIYVP     D+I+E+I+A I LI+CITEGIP LDM+ VKA+LE+S
Sbjct: 56  TVREAVEATGATASVIYVPAPFCKDSILEAIDAGIKLIICITEGIPTLDMLVVKAKLEQS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            +R+IGPNCPG++TP  CKIGIMPG I   G VGI+SRSGTLTYEAV QT+  G GQS+ 
Sbjct: 116 DARMIGPNCPGVITPGECKIGIMPGHIHLPGKVGIVSRSGTLTYEAVKQTTDIGFGQSSC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L+LF  D  TE IVM+GEIGG+AEE+AA ++KD       KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILKLFQEDPQTEVIVMIGEIGGNAEEDAAAYIKDH----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELL 297
           G++AG TAP G+ MGHAGA+I+GGKG A++K  A++ AG+    S A IG ++  +L
Sbjct: 232 GYIAGVTAPKGKRMGHAGAIIAGGKGTADEKFAALEAAGVKTVRSLAEIGNAVKTVL 288


>gi|218288279|ref|ZP_03492578.1| succinyl-CoA synthetase, alpha subunit [Alicyclobacillus
           acidocaldarius LAA1]
 gi|218241638|gb|EED08811.1| succinyl-CoA synthetase, alpha subunit [Alicyclobacillus
           acidocaldarius LAA1]
          Length = 299

 Score =  352 bits (904), Expect = 3e-95,   Method: Composition-based stats.
 Identities = 181/299 (60%), Positives = 229/299 (76%), Gaps = 9/299 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSILV+K T+V+ QG+TG AG FHT+QA+ Y  T+VVGG  P KG T   G    +PVF 
Sbjct: 1   MSILVNKETRVITQGITGSAGLFHTQQALAY-GTKVVGGTSPGKGGTKVEG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA   T ANASVIYVPP+ A DAI+E++ A + L+VCITEGIP+ DMV+VK  +E  
Sbjct: 56  TVEEAVRETGANASVIYVPPAFAADAIMEAVAAGLELVVCITEGIPIFDMVKVKRYMEGK 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            +RLIGPNCPG++TP+ CKIGIMPG I   G +G++SRSGTLTYEAV+Q +Q GLGQSTA
Sbjct: 116 KTRLIGPNCPGVITPNECKIGIMPGYIHTPGKIGVVSRSGTLTYEAVYQLTQLGLGQSTA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPV GT F+DVL++F  D  TE+++M+GEIGGSAEEEAA+++K       KKP+V
Sbjct: 176 VGIGGDPVNGTNFVDVLKMFNDDPDTEAVIMIGEIGGSAEEEAAEWIKANM----KKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
           GF+AG TAPPGR MGHAGA++SGG G A+ KI  MKE GI +AP+P+ +G +L ++L  
Sbjct: 232 GFIAGATAPPGRRMGHAGAIVSGGSGTAQSKIEKMKECGIRVAPTPSEMGSTLYQVLEE 290


>gi|89095245|ref|ZP_01168167.1| succinyl-CoA synthetase alpha chain [Oceanospirillum sp. MED92]
 gi|89080499|gb|EAR59749.1| succinyl-CoA synthetase alpha chain [Oceanospirillum sp. MED92]
          Length = 290

 Score =  352 bits (904), Expect = 3e-95,   Method: Composition-based stats.
 Identities = 174/298 (58%), Positives = 217/298 (72%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+TKV+ QG TG  GTFH+EQAI Y  T++VGG+ P KG T   G    +PVF 
Sbjct: 1   MSVLINKDTKVICQGFTGGQGTFHSEQAIAY-GTKMVGGVTPGKGGTTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TVAEA   T A ASVIYVP     D+I+E+  A I LIVCITE IPV+DM+  K R ++ 
Sbjct: 56  TVAEAVAETGAEASVIYVPAPFCKDSILEAANAGIKLIVCITEHIPVMDMLECKVRCDEL 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             RLIGPNCPG++TP  CKIGIMPG I   G VGI+SRSGTLTYEAV QT+  G GQST 
Sbjct: 116 GVRLIGPNCPGVITPGECKIGIMPGHIHLPGKVGIVSRSGTLTYEAVKQTTDAGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+LE+F  D  TE+IVM+GEIGGSAEEEAA+F+K        KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILEMFQNDPQTEAIVMIGEIGGSAEEEAAEFIKAN----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            ++AG TAP G+ MGHAGA+ISGGKG A++K  A+++AG+    S A+IG +L E+ G
Sbjct: 232 SYIAGVTAPAGKRMGHAGAIISGGKGTADEKFAALEDAGVKTVRSLAQIGDALKEVTG 289


>gi|85711260|ref|ZP_01042319.1| Succinyl-CoA synthetase, alpha subunit [Idiomarina baltica OS145]
 gi|85694761|gb|EAQ32700.1| Succinyl-CoA synthetase, alpha subunit [Idiomarina baltica OS145]
          Length = 290

 Score =  352 bits (904), Expect = 3e-95,   Method: Composition-based stats.
 Identities = 179/298 (60%), Positives = 220/298 (73%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L+DKNTKV+ QG TG  GTFH+EQAI Y  TQ+VGG+ P KG     G    +PVF 
Sbjct: 1   MSVLIDKNTKVICQGFTGGQGTFHSEQAIAY-GTQMVGGVTPGKGGQEHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T A ASVIYVP     D+IIE+ +A I LIVCITEGIP LDM+ VK  L   
Sbjct: 56  TVKEAVEATGATASVIYVPAPFCKDSIIEAADAGIELIVCITEGIPTLDMLYVKEYLTHK 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TPD CKIGIMPG I +KG VGI+SRSGTLTYEAV QT+ EG GQST 
Sbjct: 116 GVRMIGPNCPGVITPDECKIGIMPGHIHKKGKVGIVSRSGTLTYEAVKQTTDEGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+LELF  D  TE+IVM+GEIGG+AEEEAA+++K+       KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILELFEKDPETEAIVMIGEIGGTAEEEAAEYIKNH----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            ++AG TAPPG+ MGHAGA+I+GGKG A++K  A++ AG+    S A IG+++ E  G
Sbjct: 232 SYIAGVTAPPGKRMGHAGAIIAGGKGTADEKFAALEAAGVKTVRSLADIGKAVREKTG 289


>gi|148554220|ref|YP_001261802.1| succinyl-CoA synthetase (ADP-forming) subunit alpha [Sphingomonas
           wittichii RW1]
 gi|148499410|gb|ABQ67664.1| succinyl-CoA synthetase (ADP-forming) alpha subunit [Sphingomonas
           wittichii RW1]
          Length = 294

 Score =  352 bits (903), Expect = 4e-95,   Method: Composition-based stats.
 Identities = 213/298 (71%), Positives = 252/298 (84%), Gaps = 5/298 (1%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSILV+KNTKV+ QG+TG  GTFHTEQA+ Y  TQ+VGG+ P KG T   G    +P F 
Sbjct: 1   MSILVNKNTKVITQGMTGNTGTFHTEQALAY-GTQMVGGVTPGKGGTTHIG----LPNFD 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA   T A+ASVIYVPP  A D+I+E+I+AE+PLIVCITEGIPV+DM+RVK  L+ S
Sbjct: 56  TVHEAVAATGADASVIYVPPPFAADSILEAIDAEVPLIVCITEGIPVIDMIRVKRALQGS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            SRLIGPNCPG+LTP+ CKIGIMPGSIF+KGSVG++SRSGTLTYEAVFQTS  GLGQ+TA
Sbjct: 116 KSRLIGPNCPGVLTPNECKIGIMPGSIFQKGSVGVVSRSGTLTYEAVFQTSAIGLGQTTA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPV GT FIDVLELFLAD+ T+SI+M+GEIGGSAEEEAAQFL+DEAKRGRKKP+ 
Sbjct: 176 VGIGGDPVNGTNFIDVLELFLADDETKSIIMIGEIGGSAEEEAAQFLRDEAKRGRKKPMA 235

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           GF+AG+TAPPGR MGHAGA++SGG+GGAEDKI AM+ AGI +A SP+ +G +L E+L 
Sbjct: 236 GFIAGRTAPPGRRMGHAGAIVSGGQGGAEDKIAAMEAAGIKVAASPSELGTTLAEVLK 293


>gi|110678917|ref|YP_681924.1| succinyl-CoA synthase, alpha subunit [Roseobacter denitrificans OCh
           114]
 gi|109455033|gb|ABG31238.1| succinyl-CoA synthase, alpha subunit [Roseobacter denitrificans OCh
           114]
          Length = 295

 Score =  352 bits (903), Expect = 4e-95,   Method: Composition-based stats.
 Identities = 198/299 (66%), Positives = 245/299 (81%), Gaps = 5/299 (1%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           M++L+D+NTKV+ QGLTG  GTFH+EQAI Y  T++VGG+ P KG        +++PVF 
Sbjct: 1   MAVLIDENTKVICQGLTGSQGTFHSEQAIAY-GTKMVGGVTPGKGGQTH----LDLPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           +V EAK  T ANASVIYVPP  A D+I+E+I+AE+ LIVCITEGIPVLDM++V+  LE S
Sbjct: 56  SVHEAKHATEANASVIYVPPPFAADSILEAIDAEMELIVCITEGIPVLDMMKVQRALEGS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            SRLIGPNCPG++TPD+CKIGIMPG I ++GS G++SRSGTLTYEAV QT+  GLGQSTA
Sbjct: 116 KSRLIGPNCPGVITPDACKIGIMPGHIHKRGSCGVVSRSGTLTYEAVKQTTDLGLGQSTA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+KGTE IDVLE+FLAD  T SI+M+GEIGGSAEE+AAQFL DE K+GR KP  
Sbjct: 176 VGIGGDPIKGTEHIDVLEMFLADPETTSIIMIGEIGGSAEEDAAQFLADEKKKGRWKPTA 235

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
           GF+AG+TAPPGR MGHAGA+++GGKGGAEDKI+AM+ AGI +A SPA +G ++ E +  
Sbjct: 236 GFIAGRTAPPGRRMGHAGAIVAGGKGGAEDKIDAMRAAGIVVADSPATLGEAVQEAIAK 294


>gi|67459056|ref|YP_246680.1| succinyl-CoA synthetase subunit alpha [Rickettsia felis URRWXCal2]
 gi|75536510|sp|Q4ULQ8|SUCD_RICFE RecName: Full=Succinyl-CoA ligase [ADP-forming] subunit alpha;
           AltName: Full=Succinyl-CoA synthetase subunit alpha;
           Short=SCS-alpha
 gi|67004589|gb|AAY61515.1| Succinyl-CoA synthetase alpha chain [Rickettsia felis URRWXCal2]
          Length = 292

 Score =  352 bits (903), Expect = 4e-95,   Method: Composition-based stats.
 Identities = 181/299 (60%), Positives = 234/299 (78%), Gaps = 8/299 (2%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           M+IL++K TKV+ QG TG  GTFH+EQAI Y  T +VGG+ P KG        +++PV+ 
Sbjct: 1   MAILINKKTKVICQGFTGSQGTFHSEQAIAY-GTNMVGGVTPGKGGHTH----LDLPVYN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EAK +T ANASVIYVPP  A D+I+E+I+AEI ++VCITEGIPVLDMV+VK  L  S
Sbjct: 56  TVHEAKAKTGANASVIYVPPGFAADSILEAIDAEIEVVVCITEGIPVLDMVKVKRALVGS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            +RLIGPNCPG++TP  CKIGIMPG I ++G++GI+SRSGTLTYEAV QT+  GLGQST 
Sbjct: 116 KTRLIGPNCPGVITPGECKIGIMPGHIHKRGTIGIVSRSGTLTYEAVAQTTAVGLGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPV GT F+D +++FL D+ T++I+M+GEIGG+AEE+AA+F+K       KKPIV
Sbjct: 176 VGIGGDPVNGTNFVDCIDMFLKDDETKAIIMIGEIGGNAEEDAAEFIKQ---SKIKKPIV 232

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
            F+AG TAPPG+ MGHAGA+I+GGKG AEDK+ A++ AG+ I  SPA IG+++ +LL  
Sbjct: 233 SFIAGITAPPGKRMGHAGAIIAGGKGSAEDKLEALQSAGVTITRSPADIGKTMFDLLNK 291


>gi|295696102|ref|YP_003589340.1| succinyl-CoA synthetase, alpha subunit [Bacillus tusciae DSM 2912]
 gi|295411704|gb|ADG06196.1| succinyl-CoA synthetase, alpha subunit [Bacillus tusciae DSM 2912]
          Length = 305

 Score =  352 bits (903), Expect = 4e-95,   Method: Composition-based stats.
 Identities = 187/299 (62%), Positives = 232/299 (77%), Gaps = 9/299 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSILVD+NTKV+ QG+TG  G FHT+QA+ Y  T+VV G+ P KG T   G    VPVF 
Sbjct: 1   MSILVDRNTKVVTQGITGSTGLFHTKQALEY-GTKVVAGVTPGKGGTVIEG----VPVFD 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
            VAEA + T ANASVIYVPP+ A DAI+E+ +A + L++CITEGIPVLDMV+VK  LE  
Sbjct: 56  KVAEAVKETGANASVIYVPPAFAADAIMEAADAGLELVICITEGIPVLDMVKVKRYLEGR 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            +RLIGPNCPG++TPD CKIGIMPG I R G VG++SRSGTLTYEAV Q +  G+GQSTA
Sbjct: 116 KTRLIGPNCPGVITPDQCKIGIMPGYIHRPGHVGVVSRSGTLTYEAVHQLTTRGIGQSTA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPV GT FIDVL+LF  D  TE+++M+GEIGG+AEEEAA+++K       KKP+V
Sbjct: 176 VGIGGDPVNGTNFIDVLKLFNEDPETEAVIMIGEIGGTAEEEAAEWIKANM----KKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
           GF+AG TAP G+ MGHAGA+ISGGKG A +KI  +KE G+ +AP+PA++G +LVE+L  
Sbjct: 232 GFIAGATAPKGKRMGHAGAIISGGKGTAAEKIAKLKECGVRVAPTPAQMGETLVEVLKE 290


>gi|260431532|ref|ZP_05785503.1| succinyl-CoA ligase, alpha subunit [Silicibacter lacuscaerulensis
           ITI-1157]
 gi|260415360|gb|EEX08619.1| succinyl-CoA ligase, alpha subunit [Silicibacter lacuscaerulensis
           ITI-1157]
          Length = 294

 Score =  352 bits (903), Expect = 4e-95,   Method: Composition-based stats.
 Identities = 202/299 (67%), Positives = 249/299 (83%), Gaps = 5/299 (1%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           M++L+D+NTKV+ QG TG  GTFH+EQAI Y  T++VGG+ P KG     G    +PVF 
Sbjct: 1   MAVLIDENTKVICQGFTGSQGTFHSEQAIAY-GTKMVGGVTPGKGGMTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           +V EAK  T ANA+VIYVPP  A D+I+E+I+AE+ +IVCITEGIPVLDM++VK  LE S
Sbjct: 56  SVHEAKHVTEANATVIYVPPPFAADSILEAIDAEMEVIVCITEGIPVLDMMKVKRALEGS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            SRLIGPNCPG++TPD+CKIGIMPG I ++GSVG++SRSGTLTYEAV QT+  GLGQST 
Sbjct: 116 KSRLIGPNCPGVITPDACKIGIMPGHIHKRGSVGVVSRSGTLTYEAVKQTTDVGLGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+KGTE IDVLE FLAD+ TESI+M+GEIGGSAEEEAAQFL DEAK+GRKKP+ 
Sbjct: 176 VGIGGDPIKGTEHIDVLEWFLADDETESIIMIGEIGGSAEEEAAQFLADEAKKGRKKPVA 235

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
           GF+AG+TAPPGR MGHAGA+++GGKGGAEDKI AM+ AGI +A SPA++G +++E +G 
Sbjct: 236 GFIAGRTAPPGRRMGHAGAIVAGGKGGAEDKIEAMRSAGIVVAESPAKLGEAVLEAIGK 294


>gi|123443155|ref|YP_001007129.1| succinyl-CoA synthetase subunit alpha [Yersinia enterocolitica
           subsp. enterocolitica 8081]
 gi|332160921|ref|YP_004297498.1| succinyl-CoA synthetase subunit alpha [Yersinia enterocolitica
           subsp. palearctica 105.5R(r)]
 gi|122090116|emb|CAL12979.1| succinyl-CoA synthetase alpha chain [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|318604826|emb|CBY26324.1| succinyl-CoA ligase [ADP-forming] alpha chain [Yersinia
           enterocolitica subsp. palearctica Y11]
 gi|325665151|gb|ADZ41795.1| succinyl-CoA synthetase subunit alpha [Yersinia enterocolitica
           subsp. palearctica 105.5R(r)]
 gi|330862914|emb|CBX73049.1| succinyl-CoA ligase [ADP-forming] subunit alpha [Yersinia
           enterocolitica W22703]
          Length = 292

 Score =  352 bits (902), Expect = 5e-95,   Method: Composition-based stats.
 Identities = 177/299 (59%), Positives = 220/299 (73%), Gaps = 9/299 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL+DKNTKV+ QG TG  GTFH+EQAI Y  T++VGG+ P KG T   G    +PVF 
Sbjct: 1   MSILIDKNTKVICQGFTGSQGTFHSEQAIAY-GTKMVGGVTPGKGGTQHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T A ASVIYVP     D+I+E+I+A I LI+CITEGIP LDM+ VK +LE+S
Sbjct: 56  TVREAVETTGATASVIYVPAPFCKDSILEAIDAGIKLIICITEGIPTLDMLVVKVKLEQS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            +R+IGPNCPG++TP  CKIGIMPG I   G VGI+SRSGTLTYEAV QT+  G GQST 
Sbjct: 116 DARMIGPNCPGVITPGECKIGIMPGHIHLPGKVGIVSRSGTLTYEAVKQTTDIGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L+LF  D  TE IVM+GEIGG+AEEEAA ++K+       KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILKLFQEDPQTEVIVMIGEIGGNAEEEAAAYIKEH----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
           G++AG TAP G+ MGHAGA+I+GGKG A+DK  A++ AG+    S A IG ++  +  S
Sbjct: 232 GYIAGVTAPKGKRMGHAGAIIAGGKGTADDKFAALEAAGVKTVRSLAEIGNAVKAVYQS 290


>gi|85704794|ref|ZP_01035895.1| succinyl-CoA synthase, alpha subunit [Roseovarius sp. 217]
 gi|85670612|gb|EAQ25472.1| succinyl-CoA synthase, alpha subunit [Roseovarius sp. 217]
          Length = 293

 Score =  352 bits (902), Expect = 5e-95,   Method: Composition-based stats.
 Identities = 209/298 (70%), Positives = 249/298 (83%), Gaps = 5/298 (1%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           M++LVDK+T+V+ QGLTG  GTFH+EQAI Y  TQ+VGG+ P KG T      +++PVF 
Sbjct: 1   MAVLVDKHTRVICQGLTGSQGTFHSEQAIAY-GTQMVGGVTPGKGGTTH----LDLPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           +V EAK  T ANASVIYVPP  A D+I+E+I+AE+ LIVCITEGIPVLDM+RVK  LE S
Sbjct: 56  SVHEAKHVTEANASVIYVPPPFAADSILEAIDAEMELIVCITEGIPVLDMMRVKRALEGS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            SRLIGPNCPGI+TPD+CKIGIMPG I R+GSVG++SRSGTLTYEAV QTS  GLGQST 
Sbjct: 116 KSRLIGPNCPGIITPDACKIGIMPGHIHRRGSVGVVSRSGTLTYEAVKQTSDVGLGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+KGTE IDVLE FLAD+ T+SI+M+GEIGGSAEEEAAQFLKDEAKRGRKKP+ 
Sbjct: 176 VGIGGDPIKGTEHIDVLEWFLADDETQSIIMIGEIGGSAEEEAAQFLKDEAKRGRKKPVA 235

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           GF+AG+TAPPGR MGHAGA+++GGKG AE KI AMK AGI +A SPA +G +++  +G
Sbjct: 236 GFIAGRTAPPGRRMGHAGAIVAGGKGDAESKIEAMKSAGITVAESPAGLGEAVLTAIG 293


>gi|157826591|ref|YP_001495655.1| succinyl-CoA synthetase subunit alpha [Rickettsia bellii OSU
           85-389]
 gi|157801895|gb|ABV78618.1| succinyl-CoA synthetase subunit alpha [Rickettsia bellii OSU
           85-389]
          Length = 291

 Score =  352 bits (902), Expect = 5e-95,   Method: Composition-based stats.
 Identities = 185/298 (62%), Positives = 233/298 (78%), Gaps = 8/298 (2%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           M+ILV+K TKV+ QG TG  GTFH+EQAI Y  T++VGG+ P KG        +++P++ 
Sbjct: 1   MAILVNKKTKVICQGFTGSQGTFHSEQAIAY-GTKMVGGVTPGKGGKTH----LDLPIYN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EAK +T ANASVIYVPP  A D+I+E+I+A I ++VCITEGIPVLDMVRVK  L  S
Sbjct: 56  TVHEAKAKTGANASVIYVPPPFAADSILEAIDAGIEIVVCITEGIPVLDMVRVKRALVGS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            +RLIGPNCPGI+TPD CKIGIMPG I RKGS+GI+SRSGTLTYEAV QT+  GLGQST 
Sbjct: 116 RTRLIGPNCPGIITPDECKIGIMPGHIHRKGSIGIVSRSGTLTYEAVAQTTAVGLGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ GT F+D +++FL D+ T++I+M+GEIGG AEE AA F+K       KKPIV
Sbjct: 176 VGIGGDPINGTNFVDCIDMFLQDDETKAIIMIGEIGGDAEENAADFIK---HSKIKKPIV 232

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            F+AG TAPPG+ MGHAGA+I+GGKG AEDK+ A++ AG+ I  SPA IG+++++LL 
Sbjct: 233 SFIAGITAPPGKRMGHAGAIIAGGKGSAEDKLEALQSAGVTITRSPADIGKTMLDLLN 290


>gi|56460606|ref|YP_155887.1| succinyl-CoA synthetase, alpha subunit [Idiomarina loihiensis L2TR]
 gi|56179616|gb|AAV82338.1| Succinyl-CoA synthetase, alpha subunit [Idiomarina loihiensis L2TR]
          Length = 290

 Score =  352 bits (902), Expect = 5e-95,   Method: Composition-based stats.
 Identities = 178/298 (59%), Positives = 219/298 (73%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL+DKNTKV+ QG TG  GTFH+EQAI Y  TQ+VGG+ P KG     G    +PVF 
Sbjct: 1   MSILIDKNTKVICQGFTGGQGTFHSEQAIAY-GTQMVGGVTPGKGGQEHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T A ASVIYVP     D+IIE+ +A I LIVCITEGIP LDM+ VK  L   
Sbjct: 56  TVREAVEATGATASVIYVPAPFCKDSIIEAADAGIELIVCITEGIPTLDMLYVKEYLTHK 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TPD CKIGIMPG I +KG VGI+SRSGTLTYEAV QT+  G GQS+ 
Sbjct: 116 GVRMIGPNCPGVITPDECKIGIMPGHIHKKGKVGIVSRSGTLTYEAVKQTTDAGFGQSSC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+LELF  D  TE+IVM+GEIGG+AEEEAA+++K+       KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILELFEKDPETEAIVMIGEIGGTAEEEAAEYIKNN----VSKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            ++AG TAPPG+ MGHAGA+I+GGKG A++K  A++ AG+    S A IG+++ E  G
Sbjct: 232 SYIAGVTAPPGKRMGHAGAIIAGGKGTADEKFAALEAAGVKTVRSLADIGKAVAEKTG 289


>gi|255261782|ref|ZP_05341124.1| succinyl-CoA ligase [ADP-forming] subunit alpha [Thalassiobium sp.
           R2A62]
 gi|255104117|gb|EET46791.1| succinyl-CoA ligase [ADP-forming] subunit alpha [Thalassiobium sp.
           R2A62]
          Length = 293

 Score =  352 bits (902), Expect = 5e-95,   Method: Composition-based stats.
 Identities = 198/298 (66%), Positives = 245/298 (82%), Gaps = 5/298 (1%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           M+IL+D+NTKV+ QG TG  GTFH+EQAI Y  T++VGG+ P KG        +++PVF 
Sbjct: 1   MAILIDENTKVICQGFTGSQGTFHSEQAIAY-GTKMVGGVTPGKGGQTH----LDLPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           +  EA E T ANA+VIYVPP  A D+I+E+++AEIP I CITEGIPVLDM++VK  LE S
Sbjct: 56  SCHEAVETTGANATVIYVPPPFAADSILEALDAEIPFICCITEGIPVLDMMKVKRALEGS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
           SS LIGPNCPG++TPD+CKIGIMPG I ++GSVG++SRSGTLTYEAV QT+  GLGQSTA
Sbjct: 116 SSILIGPNCPGVITPDACKIGIMPGHIHKRGSVGVVSRSGTLTYEAVKQTTDSGLGQSTA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+KGTE IDVLE FLAD+ T+SI+M+GEIGGSAEEEAAQFL DE K+GR KP  
Sbjct: 176 VGIGGDPIKGTEHIDVLERFLADDETQSIIMIGEIGGSAEEEAAQFLADEKKKGRWKPTA 235

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           GF+AG+TAPPGR MGHAGA+++GGKGGAEDKI AM+ AG+ +A SPA +G +++E +G
Sbjct: 236 GFIAGRTAPPGRRMGHAGAIVAGGKGGAEDKIEAMRSAGVVVAESPAGLGEAVLEAIG 293


>gi|91206042|ref|YP_538397.1| succinyl-CoA synthetase subunit alpha [Rickettsia bellii RML369-C]
 gi|122425252|sp|Q1RH56|SUCD_RICBR RecName: Full=Succinyl-CoA ligase [ADP-forming] subunit alpha;
           AltName: Full=Succinyl-CoA synthetase subunit alpha;
           Short=SCS-alpha
 gi|91069586|gb|ABE05308.1| Succinyl-CoA synthetase alpha chain [Rickettsia bellii RML369-C]
          Length = 291

 Score =  352 bits (902), Expect = 5e-95,   Method: Composition-based stats.
 Identities = 186/298 (62%), Positives = 233/298 (78%), Gaps = 8/298 (2%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           M+ILV+K TKV+ QG TG  GTFH+EQAI Y  T++VGG+ P KG        +++P++ 
Sbjct: 1   MAILVNKKTKVICQGFTGSQGTFHSEQAIAY-GTKMVGGVTPGKGGKTH----LDLPIYN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EAK +T ANASVIYVPP  A D+I+E+I+A I ++VCITEGIPVLDMVRVK  L  S
Sbjct: 56  TVHEAKAKTGANASVIYVPPPFAADSILEAIDAGIEIVVCITEGIPVLDMVRVKRALVGS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            +RLIGPNCPGI+TPD CKIGIMPG I RKGS+GI+SRSGTLTYEAV QT+  GLGQST 
Sbjct: 116 RTRLIGPNCPGIITPDECKIGIMPGHIHRKGSIGIVSRSGTLTYEAVAQTTAVGLGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPV GT F+D +++FL D+ T++I+M+GEIGG AEE AA F+K       KKPIV
Sbjct: 176 VGIGGDPVNGTNFVDCIDMFLQDDETKAIIMIGEIGGDAEENAADFIK---HSKIKKPIV 232

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            F+AG TAPPG+ MGHAGA+I+GGKG AEDK+ A++ AG+ I  SPA IG+++++LL 
Sbjct: 233 SFIAGITAPPGKRMGHAGAIIAGGKGSAEDKLEALQSAGVTITRSPADIGKTMLDLLN 290


>gi|22126940|ref|NP_670363.1| succinyl-CoA synthetase subunit alpha [Yersinia pestis KIM 10]
 gi|45440874|ref|NP_992413.1| succinyl-CoA synthetase subunit alpha [Yersinia pestis biovar
           Microtus str. 91001]
 gi|51595494|ref|YP_069685.1| succinyl-CoA synthetase subunit alpha [Yersinia pseudotuberculosis
           IP 32953]
 gi|108806591|ref|YP_650507.1| succinyl-CoA synthetase subunit alpha [Yersinia pestis Antiqua]
 gi|108813042|ref|YP_648809.1| succinyl-CoA synthetase subunit alpha [Yersinia pestis Nepal516]
 gi|145599846|ref|YP_001163922.1| succinyl-CoA synthetase subunit alpha [Yersinia pestis Pestoides F]
 gi|149366884|ref|ZP_01888918.1| succinyl-CoA synthetase alpha chain [Yersinia pestis CA88-4125]
 gi|153950506|ref|YP_001401841.1| succinyl-CoA synthetase subunit alpha [Yersinia pseudotuberculosis
           IP 31758]
 gi|162420505|ref|YP_001605913.1| succinyl-CoA synthetase subunit alpha [Yersinia pestis Angola]
 gi|165924347|ref|ZP_02220179.1| succinyl-CoA synthetase, alpha subunit [Yersinia pestis biovar
           Orientalis str. F1991016]
 gi|165938400|ref|ZP_02226958.1| succinyl-CoA synthetase, alpha subunit [Yersinia pestis biovar
           Orientalis str. IP275]
 gi|166011613|ref|ZP_02232511.1| succinyl-CoA synthetase, alpha subunit [Yersinia pestis biovar
           Antiqua str. E1979001]
 gi|166211799|ref|ZP_02237834.1| succinyl-CoA synthetase, alpha subunit [Yersinia pestis biovar
           Antiqua str. B42003004]
 gi|167399740|ref|ZP_02305258.1| succinyl-CoA synthetase, alpha subunit [Yersinia pestis biovar
           Antiqua str. UG05-0454]
 gi|167419457|ref|ZP_02311210.1| succinyl-CoA synthetase, alpha subunit [Yersinia pestis biovar
           Orientalis str. MG05-1020]
 gi|167423865|ref|ZP_02315618.1| succinyl-CoA synthetase, alpha subunit [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|167468937|ref|ZP_02333641.1| succinyl-CoA synthetase, alpha subunit [Yersinia pestis FV-1]
 gi|170025187|ref|YP_001721692.1| succinyl-CoA synthetase subunit alpha [Yersinia pseudotuberculosis
           YPIII]
 gi|186894547|ref|YP_001871659.1| succinyl-CoA synthetase subunit alpha [Yersinia pseudotuberculosis
           PB1/+]
 gi|218928284|ref|YP_002346159.1| succinyl-CoA synthetase subunit alpha [Yersinia pestis CO92]
 gi|229841052|ref|ZP_04461211.1| succinyl-CoA synthetase, NAD(P)-binding, alpha subunit [Yersinia
           pestis biovar Orientalis str. PEXU2]
 gi|229843156|ref|ZP_04463302.1| succinyl-CoA synthetase, NAD(P)-binding, alpha subunit [Yersinia
           pestis biovar Orientalis str. India 195]
 gi|229893993|ref|ZP_04509179.1| succinyl-CoA synthetase, NAD(P)-binding, alpha subunit [Yersinia
           pestis Pestoides A]
 gi|229903483|ref|ZP_04518596.1| succinyl-CoA synthetase, NAD(P)-binding, alpha subunit [Yersinia
           pestis Nepal516]
 gi|270487264|ref|ZP_06204338.1| succinyl-CoA synthetase subunit alpha [Yersinia pestis KIM D27]
 gi|294503123|ref|YP_003567185.1| succinyl-CoA synthetase alpha subunit [Yersinia pestis Z176003]
 gi|21959980|gb|AAM86614.1|AE013907_8 succinyl-CoA synthetase, alpha subunit [Yersinia pestis KIM 10]
 gi|45435732|gb|AAS61290.1| succinyl-CoA synthetase alpha chain [Yersinia pestis biovar
           Microtus str. 91001]
 gi|51588776|emb|CAH20390.1| succinyl-CoA synthetase alpha chain [Yersinia pseudotuberculosis IP
           32953]
 gi|108776690|gb|ABG19209.1| succinyl-CoA synthetase (ADP-forming) alpha subunit [Yersinia
           pestis Nepal516]
 gi|108778504|gb|ABG12562.1| succinyl-CoA synthetase (ADP-forming) alpha subunit [Yersinia
           pestis Antiqua]
 gi|115346895|emb|CAL19782.1| succinyl-CoA synthetase alpha chain [Yersinia pestis CO92]
 gi|145211542|gb|ABP40949.1| succinyl-CoA synthetase (ADP-forming) alpha subunit [Yersinia
           pestis Pestoides F]
 gi|149291258|gb|EDM41333.1| succinyl-CoA synthetase alpha chain [Yersinia pestis CA88-4125]
 gi|152962001|gb|ABS49462.1| succinyl-CoA synthetase, alpha subunit [Yersinia pseudotuberculosis
           IP 31758]
 gi|162353320|gb|ABX87268.1| succinyl-CoA synthetase, alpha subunit [Yersinia pestis Angola]
 gi|165913778|gb|EDR32397.1| succinyl-CoA synthetase, alpha subunit [Yersinia pestis biovar
           Orientalis str. IP275]
 gi|165923407|gb|EDR40539.1| succinyl-CoA synthetase, alpha subunit [Yersinia pestis biovar
           Orientalis str. F1991016]
 gi|165989561|gb|EDR41862.1| succinyl-CoA synthetase, alpha subunit [Yersinia pestis biovar
           Antiqua str. E1979001]
 gi|166207570|gb|EDR52050.1| succinyl-CoA synthetase, alpha subunit [Yersinia pestis biovar
           Antiqua str. B42003004]
 gi|166962198|gb|EDR58219.1| succinyl-CoA synthetase, alpha subunit [Yersinia pestis biovar
           Orientalis str. MG05-1020]
 gi|167050448|gb|EDR61856.1| succinyl-CoA synthetase, alpha subunit [Yersinia pestis biovar
           Antiqua str. UG05-0454]
 gi|167056714|gb|EDR66477.1| succinyl-CoA synthetase, alpha subunit [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|169751721|gb|ACA69239.1| succinyl-CoA synthetase, alpha subunit [Yersinia pseudotuberculosis
           YPIII]
 gi|186697573|gb|ACC88202.1| succinyl-CoA synthetase, alpha subunit [Yersinia pseudotuberculosis
           PB1/+]
 gi|229679253|gb|EEO75356.1| succinyl-CoA synthetase, NAD(P)-binding, alpha subunit [Yersinia
           pestis Nepal516]
 gi|229689503|gb|EEO81564.1| succinyl-CoA synthetase, NAD(P)-binding, alpha subunit [Yersinia
           pestis biovar Orientalis str. India 195]
 gi|229697418|gb|EEO87465.1| succinyl-CoA synthetase, NAD(P)-binding, alpha subunit [Yersinia
           pestis biovar Orientalis str. PEXU2]
 gi|229703878|gb|EEO90891.1| succinyl-CoA synthetase, NAD(P)-binding, alpha subunit [Yersinia
           pestis Pestoides A]
 gi|262361159|gb|ACY57880.1| succinyl-CoA synthetase alpha subunit [Yersinia pestis D106004]
 gi|262365286|gb|ACY61843.1| succinyl-CoA synthetase alpha subunit [Yersinia pestis D182038]
 gi|270335768|gb|EFA46545.1| succinyl-CoA synthetase subunit alpha [Yersinia pestis KIM D27]
 gi|294353582|gb|ADE63923.1| succinyl-CoA synthetase alpha subunit [Yersinia pestis Z176003]
 gi|320014255|gb|ADV97826.1| succinyl-CoA synthetase, NAD(P)-binding, alpha subunit [Yersinia
           pestis biovar Medievalis str. Harbin 35]
          Length = 290

 Score =  352 bits (902), Expect = 5e-95,   Method: Composition-based stats.
 Identities = 177/297 (59%), Positives = 220/297 (74%), Gaps = 9/297 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL+DKNTKV+ QG TG  GTFH+EQAI Y  T++VGG+ P KG T   G    +PVF 
Sbjct: 1   MSILIDKNTKVICQGFTGSQGTFHSEQAIAY-GTKMVGGVTPGKGGTQHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T A ASVIYVP     D+I+E+I+A I LI+CITEGIP LDM+ VK RLE+S
Sbjct: 56  TVREAVETTGATASVIYVPAPFCKDSILEAIDAGIKLIICITEGIPTLDMLVVKVRLEQS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            +R+IGPNCPG++TP  CKIGIMPG I   G VGI+SRSGTLTYEAV QT+  G GQS+ 
Sbjct: 116 DARMIGPNCPGVITPGECKIGIMPGHIHLPGKVGIVSRSGTLTYEAVKQTTDIGFGQSSC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L+LF  D  TE IVM+GEIGG+AEEEAA ++K+       KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILKLFQEDPQTEVIVMIGEIGGNAEEEAAAYIKEH----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELL 297
           G++AG TAP G+ MGHAGA+I+GGKG A+DK  A++ AG+    S A IG ++  +L
Sbjct: 232 GYIAGVTAPKGKRMGHAGAIIAGGKGTADDKFAALEAAGVKTVRSLAEIGNAVKAVL 288


>gi|326386304|ref|ZP_08207928.1| succinyl-CoA synthetase (ADP-forming) alpha subunit
           [Novosphingobium nitrogenifigens DSM 19370]
 gi|326209529|gb|EGD60322.1| succinyl-CoA synthetase (ADP-forming) alpha subunit
           [Novosphingobium nitrogenifigens DSM 19370]
          Length = 296

 Score =  351 bits (901), Expect = 7e-95,   Method: Composition-based stats.
 Identities = 214/298 (71%), Positives = 255/298 (85%), Gaps = 3/298 (1%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSILV+K+TKV+ QG+TGK GTFHT+QA+ Y  TQ+VGG+ P KG +     +  +P++ 
Sbjct: 1   MSILVNKDTKVITQGMTGKTGTFHTQQALAY-GTQMVGGVTPGKGGSTHE--DTGLPIWD 57

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TVAEAK  + A ASVIYVPP  A D+I+E+I+AEI LIV ITEGIPVLDMVRVK  L+ S
Sbjct: 58  TVAEAKAASGATASVIYVPPPFAADSILEAIDAEIELIVAITEGIPVLDMVRVKRALQGS 117

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            SRLIGPNCPG+LTP  CKIGIMPGSIFRKGSVG++SRSGTLTYEAVFQTS  GLGQ+TA
Sbjct: 118 KSRLIGPNCPGVLTPGECKIGIMPGSIFRKGSVGVVSRSGTLTYEAVFQTSNIGLGQTTA 177

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPV GT FIDVLELFLADE T+SI+M+GEIGG+AEE+AAQFLKDEAKRGRKKP+V
Sbjct: 178 VGIGGDPVNGTNFIDVLELFLADEETKSIIMIGEIGGNAEEQAAQFLKDEAKRGRKKPMV 237

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           GF+AG+TAPPGR MGHAGA++SGG+GGAEDKI AM+EAGI ++PSP+ +G +L E+L 
Sbjct: 238 GFIAGRTAPPGRRMGHAGAIVSGGQGGAEDKIAAMEEAGIRVSPSPSLLGETLAEVLK 295


>gi|227114766|ref|ZP_03828422.1| succinyl-CoA synthetase subunit alpha [Pectobacterium carotovorum
           subsp. brasiliensis PBR1692]
          Length = 290

 Score =  351 bits (901), Expect = 7e-95,   Method: Composition-based stats.
 Identities = 175/298 (58%), Positives = 221/298 (74%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL++KNTKV+ QG TG  GTFH+EQA+ Y  TQ+VGG+ P KG T   G    +PVF 
Sbjct: 1   MSILINKNTKVICQGFTGSQGTFHSEQALAY-GTQMVGGVTPGKGGTEHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T A ASVIYVP     D+I+E+I+A I LI+CITEGIP LDM+ VK +L++S
Sbjct: 56  TVREAVEATGATASVIYVPAPFCKDSILEAIDAGIELIICITEGIPTLDMLTVKVKLDQS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TP  CKIGIMPG I   G VGI+SRSGTLTYEAV QT+  GLGQS+ 
Sbjct: 116 GVRMIGPNCPGVITPGECKIGIMPGHIHLPGKVGIVSRSGTLTYEAVKQTTDAGLGQSSC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L+LF  D  TE+IVM+GEIGG+AEEEAA ++K+       KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILKLFEQDPQTEAIVMIGEIGGTAEEEAAAYIKEH----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           G++AG TAP G+ MGHAGA+I+GGKG A+DK  A++ AG+    S A IG ++  +L 
Sbjct: 232 GYIAGVTAPKGKRMGHAGAIIAGGKGTADDKFAALEAAGVKTVRSLADIGDAVKAILS 289


>gi|83950441|ref|ZP_00959174.1| succinyl-CoA synthase, alpha subunit [Roseovarius nubinhibens ISM]
 gi|83838340|gb|EAP77636.1| succinyl-CoA synthase, alpha subunit [Roseovarius nubinhibens ISM]
          Length = 293

 Score =  351 bits (901), Expect = 7e-95,   Method: Composition-based stats.
 Identities = 204/298 (68%), Positives = 248/298 (83%), Gaps = 5/298 (1%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           M++LVDKNTKV+ QGLTG  GTFH+EQAI Y  TQ+VGG+ P KG        +++PVF 
Sbjct: 1   MAVLVDKNTKVICQGLTGSQGTFHSEQAIAY-GTQMVGGVTPGKGGQTH----LDLPVFD 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           +V EA +RT+A+ASVIYVPP  A D+I+E+I+A++PLIVCITEGIPVLDM+RVK  LE S
Sbjct: 56  SVHEAMDRTSADASVIYVPPPFAADSILEAIDAQMPLIVCITEGIPVLDMMRVKRALEGS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            S LIGPNCPGI+TPD+CKIGIMPG I ++GSVG++SRSGTLTYEAV QT+  GLGQST 
Sbjct: 116 KSTLIGPNCPGIITPDACKIGIMPGHIHKRGSVGVVSRSGTLTYEAVKQTTDVGLGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+KGTE IDVLE FLAD+ TESI+M+GEIGGSAEEEAAQFL DE K+GR KP  
Sbjct: 176 VGIGGDPIKGTEHIDVLEWFLADDETESIIMIGEIGGSAEEEAAQFLADEKKKGRWKPTA 235

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           GF+AG+TAPPGR MGHAGA+++GGKGGA+DKI AMK AGI +A SPA +G +++  +G
Sbjct: 236 GFIAGRTAPPGRRMGHAGAIVAGGKGGADDKIEAMKSAGIVVAESPAGLGEAVLAAIG 293


>gi|154251906|ref|YP_001412730.1| succinyl-CoA synthetase subunit alpha [Parvibaculum lavamentivorans
           DS-1]
 gi|154155856|gb|ABS63073.1| succinyl-CoA synthetase, alpha subunit [Parvibaculum
           lavamentivorans DS-1]
          Length = 291

 Score =  351 bits (900), Expect = 7e-95,   Method: Composition-based stats.
 Identities = 198/298 (66%), Positives = 237/298 (79%), Gaps = 8/298 (2%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+LVDKNTKV+ QG TG  GTFH+EQAI Y  T++VGG+ P KG +      +++PVF 
Sbjct: 1   MSVLVDKNTKVICQGFTGNQGTFHSEQAIAY-GTKMVGGVSPGKGGSKH----LDLPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TVAEA E+T A AS IYVPP  A DAI+E+I+A I L VCITEGIPVLDMV+VK  L+ S
Sbjct: 56  TVAEAVEKTGATASAIYVPPPFAADAILEAIDAGIELAVCITEGIPVLDMVKVKRALQGS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
           ++RL+GPNCPG++TPD CKIGIMPG I + GSVGI+SRSGTLTYEAV QT+  GLGQST 
Sbjct: 116 NTRLVGPNCPGVITPDECKIGIMPGHIHKPGSVGIVSRSGTLTYEAVAQTTAAGLGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           +GIGGDPV GT FID LE+FL D  T SI+M+GEIGGSAEE+AA+FLK       KKPIV
Sbjct: 176 IGIGGDPVNGTNFIDCLEMFLGDPDTTSIIMIGEIGGSAEEDAAEFLKA---SKVKKPIV 232

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           GF+AG TAPPGR MGHAGA+ISGGKGGAEDK+ AM+ AGI +A SP+ +G +LVE+L 
Sbjct: 233 GFIAGVTAPPGRRMGHAGAIISGGKGGAEDKMEAMRSAGITVAKSPSALGTTLVEVLK 290


>gi|126668315|ref|ZP_01739274.1| succinyl-CoA synthetase subunit alpha [Marinobacter sp. ELB17]
 gi|126627232|gb|EAZ97870.1| succinyl-CoA synthetase subunit alpha [Marinobacter sp. ELB17]
          Length = 290

 Score =  351 bits (900), Expect = 8e-95,   Method: Composition-based stats.
 Identities = 171/298 (57%), Positives = 219/298 (73%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL++K+TKV+ QG TG  GTFH++QAI Y  T +VGG+ P KG T   G    +PVF 
Sbjct: 1   MSILINKDTKVICQGFTGSQGTFHSQQAIEY-GTNMVGGVSPGKGGTEHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E+T A+A+VIYVP     DAIIE+ +A I LIVCITEGIP +DM+  K  +++ 
Sbjct: 56  TVREAVEKTGAHATVIYVPAPFCKDAIIEAADAGIELIVCITEGIPTIDMLYAKEYVDRK 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TP  CKIGIMPG I + G VGI+SRSGTLTYEAV QT+  G GQST 
Sbjct: 116 GVRMIGPNCPGVITPGECKIGIMPGHIHKPGKVGIVSRSGTLTYEAVKQTTDFGYGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L+L   D  TE+IVM+GEIGG+AEEEAA ++K+       KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILKLLQEDPQTEAIVMIGEIGGTAEEEAAAYIKEH----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            ++AG TAPPG+ MGHAGA+ISGGKG A++K  A+ +AG+    S A IG++L E+ G
Sbjct: 232 SYIAGVTAPPGKRMGHAGAIISGGKGTADEKFAALNDAGVKTVRSLADIGKALKEVTG 289


>gi|254510907|ref|ZP_05122974.1| succinyl-CoA synthase, alpha subunit [Rhodobacteraceae bacterium
           KLH11]
 gi|221534618|gb|EEE37606.1| succinyl-CoA synthase, alpha subunit [Rhodobacteraceae bacterium
           KLH11]
          Length = 293

 Score =  351 bits (900), Expect = 1e-94,   Method: Composition-based stats.
 Identities = 198/298 (66%), Positives = 247/298 (82%), Gaps = 5/298 (1%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           M++L+D+NTKV+ QG TG  GTFH+EQAI Y  T +VGG+ P KG        +++PVF 
Sbjct: 1   MAVLIDENTKVICQGFTGSQGTFHSEQAIAY-GTNMVGGVTPGKGGMEH----LDLPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           +V EAK  T ANASVIYVPP  A D+I+E+I+A + +IVCITEGIPVLDM++VK  LE S
Sbjct: 56  SVHEAKAVTEANASVIYVPPPFAADSILEAIDARMEVIVCITEGIPVLDMMKVKRALEGS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
           +SRL+GPNCPG++TP +CKIGIMPG I ++GSVG++SRSGTLTYEAV QT+  GLGQST 
Sbjct: 116 NSRLVGPNCPGVITPGACKIGIMPGHIHKRGSVGVVSRSGTLTYEAVKQTTDVGLGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+KGTE IDVLE FLAD+ T SI+M+GEIGGSAEEEAAQFL DEAK+GRKKP+ 
Sbjct: 176 VGIGGDPIKGTEHIDVLEWFLADDETTSIIMIGEIGGSAEEEAAQFLADEAKKGRKKPVA 235

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           GF+AG+TAPPGR MGHAGA+++GGKGGAEDKI AM+ AGI +A SPA++G +++E +G
Sbjct: 236 GFIAGRTAPPGRRMGHAGAIVAGGKGGAEDKIEAMRAAGIVVAESPAQLGEAVLEAIG 293


>gi|146307522|ref|YP_001187987.1| succinyl-CoA synthetase subunit alpha [Pseudomonas mendocina ymp]
 gi|145575723|gb|ABP85255.1| succinyl-CoA synthetase (ADP-forming) alpha subunit [Pseudomonas
           mendocina ymp]
          Length = 295

 Score =  350 bits (899), Expect = 1e-94,   Method: Composition-based stats.
 Identities = 174/298 (58%), Positives = 216/298 (72%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL++K+TKV+ QG TG  GTFH+EQAI Y  T++VGG+ P KG +   G    +PVF 
Sbjct: 1   MSILINKDTKVICQGFTGSQGTFHSEQAIAY-GTKMVGGVTPGKGGSTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T A ASVIYVP     D+I+E+    I LIVCITEGIP +DM+  K + ++ 
Sbjct: 56  TVKEAVEATGAEASVIYVPAPFCKDSILEAANGGIKLIVCITEGIPTIDMLEAKVKCDEL 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             RLIGPNCPG++TP  CKIGIMPG I   G VGI+SRSGTLTYEAV QT+  G GQST 
Sbjct: 116 GVRLIGPNCPGVITPGECKIGIMPGHIHLPGKVGIVSRSGTLTYEAVKQTTDAGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L+LF  D  TE+IVM+GEIGGSAEEEAA F+K        KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILKLFQEDPKTEAIVMIGEIGGSAEEEAAAFIKAN----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            ++AG TAPPG+ MGHAGA+ISGGKG A++K  A+++AG+    S A IG++L EL G
Sbjct: 232 SYIAGVTAPPGKRMGHAGAIISGGKGTADEKFAALQDAGVKTVRSLADIGKALAELTG 289


>gi|229844848|ref|ZP_04464986.1| succinyl-CoA synthetase alpha subunit [Haemophilus influenzae
           6P18H1]
 gi|229812229|gb|EEP47920.1| succinyl-CoA synthetase alpha subunit [Haemophilus influenzae
           6P18H1]
          Length = 293

 Score =  350 bits (899), Expect = 1e-94,   Method: Composition-based stats.
 Identities = 183/299 (61%), Positives = 222/299 (74%), Gaps = 9/299 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           M+IL+DKNTKV+ QG TG  GTFH+EQA+ Y  TQ+VGG+ P KG T   G    +PVF 
Sbjct: 1   MAILIDKNTKVICQGFTGGQGTFHSEQALAY-GTQLVGGVSPNKGGTTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T A A+VIYVP     DAIIE+I+A I LIVCITEGIP LDM++VK +L ++
Sbjct: 56  TVREAVENTGATATVIYVPAPFCKDAIIEAIDAGIKLIVCITEGIPTLDMLKVKQKLNET 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
              +IGPNCPG++TPD CKIGIMP  I +KG VGI+SRSGTLTYEAV QT+ EG GQST 
Sbjct: 116 GVVMIGPNCPGVITPDECKIGIMPAHIHKKGKVGIVSRSGTLTYEAVKQTTDEGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+LE F  D  TE+IVM+GEIGGSAEEEAA F+KD       KP+V
Sbjct: 176 VGIGGDPIPGSSFIDILERFQQDPETEAIVMIGEIGGSAEEEAAIFIKDN----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
            ++AG TAP G+ MGHAGA+ISGGKG A +KI A++ AG+    S A IG +L +LL S
Sbjct: 232 AYIAGITAPKGKRMGHAGAIISGGKGTAVEKIAALEAAGVTCVKSLAEIGEALRKLLKS 290


>gi|56695261|ref|YP_165609.1| succinyl-CoA synthase, alpha subunit [Ruegeria pomeroyi DSS-3]
 gi|56676998|gb|AAV93664.1| succinyl-CoA synthase, alpha subunit [Ruegeria pomeroyi DSS-3]
          Length = 294

 Score =  350 bits (899), Expect = 1e-94,   Method: Composition-based stats.
 Identities = 205/299 (68%), Positives = 251/299 (83%), Gaps = 5/299 (1%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           M++L+D+NTKV+ QG TG  GTFH+EQAI Y  T++VGG+ P KG     G    +PVF 
Sbjct: 1   MAVLIDENTKVICQGFTGSQGTFHSEQAIAY-GTKMVGGVTPGKGGMEHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           +V EAK  T ANA+VIYVPP  A D+I+E+I+A++ +IVCITEGIPVLDM++VK  LE S
Sbjct: 56  SVHEAKHVTEANATVIYVPPPFAADSILEAIDAQMEVIVCITEGIPVLDMMKVKRALEGS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
           SSRLIGPNCPG++TPD+CKIGIMPG I ++GSVG++SRSGTLTYEAV QTS  GLGQSTA
Sbjct: 116 SSRLIGPNCPGVITPDACKIGIMPGHIHKRGSVGVVSRSGTLTYEAVKQTSDIGLGQSTA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+KGTE IDVLE FLAD+ TESI+M+GEIGGSAEEEAAQFLKDEAK+GRKKP+ 
Sbjct: 176 VGIGGDPIKGTEHIDVLEWFLADDETESIIMIGEIGGSAEEEAAQFLKDEAKKGRKKPVA 235

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
           GF+AG+TAPPGR MGHAGA+++GGKGGAEDKI AM+ AGI +A SPA +G +++E +G 
Sbjct: 236 GFIAGRTAPPGRRMGHAGAIVAGGKGGAEDKIEAMRSAGIVVADSPATLGEAVLEAIGK 294


>gi|239826602|ref|YP_002949226.1| succinyl-CoA synthetase subunit alpha [Geobacillus sp. WCH70]
 gi|239806895|gb|ACS23960.1| succinyl-CoA synthetase, alpha subunit [Geobacillus sp. WCH70]
          Length = 300

 Score =  350 bits (899), Expect = 1e-94,   Method: Composition-based stats.
 Identities = 185/299 (61%), Positives = 234/299 (78%), Gaps = 9/299 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSI ++K+TKV+VQG+TG  G FHT+Q + Y  T++VGG+ P KG T   G    VPVF 
Sbjct: 1   MSIFINKDTKVIVQGITGSQGLFHTKQMLEY-GTKIVGGVTPGKGGTEVEG----VPVFD 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV+EA E+T ANASVIYVPP+ A DAI+E+++AE+ L+VCITEGIPVLDMV+VK  +E  
Sbjct: 56  TVSEAVEKTGANASVIYVPPAFAADAIMEAVDAELDLVVCITEGIPVLDMVKVKRYMEGK 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            +RLIGPNCPG++TP+ CKIGIMPG I +KG VGI+SRSGTLTYEAV Q +Q G+GQSTA
Sbjct: 116 KTRLIGPNCPGVITPEECKIGIMPGYIHKKGHVGIVSRSGTLTYEAVHQLTQAGIGQSTA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPV GT FIDVL+ F  DE T +++M+GEIGG+AEEEAA+++K       KKP+V
Sbjct: 176 VGIGGDPVNGTNFIDVLKAFNEDEETYAVIMIGEIGGTAEEEAAEWVKANM----KKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
           GF+ G+TAPPG+ MGHAGA+ISGGKG A +KI  M E GI +A +PA IG +L+ +L  
Sbjct: 232 GFIGGQTAPPGKRMGHAGAIISGGKGTAAEKIKKMNECGIKVAETPAVIGETLISVLKE 290


>gi|254361865|ref|ZP_04977999.1| succinate--CoA ligase (ADP-forming) [Mannheimia haemolytica PHL213]
 gi|261492659|ref|ZP_05989212.1| succinyl-CoA synthetase alpha subunit [Mannheimia haemolytica
           serotype A2 str. BOVINE]
 gi|261494592|ref|ZP_05991073.1| succinyl-CoA synthetase alpha subunit [Mannheimia haemolytica
           serotype A2 str. OVINE]
 gi|153093404|gb|EDN74395.1| succinate--CoA ligase (ADP-forming) [Mannheimia haemolytica PHL213]
 gi|261309704|gb|EEY10926.1| succinyl-CoA synthetase alpha subunit [Mannheimia haemolytica
           serotype A2 str. OVINE]
 gi|261311818|gb|EEY12968.1| succinyl-CoA synthetase alpha subunit [Mannheimia haemolytica
           serotype A2 str. BOVINE]
          Length = 289

 Score =  350 bits (899), Expect = 1e-94,   Method: Composition-based stats.
 Identities = 182/298 (61%), Positives = 228/298 (76%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL+DKNTKV+ QG TG  GTFH+EQA+ Y  TQ+VGG+ P KG T   G    +PVF 
Sbjct: 1   MSILIDKNTKVICQGFTGGQGTFHSEQALAY-GTQLVGGVSPNKGGTTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T A A+VIYVP  G  DAI+E+I+A I LIVCITEGIP LDM++VK RL ++
Sbjct: 56  TVREAVEATGATATVIYVPAPGCKDAILEAIDAGIQLIVCITEGIPTLDMLQVKQRLNQT 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TPD CKIGIMPG+I +KG++GI+SRSGTLTYEAV QT+ EG GQST 
Sbjct: 116 GVRMIGPNCPGVITPDECKIGIMPGNIHKKGNIGIVSRSGTLTYEAVKQTTDEGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L+LF  D  TE+IVM+GEIGGSAEEEAA F+K+       KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILKLFQDDPETEAIVMIGEIGGSAEEEAAAFIKEN----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            ++AG TAP G+ MGHAGA+ISGGKG A++K   +++AG+    S A IG +L ++LG
Sbjct: 232 SYIAGVTAPKGKRMGHAGAIISGGKGTADEKFKILEDAGVTTVRSLAEIGSALRKILG 289


>gi|330503178|ref|YP_004380047.1| succinyl-CoA synthetase subunit alpha [Pseudomonas mendocina NK-01]
 gi|328917464|gb|AEB58295.1| succinyl-CoA synthetase subunit alpha [Pseudomonas mendocina NK-01]
          Length = 295

 Score =  350 bits (899), Expect = 1e-94,   Method: Composition-based stats.
 Identities = 174/298 (58%), Positives = 215/298 (72%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL++K+TKV+ QG TG  GTFH+EQAI Y  T++VGG+ P KG T   G    +PVF 
Sbjct: 1   MSILINKDTKVICQGFTGSQGTFHSEQAIAY-GTKMVGGVTPGKGGTTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA   T A ASVIYVP     D+I+E+    I LIVCITEGIP +DM+  K + ++ 
Sbjct: 56  TVKEAVAATGAEASVIYVPAPFCKDSILEAANGGIKLIVCITEGIPTIDMLEAKVKCDEL 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             RLIGPNCPG++TP  CKIGIMPG I   G VGI+SRSGTLTYEAV QT+  G GQST 
Sbjct: 116 GVRLIGPNCPGVITPGECKIGIMPGHIHLPGKVGIVSRSGTLTYEAVKQTTDAGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L+LF  D  TE+IVM+GEIGGSAEEEAA F+K        KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILKLFQEDPKTEAIVMIGEIGGSAEEEAAAFIKAN----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            ++AG TAPPG+ MGHAGA+ISGGKG A++K  A+++AG+    S A IG++L EL G
Sbjct: 232 SYIAGVTAPPGKRMGHAGAIISGGKGTADEKFAALQDAGVKTVRSLADIGKALAELTG 289


>gi|253687633|ref|YP_003016823.1| succinyl-CoA synthetase, alpha subunit [Pectobacterium carotovorum
           subsp. carotovorum PC1]
 gi|251754211|gb|ACT12287.1| succinyl-CoA synthetase, alpha subunit [Pectobacterium carotovorum
           subsp. carotovorum PC1]
          Length = 290

 Score =  350 bits (899), Expect = 1e-94,   Method: Composition-based stats.
 Identities = 175/298 (58%), Positives = 221/298 (74%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL++KNTKV+ QG TG  GTFH+EQA+ Y  TQ+VGG+ P KG T   G    +PVF 
Sbjct: 1   MSILINKNTKVICQGFTGSQGTFHSEQALAY-GTQMVGGVTPGKGGTEHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T A ASVIYVP     D+I+E+I+A I LI+CITEGIP LDM+ VK +L++S
Sbjct: 56  TVREAVEATGATASVIYVPAPFCKDSILEAIDAGIELIICITEGIPTLDMLTVKVKLDQS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TP  CKIGIMPG I   G VGI+SRSGTLTYEAV QT+  GLGQS+ 
Sbjct: 116 GVRMIGPNCPGVITPGECKIGIMPGHIHLPGKVGIVSRSGTLTYEAVKQTTDAGLGQSSC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L+LF  D  TE+IVM+GEIGG+AEEEAA ++K+       KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILKLFEQDPQTEAIVMIGEIGGTAEEEAAAYIKEH----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           G++AG TAP G+ MGHAGA+I+GGKG A+DK  A++ AG+    S A IG ++  +L 
Sbjct: 232 GYIAGVTAPKGKRMGHAGAIIAGGKGTADDKFAALEAAGVKTVRSLADIGDAVKAILA 289


>gi|641971|gb|AAA61788.1| succinyl-CoA synthetase alpha chain [Coxiella burnetii]
          Length = 294

 Score =  350 bits (899), Expect = 1e-94,   Method: Composition-based stats.
 Identities = 176/299 (58%), Positives = 225/299 (75%), Gaps = 10/299 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL+DK T+VL QG TGK GTFH+EQAI Y  TQ+VGG+ P KG     G    +P+F 
Sbjct: 1   MSILIDKETRVLCQGFTGKQGTFHSEQAIEY-GTQMVGGVTPGKGGQSHLG----LPIFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           +V EA E T+A+A++I+VP     D+IIE+++A + L+VCITEGIPVLDM+ VKA L + 
Sbjct: 56  SVHEAVEETSADATMIFVPAPFCKDSIIEAVDAGVRLVVCITEGIPVLDMLEVKAYLRQH 115

Query: 121 S-SRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQST 179
              R+IGPNCPG++TP  CKIGIMPG I ++G VGI+SRSGTLTYEAV QT+Q G GQST
Sbjct: 116 PDVRMIGPNCPGVITPGECKIGIMPGHIHQRGKVGIVSRSGTLTYEAVNQTTQMGFGQST 175

Query: 180 AVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPI 239
            VGIGGDP+ GT FIDVLE+F  D  T++IVMVGEIGG+AEEEAA+F++       KKP+
Sbjct: 176 CVGIGGDPIPGTSFIDVLEMFEKDSQTQAIVMVGEIGGTAEEEAAEFIQSN----VKKPV 231

Query: 240 VGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           + ++AG TAPPG+ MGHAGA+I+GGKG A DK  A++ AG+ +  SPA IG+ + E  G
Sbjct: 232 ISYIAGVTAPPGKRMGHAGAIIAGGKGTAADKYAALEAAGVFVVKSPAEIGKGVREATG 290


>gi|227327548|ref|ZP_03831572.1| succinyl-CoA synthetase subunit alpha [Pectobacterium carotovorum
           subsp. carotovorum WPP14]
          Length = 290

 Score =  350 bits (899), Expect = 1e-94,   Method: Composition-based stats.
 Identities = 175/298 (58%), Positives = 222/298 (74%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL++KNTKV+ QG TG  GTFH+EQA+ Y  TQ+VGG+ P KG T   G    +PVF 
Sbjct: 1   MSILINKNTKVICQGFTGSQGTFHSEQALAY-GTQMVGGVTPGKGGTEHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T A ASVIYVP     D+I+E+I+A I LI+CITEGIP LDM+ VK +L++S
Sbjct: 56  TVREAVEATGATASVIYVPAPFCKDSILEAIDAGIELIICITEGIPTLDMLTVKVKLDQS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            +R+IGPNCPG++TP  CKIGIMPG I   G VGI+SRSGTLTYEAV QT+  GLGQS+ 
Sbjct: 116 GARMIGPNCPGVITPGECKIGIMPGHIHLPGKVGIVSRSGTLTYEAVKQTTDAGLGQSSC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L+LF  D  TE+IVM+GEIGG+AEEEAA ++K+       KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILKLFEQDPQTEAIVMIGEIGGTAEEEAAAYIKEH----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           G++AG TAP G+ MGHAGA+I+GGKG A+DK  A++ AG+    S A IG ++  +L 
Sbjct: 232 GYIAGVTAPKGKRMGHAGAIIAGGKGTADDKFAALEAAGVKTVRSLADIGDAVKAILS 289


>gi|126734827|ref|ZP_01750573.1| succinyl-CoA synthetase, alpha subunit [Roseobacter sp. CCS2]
 gi|126715382|gb|EBA12247.1| succinyl-CoA synthetase, alpha subunit [Roseobacter sp. CCS2]
          Length = 293

 Score =  350 bits (899), Expect = 1e-94,   Method: Composition-based stats.
 Identities = 194/298 (65%), Positives = 245/298 (82%), Gaps = 5/298 (1%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           M+ILV++NT+V+ QGLTG  GTFH+EQAI Y  T++VGG+ P KG        +++P+F 
Sbjct: 1   MAILVNENTRVICQGLTGSQGTFHSEQAIAY-GTKMVGGVTPGKGGQTH----LDLPIFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           +V EA  +T ANASVIYVPP  A D+I+E+I+AE+ LI+CITEGIPVLDM+RVK  LE S
Sbjct: 56  SVHEAMAKTEANASVIYVPPPFAADSILEAIDAEMELIICITEGIPVLDMMRVKRALEGS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
           +SRLIGPNCPG++TPD+CKIGIMPG I ++GSVG++SRSGTLTYEAV QTS  GLGQSTA
Sbjct: 116 TSRLIGPNCPGVITPDACKIGIMPGHIHKRGSVGVVSRSGTLTYEAVKQTSDSGLGQSTA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+KGTE IDVL++FL D+ T S++M+GEIGGSAEEEAA+FL  + K+GR KP  
Sbjct: 176 VGIGGDPIKGTEHIDVLDMFLDDDETHSMIMIGEIGGSAEEEAAEFLTAQKKKGRWKPTA 235

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           GF+AG+TAPPGR MGHAGA+++GGKG AE KI AMK AGI +A SPA +G +++E +G
Sbjct: 236 GFIAGRTAPPGRRMGHAGAIVAGGKGDAESKIEAMKSAGIVVADSPATLGEAVLEAIG 293


>gi|322833840|ref|YP_004213867.1| succinyl-CoA synthetase subunit alpha [Rahnella sp. Y9602]
 gi|321169041|gb|ADW74740.1| succinyl-CoA synthetase, alpha subunit [Rahnella sp. Y9602]
          Length = 290

 Score =  350 bits (899), Expect = 1e-94,   Method: Composition-based stats.
 Identities = 173/297 (58%), Positives = 218/297 (73%), Gaps = 9/297 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL++KNTKV+ QG TG  GTFH+EQAI Y  T++VGG+ P KG T   G    +PVF 
Sbjct: 1   MSILINKNTKVICQGFTGSQGTFHSEQAIAY-GTKMVGGVTPGKGGTEHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T A ASVIYVP     D+I+E+++A I LI+CITEGIP LDM+ VK +L++S
Sbjct: 56  TVREAVETTGATASVIYVPAPFCKDSILEALDAGIKLIICITEGIPTLDMLVVKVKLDQS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            + +IGPNCPG++TP  CKIGIMPG I   G VGI+SRSGTLTYEAV QT+  G GQST 
Sbjct: 116 DAVMIGPNCPGVITPGECKIGIMPGHIHLPGKVGIVSRSGTLTYEAVKQTTDYGYGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L+LF  D  TE IVM+GEIGG+AEEEAA ++K        KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILKLFQEDPQTEVIVMIGEIGGNAEEEAAAYIKAH----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELL 297
           G++AG TAP G+ MGHAGA+I+GGKG A++K  A++ AG+    S A IG ++  LL
Sbjct: 232 GYIAGVTAPKGKRMGHAGAIIAGGKGTADEKFAALEAAGVKTVRSLADIGEAVKSLL 288


>gi|15596786|ref|NP_250280.1| succinyl-CoA synthetase subunit alpha [Pseudomonas aeruginosa PAO1]
 gi|107101022|ref|ZP_01364940.1| hypothetical protein PaerPA_01002052 [Pseudomonas aeruginosa PACS2]
 gi|116049534|ref|YP_791662.1| succinyl-CoA synthetase subunit alpha [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|152988843|ref|YP_001349039.1| succinyl-CoA synthetase subunit alpha [Pseudomonas aeruginosa PA7]
 gi|218892454|ref|YP_002441321.1| succinyl-CoA synthetase subunit alpha [Pseudomonas aeruginosa
           LESB58]
 gi|254234689|ref|ZP_04928012.1| succinyl-CoA synthetase alpha chain [Pseudomonas aeruginosa C3719]
 gi|254239936|ref|ZP_04933258.1| succinyl-CoA synthetase alpha chain [Pseudomonas aeruginosa 2192]
 gi|296390036|ref|ZP_06879511.1| succinyl-CoA synthetase subunit alpha [Pseudomonas aeruginosa PAb1]
 gi|313106603|ref|ZP_07792829.1| succinyl-CoA synthetase alpha chain [Pseudomonas aeruginosa 39016]
 gi|12230978|sp|Q51567|SUCD_PSEAE RecName: Full=Succinyl-CoA ligase [ADP-forming] subunit alpha;
           AltName: Full=Succinyl-CoA synthetase subunit alpha;
           Short=SCS-alpha
 gi|9947553|gb|AAG04978.1|AE004587_2 succinyl-CoA synthetase alpha chain [Pseudomonas aeruginosa PAO1]
 gi|115584755|gb|ABJ10770.1| succinyl-CoA synthetase alpha chain [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|126166620|gb|EAZ52131.1| succinyl-CoA synthetase alpha chain [Pseudomonas aeruginosa C3719]
 gi|126193314|gb|EAZ57377.1| succinyl-CoA synthetase alpha chain [Pseudomonas aeruginosa 2192]
 gi|150964001|gb|ABR86026.1| succinyl-CoA synthetase alpha chain [Pseudomonas aeruginosa PA7]
 gi|218772680|emb|CAW28465.1| succinyl-CoA synthetase alpha chain [Pseudomonas aeruginosa LESB58]
 gi|310879331|gb|EFQ37925.1| succinyl-CoA synthetase alpha chain [Pseudomonas aeruginosa 39016]
          Length = 295

 Score =  350 bits (898), Expect = 1e-94,   Method: Composition-based stats.
 Identities = 175/298 (58%), Positives = 216/298 (72%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+TKV+ QG TG  GTFH+EQAI Y  T++VGG+ P KG T   G    +PVF 
Sbjct: 1   MSVLINKDTKVICQGFTGSQGTFHSEQAIAY-GTKMVGGVTPGKGGTTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T A ASVIYVP     D+I+E+    I LIVCITEGIP LDM+  K + ++ 
Sbjct: 56  TVKEAVEATGAEASVIYVPAPFCKDSILEAAFGGIKLIVCITEGIPTLDMLDAKVKCDEL 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             RLIGPNCPG++TP  CKIGIMPG I   G VGI+SRSGTLTYEAV QT+  G GQST 
Sbjct: 116 GVRLIGPNCPGVITPGECKIGIMPGHIHLPGKVGIVSRSGTLTYEAVKQTTDAGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L+LF  D  TE+IVM+GEIGGSAEEEAA F+K        KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILKLFQEDPQTEAIVMIGEIGGSAEEEAAAFIKAN----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            ++AG TAPPG+ MGHAGA+ISGGKG A++K  A+++AG+    S A IG++L EL G
Sbjct: 232 SYIAGVTAPPGKRMGHAGAIISGGKGTADEKFAALQDAGVKTVRSLADIGKALAELTG 289


>gi|152996808|ref|YP_001341643.1| succinyl-CoA synthetase subunit alpha [Marinomonas sp. MWYL1]
 gi|150837732|gb|ABR71708.1| succinyl-CoA synthetase, alpha subunit [Marinomonas sp. MWYL1]
          Length = 290

 Score =  350 bits (898), Expect = 1e-94,   Method: Composition-based stats.
 Identities = 171/298 (57%), Positives = 215/298 (72%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+TKV+ QG TG  GTFH+EQAI Y  T++VGG+ P KG     G    +PVF 
Sbjct: 1   MSVLINKDTKVICQGFTGGQGTFHSEQAIAY-GTKMVGGVTPGKGGQTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E+T A ASVIYVP     D+I+E+  + I LIVCITEG+P LDM+  K + ++ 
Sbjct: 56  TVKEAVEQTGAEASVIYVPAPFCKDSILEAANSGIKLIVCITEGVPTLDMLDCKVKCDEL 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             RLIGPNCPG++TP  CKIGIMPG I   G VGI+SRSGTLTYEAV QT+  G GQST 
Sbjct: 116 GVRLIGPNCPGVITPGECKIGIMPGHIHMPGKVGIVSRSGTLTYEAVKQTTDAGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ GT FIDVLE+F  D  TE+IVM+GEIGG+AEEEAA ++K        KP+V
Sbjct: 176 VGIGGDPIPGTNFIDVLEMFQNDPQTEAIVMIGEIGGTAEEEAAAYIKAN----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            ++AG TAP G+ MGHAGA+ISGGKG A++K  A+++AG+    S A IG +L E+ G
Sbjct: 232 SYIAGVTAPAGKRMGHAGAIISGGKGTADEKFAALQDAGVKTVRSLADIGSALKEITG 289


>gi|254440234|ref|ZP_05053728.1| succinyl-CoA synthetase, alpha subunit subfamily [Octadecabacter
           antarcticus 307]
 gi|198255680|gb|EDY79994.1| succinyl-CoA synthetase, alpha subunit subfamily [Octadecabacter
           antarcticus 307]
          Length = 293

 Score =  350 bits (898), Expect = 1e-94,   Method: Composition-based stats.
 Identities = 191/298 (64%), Positives = 243/298 (81%), Gaps = 5/298 (1%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           M+IL+D+NTKV+ QGLTG  GTFH+EQAI Y  T++VGG+ P KG        +++P+F 
Sbjct: 1   MAILIDENTKVICQGLTGSQGTFHSEQAIAY-GTKMVGGVTPGKGGQTH----LDLPIFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           +V EA   T ANASVIYVPP  A D+I+E+I+AE+ LI+CITEGIPVLDM++VK  LE S
Sbjct: 56  SVHEAMHVTGANASVIYVPPPFAADSILEAIDAEMELIICITEGIPVLDMMKVKRALEGS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            SRLIGPNCPG++TP++CKIGIMPG I ++GSVG++SRSGTLTYEAV QTS  GLGQSTA
Sbjct: 116 KSRLIGPNCPGVITPNACKIGIMPGHIHKRGSVGVVSRSGTLTYEAVKQTSDSGLGQSTA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+KGTE ID+L +FL D+ T S++M+GEIGGSAEEEAA+FL  + K+GR KP  
Sbjct: 176 VGIGGDPIKGTEHIDILNMFLDDDETHSMIMIGEIGGSAEEEAAEFLTAQKKKGRWKPTA 235

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           GF+AG+TAPPGR MGHAGA+++GGKG AE KI AMK+AGI +A SPA +G ++++ +G
Sbjct: 236 GFIAGRTAPPGRRMGHAGAIVAGGKGDAESKIEAMKKAGIIVADSPATLGEAVLKAIG 293


>gi|13235375|emb|CAC33597.1| Succinyl-CoA synthetase alpha subunit [Rickettsia montanensis]
          Length = 292

 Score =  350 bits (898), Expect = 1e-94,   Method: Composition-based stats.
 Identities = 181/299 (60%), Positives = 234/299 (78%), Gaps = 8/299 (2%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           M+IL++K T+V+ QG TG  GTFH+EQAI Y  T +VGG+ P KG        +++PV+ 
Sbjct: 1   MAILINKKTQVICQGFTGSQGTFHSEQAIAY-GTNMVGGVTPGKGGHTH----LDLPVYN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EAK +T ANASVIYVPP  A D+I+E+I+AEI ++VCITEGIPVLDMV+VK  L  S
Sbjct: 56  TVHEAKAKTGANASVIYVPPGFAADSILEAIDAEIEVVVCITEGIPVLDMVKVKRALVGS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            +RLIGPNCPG++TP  CKIGIMPG I ++G++GI+SRSGTLTYEAV QT+  GLGQST 
Sbjct: 116 KTRLIGPNCPGVITPGECKIGIMPGHIHKRGTIGIVSRSGTLTYEAVAQTTTVGLGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPV GT F+D +E+FL D+ T++I+M+GEIGG+AEE+AA+F+K       KKPIV
Sbjct: 176 VGIGGDPVNGTNFVDCIEMFLKDDETKAIIMIGEIGGNAEEDAAEFIKQ---SKIKKPIV 232

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
            F+AG TAPPG+ MGHAGA+I+GG G AEDKI A++ AG+ I  SPA IG+++++LL  
Sbjct: 233 SFIAGITAPPGKRMGHAGAIIAGGTGSAEDKIEALQSAGVTITRSPADIGKTMLDLLNK 291


>gi|89053318|ref|YP_508769.1| succinyl-CoA synthetase (ADP-forming) alpha subunit [Jannaschia sp.
           CCS1]
 gi|88862867|gb|ABD53744.1| succinyl-CoA synthetase (ADP-forming) alpha subunit [Jannaschia sp.
           CCS1]
          Length = 293

 Score =  350 bits (898), Expect = 1e-94,   Method: Composition-based stats.
 Identities = 200/298 (67%), Positives = 245/298 (82%), Gaps = 5/298 (1%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           M++LVD+NTKV+ QG TG  GTFH+EQAI Y  TQ+VGG+ P KG        +++PVF 
Sbjct: 1   MAVLVDENTKVICQGFTGSQGTFHSEQAIEY-GTQMVGGVTPGKGGMTH----LDLPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           +V EA+  T ANASVIYVPP  A D+I+E+I+AE+ LI+CITEGIPVLDM+RVK  LE S
Sbjct: 56  SVHEARHVTDANASVIYVPPPFAADSILEAIDAEMELIICITEGIPVLDMMRVKRALEGS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
           SS L+GPNCPG++TPD+CKIGIMPG I ++GS G++SRSGTLTYEAV QT+  GLGQST 
Sbjct: 116 SSILVGPNCPGVITPDACKIGIMPGHIHKRGSCGVVSRSGTLTYEAVKQTTDVGLGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+KGTE IDVLE FLAD+ TESI+M+GEIGGSAEEEAAQFL DE K+GR KP  
Sbjct: 176 VGIGGDPIKGTEHIDVLEWFLADDETESIIMIGEIGGSAEEEAAQFLADEKKKGRWKPTA 235

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           GF+AG+TAPPGR MGHAGA+++GGKGGAEDKI AMK AGI +A SPA +G ++++ +G
Sbjct: 236 GFIAGRTAPPGRRMGHAGAIVAGGKGGAEDKIEAMKSAGIVVADSPATLGEAVLQAIG 293


>gi|261822340|ref|YP_003260446.1| succinyl-CoA synthetase subunit alpha [Pectobacterium wasabiae
           WPP163]
 gi|261606353|gb|ACX88839.1| succinyl-CoA synthetase, alpha subunit [Pectobacterium wasabiae
           WPP163]
          Length = 290

 Score =  350 bits (898), Expect = 1e-94,   Method: Composition-based stats.
 Identities = 175/297 (58%), Positives = 221/297 (74%), Gaps = 9/297 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL++KNTKV+ QG TG  GTFH+EQA+ Y  TQ+VGG+ P KG T   G    +PVF 
Sbjct: 1   MSILINKNTKVICQGFTGSQGTFHSEQALAY-GTQMVGGVTPGKGGTEHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T A ASVIYVP     D+I+E+I+A I LI+CITEGIP LDM+ VK +L++S
Sbjct: 56  TVREAVEATGATASVIYVPAPFCKDSILEAIDAGIELIICITEGIPTLDMLTVKVKLDQS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TP  CKIGIMPG I   G VGI+SRSGTLTYEAV QT+  GLGQS+ 
Sbjct: 116 GVRMIGPNCPGVITPGECKIGIMPGHIHLPGKVGIVSRSGTLTYEAVKQTTDAGLGQSSC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L+LF  D  TE+IVM+GEIGG+AEEEAA ++K+       KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILKLFEQDPQTEAIVMIGEIGGTAEEEAAAYIKEH----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELL 297
           G++AG TAP G+ MGHAGA+I+GGKG A+DK  A++ AG+    S A IG ++  +L
Sbjct: 232 GYIAGVTAPKGKRMGHAGAIIAGGKGTADDKFAALEAAGVKTVRSLADIGDAVKAIL 288


>gi|254449510|ref|ZP_05062947.1| succinyl-CoA ligase, alpha subunit [Octadecabacter antarcticus 238]
 gi|198263916|gb|EDY88186.1| succinyl-CoA ligase, alpha subunit [Octadecabacter antarcticus 238]
          Length = 293

 Score =  350 bits (898), Expect = 1e-94,   Method: Composition-based stats.
 Identities = 192/298 (64%), Positives = 243/298 (81%), Gaps = 5/298 (1%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           M+IL+D+NTKV+ QGLTG  GTFH+EQAI Y  T++VGG+ P KG        +++P+F 
Sbjct: 1   MAILIDENTKVICQGLTGSQGTFHSEQAIAY-GTKMVGGVTPGKGGQTH----LDLPIFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           +V EAK  T ANASVIYVPP  A D+I+E+I+AE+ LI+CITEGIPVLDM++VK  LE S
Sbjct: 56  SVHEAKHVTEANASVIYVPPPFAADSILEAIDAEMELIICITEGIPVLDMMKVKRALEGS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            SRLIGPNCPG++TP++CKIGIMPG I ++GSVG++SRSGTLTYEAV QTS  GLGQSTA
Sbjct: 116 KSRLIGPNCPGVITPNACKIGIMPGHIHKRGSVGVVSRSGTLTYEAVKQTSDSGLGQSTA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+KGTE ID+L +FL D+ T S++M+GEIGGSAEEEAA+FL  + K+GR KP  
Sbjct: 176 VGIGGDPIKGTEHIDILNMFLDDDETHSMIMIGEIGGSAEEEAAEFLTAQKKKGRWKPTA 235

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           GF+AG+TAPPGR MGHAGA+++GGKG AE KI AMK AGI +A SPA +G ++++ +G
Sbjct: 236 GFIAGRTAPPGRRMGHAGAIVAGGKGDAESKIEAMKSAGIIVADSPATLGEAVLKAIG 293


>gi|4512118|gb|AAD21623.1| succinyl-CoA synthetase alpha subunit [Pseudomonas aeruginosa PAO1]
          Length = 295

 Score =  350 bits (898), Expect = 1e-94,   Method: Composition-based stats.
 Identities = 174/298 (58%), Positives = 215/298 (72%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+TKV+ QG TG  GTFH+EQAI Y  T++VGG+ P KG T   G    +PVF 
Sbjct: 1   MSVLINKDTKVICQGFTGSQGTFHSEQAIAY-GTKMVGGVTPGKGGTTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T A ASVIYVP     D+I+E+    I LIVCITEGIP LDM+  K + ++ 
Sbjct: 56  TVKEAVEATGAEASVIYVPAPFCKDSILEAAFGGIKLIVCITEGIPTLDMLDAKVKCDEL 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             RLIGPNCPG++TP  CKIGIMPG I   G VGI+SRSGTLTYEAV QT+  G GQST 
Sbjct: 116 GVRLIGPNCPGVITPGECKIGIMPGHIHLPGKVGIVSRSGTLTYEAVKQTTDAGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L+ F  D  TE+IVM+GEIGGSAEEEAA F+K        KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILKRFQEDPQTEAIVMIGEIGGSAEEEAAAFIKAN----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            ++AG TAPPG+ MGHAGA+ISGGKG A++K  A+++AG+    S A IG++L EL G
Sbjct: 232 SYIAGVTAPPGKRMGHAGAIISGGKGTADEKFAALQDAGVKTVRSLADIGKALAELTG 289


>gi|126730340|ref|ZP_01746151.1| succinyl-CoA synthetase, alpha subunit [Sagittula stellata E-37]
 gi|126709073|gb|EBA08128.1| succinyl-CoA synthetase, alpha subunit [Sagittula stellata E-37]
          Length = 295

 Score =  350 bits (898), Expect = 1e-94,   Method: Composition-based stats.
 Identities = 194/299 (64%), Positives = 243/299 (81%), Gaps = 5/299 (1%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           M++L+D+NTKV+ QG TG  GTFH+EQAI Y  T++VGG+ P KG        +++PVF 
Sbjct: 1   MAVLIDENTKVICQGFTGSQGTFHSEQAIAY-GTKMVGGVTPGKGGQTH----LDLPVFD 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           +V EAK +T ANASVIYVPP  A D+I+E+I+AE+ LIVCITEGIPVLDM++VK  LE S
Sbjct: 56  SVHEAKAKTEANASVIYVPPPFAADSILEAIDAEMELIVCITEGIPVLDMMKVKRALENS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            S LIGPNCPG++TPD+CKIGIMPG I ++G VG++SRSGTLTYEAV QT+  GLGQST 
Sbjct: 116 KSTLIGPNCPGVITPDACKIGIMPGHIHKRGKVGVVSRSGTLTYEAVKQTTDVGLGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+KGTE IDVLE FLAD+ TE+I+M+GEIGGSAEE+AA FL  E K+GR KP  
Sbjct: 176 VGIGGDPIKGTEHIDVLEWFLADDETEAIIMIGEIGGSAEEDAAAFLASEKKKGRWKPTA 235

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
           GF+AG+TAPPGR MGHAGA+++GGKGGA+DKI AMK AGI +A SPA +G +++E + +
Sbjct: 236 GFIAGRTAPPGRRMGHAGAIVAGGKGGADDKIEAMKAAGIVVADSPATLGEAVLEAIKN 294


>gi|254467250|ref|ZP_05080661.1| succinyl-CoA synthase, alpha subunit [Rhodobacterales bacterium
           Y4I]
 gi|206688158|gb|EDZ48640.1| succinyl-CoA synthase, alpha subunit [Rhodobacterales bacterium
           Y4I]
          Length = 294

 Score =  350 bits (898), Expect = 1e-94,   Method: Composition-based stats.
 Identities = 201/299 (67%), Positives = 247/299 (82%), Gaps = 5/299 (1%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           M++L+D+NTKV+ QG TG  GTFH+EQAI Y  T++VGG+ P KG        +N+PVF 
Sbjct: 1   MAVLIDENTKVICQGFTGSQGTFHSEQAIAY-GTKMVGGVTPGKGGQTH----LNLPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           +V EAK  T ANA+VIYVPP  A D+I+E+I+AE+ +IV ITEGIPVLDM++VK  LE S
Sbjct: 56  SVHEAKHVTEANATVIYVPPPFAADSILEAIDAEMEVIVAITEGIPVLDMMKVKRALENS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            S LIGPNCPG++TPD+CKIGIMPG I R+GSVG++SRSGTLTYEAV QT+  GLGQST 
Sbjct: 116 KSTLIGPNCPGVITPDACKIGIMPGHIHRRGSVGVVSRSGTLTYEAVKQTTDVGLGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+KGTE IDVLE FLAD+ TESI+M+GEIGGSAEEEAAQFLKDEAK+GR KP+ 
Sbjct: 176 VGIGGDPIKGTEHIDVLEWFLADDETESIIMIGEIGGSAEEEAAQFLKDEAKKGRSKPVA 235

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
           GF+AG+TAPPGR MGHAGA+++GGKGGAEDKI AMK AGI +A SPA +G ++++ +G 
Sbjct: 236 GFIAGRTAPPGRRMGHAGAIVAGGKGGAEDKIEAMKSAGIVVAESPAGLGEAVLKAIGK 294


>gi|121602296|ref|YP_988363.1| succinyl-CoA synthetase subunit alpha [Bartonella bacilliformis
           KC583]
 gi|120614473|gb|ABM45074.1| succinyl-CoA synthetase alpha chain [Bartonella bacilliformis
           KC583]
          Length = 300

 Score =  350 bits (898), Expect = 2e-94,   Method: Composition-based stats.
 Identities = 236/299 (78%), Positives = 272/299 (90%), Gaps = 1/299 (0%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTG-GNVNVPVF 59
           MSIL++K+TKVLVQGLTGK GTFHTEQA+ Y  TQ+VGGI+PKKG   WTG     +P+F
Sbjct: 1   MSILINKDTKVLVQGLTGKTGTFHTEQALAYHGTQMVGGINPKKGGETWTGAKGETLPIF 60

Query: 60  TTVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEK 119
            +V E KE+T ANASVIYVPP+GA DAIIE+I+AEI LIVCITEGIPV+DMVRVKA+LEK
Sbjct: 61  ASVTEGKEKTGANASVIYVPPAGAADAIIEAIKAEIDLIVCITEGIPVMDMVRVKAKLEK 120

Query: 120 SSSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQST 179
           S SRLIGPNCPGILTPD CKIGIMPGSIF+KGSVG++SRSGTLTYEAVFQTS EGLGQ+T
Sbjct: 121 SKSRLIGPNCPGILTPDECKIGIMPGSIFKKGSVGVVSRSGTLTYEAVFQTSHEGLGQTT 180

Query: 180 AVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPI 239
           A+GIGGDPVKGTEFIDVLE+FLAD+ TESIVM+GEIGGSAEEEAAQFLKDEAK+GRKKP+
Sbjct: 181 AIGIGGDPVKGTEFIDVLEMFLADDETESIVMIGEIGGSAEEEAAQFLKDEAKKGRKKPM 240

Query: 240 VGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           VGF+AG+TAPPGRTMGHAGAVISGGKGGAEDKI AM+ AGI ++PSP+++G++LV +L 
Sbjct: 241 VGFIAGRTAPPGRTMGHAGAVISGGKGGAEDKIAAMESAGIRVSPSPSQVGKTLVSVLK 299


>gi|84515873|ref|ZP_01003234.1| Succinyl-CoA synthetase, alpha subunit [Loktanella vestfoldensis
           SKA53]
 gi|84510315|gb|EAQ06771.1| Succinyl-CoA synthetase, alpha subunit [Loktanella vestfoldensis
           SKA53]
          Length = 293

 Score =  350 bits (898), Expect = 2e-94,   Method: Composition-based stats.
 Identities = 198/298 (66%), Positives = 247/298 (82%), Gaps = 5/298 (1%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           M+ILV++NT+V+ QGLTG  GTFH+EQAI Y  T++VGG+ P KG +      +++PVF 
Sbjct: 1   MAILVNENTRVICQGLTGSQGTFHSEQAIAY-GTKMVGGVTPGKGGSTH----LDLPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           +V EA+  T ANASVIYVPP  A D+I+E+I+AE+ LI+CITEGIPVLDM++VK  LE S
Sbjct: 56  SVHEARHVTQANASVIYVPPPFAADSILEAIDAEMELIICITEGIPVLDMMKVKRALEGS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            SRLIGPNCPG++TPD+CKIGIMPG I R+GSVG++SRSGTLTYEAV QTS  GLGQSTA
Sbjct: 116 KSRLIGPNCPGVITPDACKIGIMPGHIHRRGSVGVVSRSGTLTYEAVKQTSDSGLGQSTA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+KG+E ID+LE+FLAD+ T SI+M+GEIGGSAEEEAAQFL DE K+GR KP  
Sbjct: 176 VGIGGDPIKGSEHIDILEMFLADDETHSIIMIGEIGGSAEEEAAQFLADERKKGRWKPTA 235

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           GF+AG+TAPPGR MGHAGA+++GGKG AE KI AMK AGI +A SPA +G ++++ +G
Sbjct: 236 GFIAGRTAPPGRRMGHAGAIVAGGKGDAESKIEAMKSAGIIVADSPATLGEAVLKAIG 293


>gi|254461601|ref|ZP_05075017.1| succinyl-CoA synthase, alpha subunit [Rhodobacterales bacterium
           HTCC2083]
 gi|206678190|gb|EDZ42677.1| succinyl-CoA synthase, alpha subunit [Rhodobacteraceae bacterium
           HTCC2083]
          Length = 293

 Score =  350 bits (898), Expect = 2e-94,   Method: Composition-based stats.
 Identities = 201/298 (67%), Positives = 248/298 (83%), Gaps = 5/298 (1%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           M++LVD+NTKV+ QGLTG  GTFH+EQAI Y  T++VGG+ P KG T      +++PVF 
Sbjct: 1   MAVLVDENTKVICQGLTGSQGTFHSEQAIAY-GTKMVGGVTPGKGGTTH----LDLPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           +V EA+  T ANASVIYVPP  A D+I+E+I+AE+ LIVCITEGIPVLDM+RV+  LE S
Sbjct: 56  SVHEARHVTEANASVIYVPPPFAADSILEAIDAEMELIVCITEGIPVLDMMRVQRALEGS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
           SSRLIGPNCPG++TPD+CKIGIMPG I ++GS G++SRSGTLTYEAV QT+  GLGQS+A
Sbjct: 116 SSRLIGPNCPGVITPDACKIGIMPGHIHKRGSCGVVSRSGTLTYEAVKQTTDLGLGQSSA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+KGTE IDVLE+FL D  T+SI+M+GEIGGSAEEEAAQFL DE K+GR KP  
Sbjct: 176 VGIGGDPIKGTEHIDVLEMFLGDPETQSIIMIGEIGGSAEEEAAQFLADEKKKGRWKPTA 235

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           GF+AG+TAPPGR MGHAGA+++GGKGGAEDKI AM+ AGI +A SPA +G +++E +G
Sbjct: 236 GFIAGRTAPPGRRMGHAGAIVAGGKGGAEDKIEAMRSAGIVVADSPATLGEAVIEAIG 293


>gi|109898122|ref|YP_661377.1| succinyl-CoA synthetase, alpha subunit [Pseudoalteromonas atlantica
           T6c]
 gi|109700403|gb|ABG40323.1| succinyl-CoA synthetase (ADP-forming) alpha subunit
           [Pseudoalteromonas atlantica T6c]
          Length = 290

 Score =  350 bits (897), Expect = 2e-94,   Method: Composition-based stats.
 Identities = 175/298 (58%), Positives = 218/298 (73%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L+DKNTKV+ QG TG  GTFH+EQAI Y  TQ+VGG+ P KG T   G    +PVF 
Sbjct: 1   MSVLIDKNTKVICQGFTGGQGTFHSEQAIEY-GTQMVGGVTPGKGGTTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA + T A A+VIYVP     D+I+E+ +A I LIVCITEGIP LDM+ VK  + + 
Sbjct: 56  TVREAVQETGATATVIYVPAPFCKDSIVEAADAGIELIVCITEGIPTLDMLYVKEYVNRK 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TP  CKIGIMPG I + G VGI+SRSGTLTYEAV QT+ EG GQST 
Sbjct: 116 GVRMIGPNCPGVITPGECKIGIMPGHIHKPGKVGIVSRSGTLTYEAVKQTTDEGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L++F  D  TE+IVM+GEIGG+AEEEAA F+K        KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILQMFQDDPKTEAIVMIGEIGGTAEEEAAAFIKAN----ITKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            ++AG TAP G+ MGHAGA+ISGGKG A+DK  A+++AG+    S A IG+ L E+ G
Sbjct: 232 SYIAGVTAPAGKRMGHAGAIISGGKGTADDKFKALEDAGVKTVRSLADIGQGLREITG 289


>gi|332306152|ref|YP_004434003.1| succinyl-CoA synthetase, alpha subunit [Glaciecola agarilytica
           4H-3-7+YE-5]
 gi|332173481|gb|AEE22735.1| succinyl-CoA synthetase, alpha subunit [Glaciecola agarilytica
           4H-3-7+YE-5]
          Length = 290

 Score =  350 bits (897), Expect = 2e-94,   Method: Composition-based stats.
 Identities = 176/298 (59%), Positives = 218/298 (73%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L+DKNTKV+ QG TG  GTFH+EQAI Y  TQ+VGG+ P KG T   G    +PVF 
Sbjct: 1   MSVLIDKNTKVICQGFTGGQGTFHSEQAIEY-GTQMVGGVTPGKGGTTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T A A+VIYVP     D+I+E+ +A I LIVCITEGIP LDM+ VK  + + 
Sbjct: 56  TVREAVEETGATATVIYVPAPFCKDSIVEAADAGIELIVCITEGIPTLDMLYVKEYVNRK 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TP  CKIGIMPG I + G VGI+SRSGTLTYEAV QT+ EG GQST 
Sbjct: 116 GVRMIGPNCPGVITPGECKIGIMPGHIHKPGKVGIVSRSGTLTYEAVKQTTDEGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L++F  D  TE+IVM+GEIGG+AEEEAA F+K        KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILQMFQDDPKTEAIVMIGEIGGTAEEEAAAFIKAN----ITKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            ++AG TAP G+ MGHAGA+ISGGKG A+DK  A+++AG+    S A IG+ L E+ G
Sbjct: 232 SYIAGVTAPAGKRMGHAGAIISGGKGTADDKFKALEDAGVKTVRSLAEIGQGLREITG 289


>gi|138894730|ref|YP_001125183.1| succinyl-CoA synthetase subunit alpha [Geobacillus
           thermodenitrificans NG80-2]
 gi|196247651|ref|ZP_03146353.1| succinyl-CoA synthetase, alpha subunit [Geobacillus sp. G11MC16]
 gi|134266243|gb|ABO66438.1| Succinyl-CoA synthetase (alpha subunit) [Geobacillus
           thermodenitrificans NG80-2]
 gi|196212435|gb|EDY07192.1| succinyl-CoA synthetase, alpha subunit [Geobacillus sp. G11MC16]
          Length = 300

 Score =  350 bits (897), Expect = 2e-94,   Method: Composition-based stats.
 Identities = 184/299 (61%), Positives = 232/299 (77%), Gaps = 9/299 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+ V+K+TKV+VQG+TG  G FHT+Q I Y  T +VGG+ P KG T   G    VPVF 
Sbjct: 1   MSVFVNKDTKVIVQGITGSQGLFHTKQMIEY-GTNIVGGVTPGKGGTEVEG----VPVFD 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV+EA E+T ANASVIYVPP+ A DAI+E+++AE+ L+VCITEGIPVLDMV+VK  +E  
Sbjct: 56  TVSEAVEKTGANASVIYVPPAFAADAIMEAVDAELDLVVCITEGIPVLDMVKVKRYMEGK 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            +RLIGPNCPG++TP+ CKIGIMPG I +KG VGI+SRSGTLTYEAV Q +Q G+GQSTA
Sbjct: 116 KTRLIGPNCPGVITPEECKIGIMPGYIHKKGHVGIVSRSGTLTYEAVHQLTQAGIGQSTA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPV GT FIDVL+ F  D+ T +++M+GEIGG+AEEEAA+++K        KP+V
Sbjct: 176 VGIGGDPVNGTNFIDVLKAFNEDDETYAVIMIGEIGGTAEEEAAEWVKANM----TKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
           GF+ G+TAPPG+ MGHAGA+ISGGKG A +KI  M E GI +A +PA IG +L+ +L  
Sbjct: 232 GFIGGQTAPPGKRMGHAGAIISGGKGTAAEKIKKMNECGIKVAETPAVIGETLISVLKE 290


>gi|242238593|ref|YP_002986774.1| succinyl-CoA synthetase subunit alpha [Dickeya dadantii Ech703]
 gi|242130650|gb|ACS84952.1| succinyl-CoA synthetase, alpha subunit [Dickeya dadantii Ech703]
          Length = 290

 Score =  350 bits (897), Expect = 2e-94,   Method: Composition-based stats.
 Identities = 175/298 (58%), Positives = 222/298 (74%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL+DKNTKV+ QG TG  G+FH+EQA+ Y  TQ+VGG+ P KG T   G    +PVF 
Sbjct: 1   MSILIDKNTKVICQGFTGSQGSFHSEQALAY-GTQMVGGVTPGKGGTVHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T A ASVIYVP     D+I+E+I+A I LI+CITEGIP LDM+ VK +LE++
Sbjct: 56  TVREAVEATGAIASVIYVPAPFCKDSILEAIDAGIQLIICITEGIPTLDMLTVKVKLEQT 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TP  CKIGIMPG I   G+VGI+SRSGTLTYEAV QT+  GLGQS+ 
Sbjct: 116 GVRMIGPNCPGVITPGECKIGIMPGHIHLPGNVGIVSRSGTLTYEAVKQTTDTGLGQSSC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L+LF  D  TE+IVM+GEIGG+AEEEAA ++K+       KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILKLFEQDPQTEAIVMIGEIGGTAEEEAAAYIKEH----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           G++AG TAP G+ MGHAGA+I+GGKG A+DK  A++ AG+    S A IG ++  +L 
Sbjct: 232 GYIAGVTAPKGKRMGHAGAIIAGGKGTADDKFAALEAAGVKTVRSLADIGEAVKSVLN 289


>gi|197103625|ref|YP_002129002.1| succinyl-CoA synthetase alpha-subunit [Phenylobacterium zucineum
           HLK1]
 gi|196477045|gb|ACG76573.1| succinyl-CoA synthetase alpha-subunit [Phenylobacterium zucineum
           HLK1]
          Length = 292

 Score =  350 bits (897), Expect = 2e-94,   Method: Composition-based stats.
 Identities = 204/298 (68%), Positives = 248/298 (83%), Gaps = 8/298 (2%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL+ K+T+V+ QG+TG  GTFHTEQAI Y  T++VGG+ P KG     G    +PVF 
Sbjct: 1   MSILIGKDTRVICQGITGSQGTFHTEQAIAY-GTKMVGGVTPGKGGQTHVG----LPVFD 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TVAEA + T A ASVIYVPP  A D+I+E+I+AE+PLIVCITEGIPV DM++VK  L  S
Sbjct: 56  TVAEAVKETGAEASVIYVPPPFAADSILEAIDAEVPLIVCITEGIPVTDMIKVKRALSGS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            SRLIGPNCPG+LTP  CKIGIMPG+IF++GSVG++SRSGTLTYEAVFQT+Q GLGQ+TA
Sbjct: 116 KSRLIGPNCPGVLTPGECKIGIMPGNIFKRGSVGVVSRSGTLTYEAVFQTTQVGLGQTTA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPVKGTEFIDVL++FL D  TESI+M+GEIGGSAEE+AA+F+K+      KKP+V
Sbjct: 176 VGIGGDPVKGTEFIDVLDMFLKDPETESIIMIGEIGGSAEEDAAEFIKN---SAIKKPMV 232

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           GF+AG+TAPPGR MGHAGA+ISGGKGGAEDKI AM+ AGI ++PSPA++G +LVE+L 
Sbjct: 233 GFIAGRTAPPGRRMGHAGAIISGGKGGAEDKIAAMEAAGIRVSPSPAKLGETLVEVLK 290


>gi|85709013|ref|ZP_01040079.1| succinyl-CoA synthetase, alpha subunit [Erythrobacter sp. NAP1]
 gi|85690547|gb|EAQ30550.1| succinyl-CoA synthetase, alpha subunit [Erythrobacter sp. NAP1]
          Length = 296

 Score =  350 bits (897), Expect = 2e-94,   Method: Composition-based stats.
 Identities = 202/300 (67%), Positives = 245/300 (81%), Gaps = 5/300 (1%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSILV+K+TKV+ QG+TG  GTFHT+QA+ Y  T++V G+ P KG T   G    +P F 
Sbjct: 1   MSILVNKDTKVITQGMTGNTGTFHTQQALDY-GTKMVAGVTPGKGGTEHIG----LPQFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EAKE T A AS IYVPP  A DAI E+I+AE+ LI+CITEGIPVLDMVR KA L  S
Sbjct: 56  TVREAKEATGATASCIYVPPPFAADAICEAIDAEMELIICITEGIPVLDMVRAKAALTGS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            SRLIGPNCPG+LTP+ CKIGIMPGSIF+KGSVG++SRSGTLTYEAV QT+Q GLGQ+TA
Sbjct: 116 KSRLIGPNCPGVLTPEECKIGIMPGSIFKKGSVGVVSRSGTLTYEAVHQTTQVGLGQTTA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPV GT FIDVL+LFL D  T+SI+M+GEIGGSAEEEAA+F+K EA +GR KP V
Sbjct: 176 VGIGGDPVNGTNFIDVLDLFLDDPETKSIIMIGEIGGSAEEEAAEFIKQEAAKGRSKPTV 235

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGSL 300
           GF+AG+TAPPGR MGHAGA++SGG+GGA+DKI AM++AGI ++PSP+ +G +L  +L  +
Sbjct: 236 GFIAGRTAPPGRRMGHAGAIVSGGQGGADDKIAAMEDAGIRVSPSPSELGTTLDAMLKEM 295


>gi|29654689|ref|NP_820381.1| succinate-CoA ligase (ADP-forming), alpha subunit [Coxiella
           burnetii RSA 493]
 gi|153207709|ref|ZP_01946356.1| succinate-CoA ligase (ADP-forming), alpha subunit [Coxiella
           burnetii 'MSU Goat Q177']
 gi|154706949|ref|YP_001424007.1| succinyl-CoA synthetase alpha chain [Coxiella burnetii Dugway
           5J108-111]
 gi|212212235|ref|YP_002303171.1| succinyl-CoA synthetase alpha chain [Coxiella burnetii CbuG_Q212]
 gi|212218993|ref|YP_002305780.1| succinyl-CoA synthetase alpha chain [Coxiella burnetii CbuK_Q154]
 gi|30581056|sp|P53591|SUCD_COXBU RecName: Full=Succinyl-CoA ligase [ADP-forming] subunit alpha;
           AltName: Full=Succinyl-CoA synthetase subunit alpha;
           Short=SCS-alpha
 gi|29541957|gb|AAO90895.1| succinyl-CoA synthetase alpha chain [Coxiella burnetii RSA 493]
 gi|120576405|gb|EAX33029.1| succinate-CoA ligase (ADP-forming), alpha subunit [Coxiella
           burnetii 'MSU Goat Q177']
 gi|154356235|gb|ABS77697.1| succinyl-CoA synthetase alpha chain [Coxiella burnetii Dugway
           5J108-111]
 gi|212010645|gb|ACJ18026.1| succinyl-CoA synthetase alpha chain [Coxiella burnetii CbuG_Q212]
 gi|212013255|gb|ACJ20635.1| succinyl-CoA synthetase alpha chain [Coxiella burnetii CbuK_Q154]
          Length = 294

 Score =  349 bits (896), Expect = 2e-94,   Method: Composition-based stats.
 Identities = 176/299 (58%), Positives = 225/299 (75%), Gaps = 10/299 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL+DK T+VL QG TGK GTFH+EQAI Y  TQ+VGG+ P KG     G    +P+F 
Sbjct: 1   MSILIDKETRVLCQGFTGKQGTFHSEQAIEY-GTQMVGGVTPGKGGQSHLG----LPIFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           +V EA E T+A+A++I+VP     D+IIE+++A + L+VCITEGIPVLDM+ VKA L + 
Sbjct: 56  SVHEAVEETSADATMIFVPAPFCKDSIIEAVDAGVRLVVCITEGIPVLDMLEVKAYLRQH 115

Query: 121 S-SRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQST 179
              R+IGPNCPG++TP  CKIGIMPG I ++G VGI+SRSGTLTYEAV QT+Q G GQST
Sbjct: 116 PDVRMIGPNCPGVITPGECKIGIMPGHIHQRGKVGIVSRSGTLTYEAVNQTTQMGFGQST 175

Query: 180 AVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPI 239
            VGIGGDP+ GT FIDVLE+F  D  T++IVMVGEIGG+AEEEAA+F++       KKP+
Sbjct: 176 CVGIGGDPIPGTSFIDVLEMFEKDSQTQAIVMVGEIGGTAEEEAAEFIQSN----VKKPV 231

Query: 240 VGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           + ++AG TAPPG+ MGHAGA+I+GGKG A DK  A++ AG+ +  SPA IG+ + E  G
Sbjct: 232 ISYIAGVTAPPGKRMGHAGAIIAGGKGTAADKYAALEAAGVFVVKSPAEIGKGVAEATG 290


>gi|83647428|ref|YP_435863.1| succinyl-CoA synthetase subunit alpha [Hahella chejuensis KCTC
           2396]
 gi|83635471|gb|ABC31438.1| Succinyl-CoA synthetase, alpha subunit [Hahella chejuensis KCTC
           2396]
          Length = 291

 Score =  349 bits (896), Expect = 2e-94,   Method: Composition-based stats.
 Identities = 174/298 (58%), Positives = 218/298 (73%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL+DKNTKV+ QG TG  GTFH+EQAI Y  T++VGG+ P KG     G    +PVF 
Sbjct: 1   MSILIDKNTKVICQGFTGSQGTFHSEQAIAY-GTKMVGGVTPGKGGQTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E+T A ASVIYVP     D+I+E+  A I LIVCITEGIP LDM+  K + ++ 
Sbjct: 56  TVKEAVEQTGAEASVIYVPAPFCKDSILEAANAGIKLIVCITEGIPTLDMLDAKVKCDEL 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             RLIGPNCPG++TP  CKIGIMPG I + G VGI+SRSGTLTYEAV QT+  G GQST 
Sbjct: 116 GVRLIGPNCPGVITPGECKIGIMPGHIHKPGKVGIVSRSGTLTYEAVKQTTDFGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+LE+F  D  TE+IVM+GEIGG+AEEEAA+F+K+       KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILEMFQKDAQTEAIVMIGEIGGTAEEEAAEFIKNN----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            ++AG TAP G+ MGHAGA+I+GGKG A +K  A+++AG+    S A IG++L E+ G
Sbjct: 232 SYIAGVTAPAGKRMGHAGAIIAGGKGTAAEKFAALEQAGVKTVRSLADIGKALAEVTG 289


>gi|15602146|ref|NP_245218.1| hypothetical protein PM0281 [Pasteurella multocida subsp. multocida
           str. Pm70]
 gi|12720513|gb|AAK02365.1| SucD [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 289

 Score =  349 bits (896), Expect = 3e-94,   Method: Composition-based stats.
 Identities = 178/298 (59%), Positives = 225/298 (75%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL++K+TKV+ QG TG  GTFH+EQA+ Y  TQ+VGG+ P KG T   G    +PVF 
Sbjct: 1   MSILINKDTKVICQGFTGGQGTFHSEQALAY-GTQLVGGVSPGKGGTTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV +A + T A ASVIYVP  G  DAI+E+I+A I L++CITEGIP LDM++VK RL ++
Sbjct: 56  TVRDAVDATGATASVIYVPAPGCKDAILEAIDAGIQLVICITEGIPTLDMLQVKQRLNQT 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TP+ CKIGIMPG+I +KG +GI+SRSGTLTYEAV QT+ EG GQST 
Sbjct: 116 GVRMIGPNCPGVITPEECKIGIMPGNIHKKGKIGIVSRSGTLTYEAVKQTTDEGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L+LF  D  TE+IVM+GEIGGSAEEEAA F+KD       KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILKLFQDDPQTEAIVMIGEIGGSAEEEAAAFIKDY----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            ++AG TAP G+ MGHAGA+ISGGKG A++K  A++ AG+    S A IG +L  LL 
Sbjct: 232 SYIAGVTAPKGKRMGHAGAIISGGKGTADEKFAALEAAGVKTVRSLAEIGAALKALLK 289


>gi|120554085|ref|YP_958436.1| succinyl-CoA synthetase, alpha subunit [Marinobacter aquaeolei VT8]
 gi|120323934|gb|ABM18249.1| succinyl-CoA synthetase (ADP-forming) alpha subunit [Marinobacter
           aquaeolei VT8]
          Length = 290

 Score =  349 bits (896), Expect = 3e-94,   Method: Composition-based stats.
 Identities = 174/298 (58%), Positives = 222/298 (74%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL++K+TKV+ QG TG  GTFH+EQAI Y  T++VGG+ P KG T   G    +PVF 
Sbjct: 1   MSILINKDTKVICQGFTGAQGTFHSEQAIAY-GTKMVGGVSPGKGGTEHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E+T A A+VIYVP     DAIIE+ +A I LIVCITEGIP +DM+  K  +++ 
Sbjct: 56  TVREAVEKTGAEATVIYVPAPFCKDAIIEAADAGIQLIVCITEGIPTIDMLYAKEYVDRK 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TPD CKIGIMPG I +KG VGI+SRSGTLTYEAV QT+  G GQST 
Sbjct: 116 GVRMIGPNCPGVITPDECKIGIMPGHIHKKGKVGIVSRSGTLTYEAVKQTTDFGYGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           +GIGGDP+ G+ FID+L+L   D  TE+IVM+GEIGG+AEEEAA F+K+       KP+V
Sbjct: 176 IGIGGDPIPGSNFIDILKLLQEDPETEAIVMIGEIGGTAEEEAAAFIKEN----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            ++AG TAPPG+ MGHAGA+ISGGKG A++K  A+++AG+    S A IG++L E+ G
Sbjct: 232 SYIAGVTAPPGKRMGHAGAIISGGKGTADEKFAALEDAGVKTVRSLAEIGKALKEVTG 289


>gi|157964515|ref|YP_001499339.1| succinyl-CoA synthetase subunit alpha [Rickettsia massiliae MTU5]
 gi|157844291|gb|ABV84792.1| Succinyl-CoA synthetase alpha chain [Rickettsia massiliae MTU5]
          Length = 292

 Score =  349 bits (896), Expect = 3e-94,   Method: Composition-based stats.
 Identities = 178/299 (59%), Positives = 234/299 (78%), Gaps = 8/299 (2%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           M+IL++K T+V+ QG TG  GTFH+EQAI Y  T +VGG+ P KG        +++PV+ 
Sbjct: 1   MAILINKKTQVICQGFTGSQGTFHSEQAIAY-GTNMVGGVTPGKGGHTH----LDLPVYN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EAK +T ANASVIYVPP  A D+I+E+I+A+I ++VCITEGIPVLDMV+VK  L  S
Sbjct: 56  TVHEAKAKTGANASVIYVPPGFAADSILEAIDAKIEVVVCITEGIPVLDMVKVKRALVGS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            +RLIGPNCPG++TP  CKIGIMPG I ++G++GI+SRSGTLTYEAV QT+  GLGQST 
Sbjct: 116 KTRLIGPNCPGVITPGECKIGIMPGHIHKRGTIGIVSRSGTLTYEAVAQTTAVGLGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPV GT F+D +E+FL D+ T++I+M+GEIGG+AEE+AA+F+K       KKPIV
Sbjct: 176 VGIGGDPVNGTNFVDCIEMFLKDDETKAIIMIGEIGGNAEEDAAEFIKQ---SKIKKPIV 232

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
            F+AG TAPPG+ MGHAGA+I+GG G A+DK+ A++ AG+ I  SPA IG+++++LL  
Sbjct: 233 SFIAGITAPPGKRMGHAGAIIAGGTGSAKDKLEALQSAGVTITRSPADIGKTMLDLLNK 291


>gi|260576569|ref|ZP_05844557.1| succinyl-CoA synthetase, alpha subunit [Rhodobacter sp. SW2]
 gi|259021173|gb|EEW24481.1| succinyl-CoA synthetase, alpha subunit [Rhodobacter sp. SW2]
          Length = 294

 Score =  349 bits (896), Expect = 3e-94,   Method: Composition-based stats.
 Identities = 195/299 (65%), Positives = 242/299 (80%), Gaps = 5/299 (1%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           M++LV+K T+V+ QG TG  GTFH+EQAI Y  T++VGG+ P KG +      +++PVF 
Sbjct: 1   MAVLVNKTTRVICQGFTGSQGTFHSEQAIAY-GTKMVGGVTPGKGGSTH----LDLPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           +V EA+  T ANASVIYVPP  A D+I+E+I+AE+ LIVCITEGIPVLDM++VK  L+ +
Sbjct: 56  SVHEARAVTGANASVIYVPPPFAADSILEAIDAEMELIVCITEGIPVLDMMKVKRALQGT 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            SRLIGPNCPG++TPD CKIGIMPG I R+GSVG++SRSGTLTYEAV QTS  GLGQSTA
Sbjct: 116 KSRLIGPNCPGVITPDECKIGIMPGHIHRRGSVGVVSRSGTLTYEAVKQTSDLGLGQSTA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+KG+E ID+LELFLAD  T SI+M+GEIGG+AEE+AAQFL DE KRGR KP  
Sbjct: 176 VGIGGDPIKGSEHIDILELFLADPETHSIIMIGEIGGAAEEDAAQFLADEKKRGRWKPTA 235

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
           GF+AG+TAP GR MGHAGA++SGGKG AE KI AMK AGI +A SPA +G ++++ +G 
Sbjct: 236 GFIAGRTAPAGRRMGHAGAIVSGGKGDAESKIEAMKRAGIVVADSPAHLGEAVMQAIGK 294


>gi|329847466|ref|ZP_08262494.1| succinyl-CoA ligase ADP-forming subunit alpha [Asticcacaulis
           biprosthecum C19]
 gi|328842529|gb|EGF92098.1| succinyl-CoA ligase ADP-forming subunit alpha [Asticcacaulis
           biprosthecum C19]
          Length = 295

 Score =  349 bits (896), Expect = 3e-94,   Method: Composition-based stats.
 Identities = 211/300 (70%), Positives = 252/300 (84%), Gaps = 5/300 (1%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++  TKV+ QGLTG  GTFHTEQAI Y  T++VGG+ P KG     G    +PV+ 
Sbjct: 1   MSVLINSETKVICQGLTGSQGTFHTEQAIAY-GTKMVGGVTPGKGGQTHVG----LPVYD 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TVAEAK+RT A A+ IYVPP  A D+I+E+IEAE+ LIVCITEGIPVLDMV+VK  L+ S
Sbjct: 56  TVAEAKDRTGATATAIYVPPPFAADSILEAIEAEMELIVCITEGIPVLDMVKVKKALQGS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            SRLIGPNCPG+LTP+ CKIGIMPG+IF  GSVG++SRSGTLTYEAVFQT+  GLGQ+TA
Sbjct: 116 KSRLIGPNCPGVLTPNQCKIGIMPGNIFSPGSVGVVSRSGTLTYEAVFQTTNAGLGQTTA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPVKGTEFIDVLE+FLAD+AT+SI+M+GEIGG AEE+AAQFL+DEAKRGR KP+ 
Sbjct: 176 VGIGGDPVKGTEFIDVLEMFLADDATKSIIMIGEIGGQAEEDAAQFLRDEAKRGRIKPMA 235

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGSL 300
           GF+AG+TAPPGR MGHAGA+ISGGKGGAEDKI AM+ AGI +APSPA +G +L+ +L  L
Sbjct: 236 GFIAGRTAPPGRRMGHAGAIISGGKGGAEDKIAAMEAAGIRVAPSPAALGETLLNVLKGL 295


>gi|510882|emb|CAA54877.1| putative succinyl-CoA synthetase alpha subunit [Coxiella burnetii]
          Length = 294

 Score =  349 bits (896), Expect = 3e-94,   Method: Composition-based stats.
 Identities = 174/294 (59%), Positives = 223/294 (75%), Gaps = 10/294 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL+DK T+VL QG TGK GTFH+EQAI Y  TQ+VGG+ P KG     G    +P+F 
Sbjct: 1   MSILIDKETRVLCQGFTGKQGTFHSEQAIEY-GTQMVGGVTPGKGGQSHLG----LPIFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           +V EA E T+A+A++I+VP     D+IIE+++A + L+VCITEGIPVLDM+ VKA L + 
Sbjct: 56  SVHEAVEETSADATMIFVPAPFCKDSIIEAVDAGVRLVVCITEGIPVLDMLEVKAYLRQH 115

Query: 121 S-SRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQST 179
              R+IGPNCPG++TP  CKIGIMPG I ++G VGI+SRSGTLTYEAV QT+Q G GQST
Sbjct: 116 PDVRMIGPNCPGVITPGECKIGIMPGHIHQRGKVGIVSRSGTLTYEAVNQTTQMGFGQST 175

Query: 180 AVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPI 239
            VGIGGDP+ GT FIDVLE+F  D  T++IVMVGEIGG+AEEEAA+F++       KKP+
Sbjct: 176 CVGIGGDPIPGTSFIDVLEMFEKDSQTQAIVMVGEIGGTAEEEAAEFIQSN----VKKPV 231

Query: 240 VGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSL 293
           + ++AG TAPPG+ MGHAGA+I+GGKG A DK  A++ AG+ +  SPA I ++L
Sbjct: 232 ISYIAGVTAPPGKRMGHAGAIIAGGKGTAADKYAALEAAGVFVVKSPAEIAKAL 285


>gi|149374982|ref|ZP_01892755.1| succinyl-CoA synthetase, alpha subunit [Marinobacter algicola
           DG893]
 gi|149360871|gb|EDM49322.1| succinyl-CoA synthetase, alpha subunit [Marinobacter algicola
           DG893]
          Length = 290

 Score =  349 bits (895), Expect = 3e-94,   Method: Composition-based stats.
 Identities = 172/298 (57%), Positives = 220/298 (73%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL++K+TKV+ QG TG  GTFH+EQAI Y  T++VGG+ P KG T   G    +PVF 
Sbjct: 1   MSILINKDTKVICQGFTGAQGTFHSEQAIEY-GTKMVGGVSPGKGGTEHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E+T A A+VIYVP     DAI+E+ +A I LIVCITEGIP +DM+  K  +++ 
Sbjct: 56  TVREAVEKTGAEATVIYVPAPFCKDAIVEAADAGIQLIVCITEGIPTIDMLYAKEYVDRK 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TP  CKIGIMPG+I + G VGI+SRSGTLTYEAV QT+  G GQST 
Sbjct: 116 GVRMIGPNCPGVITPGECKIGIMPGNIHKPGKVGIVSRSGTLTYEAVKQTTDFGYGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L+L   D  TE+IVM+GEIGG+AEEEAA F+K+       KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILQLLQDDPQTEAIVMIGEIGGTAEEEAAAFIKEN----VSKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            ++AG TAPPG+ MGHAGA+ISGGKG A++K  A+ +AG+    S A IG++L E+ G
Sbjct: 232 SYIAGVTAPPGKRMGHAGAIISGGKGTADEKFAALNDAGVKTVRSLAEIGKALKEVTG 289


>gi|84500190|ref|ZP_00998456.1| Succinyl-CoA synthetase, alpha subunit [Oceanicola batsensis
           HTCC2597]
 gi|84392124|gb|EAQ04392.1| Succinyl-CoA synthetase, alpha subunit [Oceanicola batsensis
           HTCC2597]
          Length = 294

 Score =  349 bits (895), Expect = 3e-94,   Method: Composition-based stats.
 Identities = 200/298 (67%), Positives = 249/298 (83%), Gaps = 5/298 (1%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           M++LVD+NTKV+ QG TG  GTFH+EQAI Y  T++VGG+ P KG +      +++PVF 
Sbjct: 1   MAVLVDENTKVICQGFTGSQGTFHSEQAIAY-GTKMVGGVTPGKGGSTH----LDLPVFD 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           +V EA ++T ANASVIYVPP  A D+I+E+I+AEIPLIVCITEGIPVLDM++VKA L+ S
Sbjct: 56  SVHEAVDQTGANASVIYVPPPFAADSILEAIDAEIPLIVCITEGIPVLDMMKVKAALKNS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
              LIGPNCPG++TPD+CKIGIMPG I ++GSVG++SRSGTLTYEAV QTS  GLGQS+A
Sbjct: 116 PCTLIGPNCPGVITPDACKIGIMPGHIHKRGSVGVVSRSGTLTYEAVKQTSDAGLGQSSA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+KGTE IDVLE+FLAD+ TESI+M+GEIGGSAEEEAAQFL DE K+GR KP  
Sbjct: 176 VGIGGDPIKGTEHIDVLEMFLADDETESIIMIGEIGGSAEEEAAQFLADEKKKGRWKPTA 235

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           GF+AG+TAPPGR MGHAGA+++GGKGGA+DKI AMK AGI +A SPA +G ++++ + 
Sbjct: 236 GFIAGRTAPPGRRMGHAGAIVAGGKGGADDKIEAMKSAGIVVADSPAGLGEAVLKAIK 293


>gi|301169938|emb|CBW29542.1| succinyl-CoA synthetase, NAD(P)-binding, alpha subunit [Haemophilus
           influenzae 10810]
          Length = 293

 Score =  349 bits (895), Expect = 3e-94,   Method: Composition-based stats.
 Identities = 184/299 (61%), Positives = 223/299 (74%), Gaps = 9/299 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           M+IL+DKNTKV+ QG TG  GTFH+EQA+ Y  TQ+VGG+ P KG T   G    +PVF 
Sbjct: 1   MAILIDKNTKVICQGFTGGQGTFHSEQALAY-GTQLVGGVSPNKGGTTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T A A+VIYVP S   DAIIE+I+A I LIVCITEGIP LDM++VK +L ++
Sbjct: 56  TVREAVENTGATATVIYVPASFCKDAIIEAIDAGIQLIVCITEGIPTLDMLKVKQKLNET 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
              +IGPNCPG++TPD CKIGIMP  I +KG VGI+SRSGTLTYEAV QT+ EG GQST 
Sbjct: 116 GVVMIGPNCPGVITPDECKIGIMPAHIHKKGKVGIVSRSGTLTYEAVKQTTDEGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+LE F  D  TE+IVM+GEIGGSAEEEAA F+KD       KP+V
Sbjct: 176 VGIGGDPIPGSSFIDILERFQQDPETEAIVMIGEIGGSAEEEAAIFIKDN----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
            ++AG TAP G+ MGHAGA+ISGGKG A +KI A++ AG+    S A IG +L +LL S
Sbjct: 232 AYIAGITAPKGKRMGHAGAIISGGKGTAVEKIAALEAAGVTCVKSLAEIGEALRKLLKS 290


>gi|260597127|ref|YP_003209698.1| succinyl-CoA synthetase subunit alpha [Cronobacter turicensis
           z3032]
 gi|260216304|emb|CBA29278.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Cronobacter
           turicensis z3032]
          Length = 289

 Score =  349 bits (895), Expect = 3e-94,   Method: Composition-based stats.
 Identities = 176/298 (59%), Positives = 220/298 (73%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL+DKNTKV+ QG TG  GTFH+EQAI Y  TQ+VGG+ P KG T   G    +PVF 
Sbjct: 1   MSILIDKNTKVICQGFTGSQGTFHSEQAIAY-GTQMVGGVTPGKGGTTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA + T A ASVIYVP     D+I+E+I+A I LI+ ITEGIP LDM+ VK +L+++
Sbjct: 56  TVREAVDATGATASVIYVPAPFCKDSILEAIDAGIKLIITITEGIPTLDMLTVKVKLDEA 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TP  CKIGIMPG I + G VGI+SRSGTLTYEAV QT+  G GQST 
Sbjct: 116 GVRMIGPNCPGVITPGECKIGIMPGHIHQPGRVGIVSRSGTLTYEAVKQTTDYGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L+LF  D  TE+IVM+GEIGGSAEEEAA ++KD       KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILKLFQEDPQTEAIVMIGEIGGSAEEEAAAYIKDH----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           G++AG TAP G+ MGHAGA+I+GGKG A++K  A++ AG+    S A IG +L  +L 
Sbjct: 232 GYIAGVTAPKGKRMGHAGAIIAGGKGTADEKFAALEAAGVKTVRSLADIGDALKTILK 289


>gi|330829378|ref|YP_004392330.1| succinyl-CoA ligase [ADP-forming] subunit alpha [Aeromonas veronii
           B565]
 gi|328804514|gb|AEB49713.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Aeromonas veronii
           B565]
          Length = 290

 Score =  349 bits (895), Expect = 3e-94,   Method: Composition-based stats.
 Identities = 173/298 (58%), Positives = 222/298 (74%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+T+V+ QG TG  GTFH+EQA+ Y  TQ+VGG+ P KG T   G    +PVF 
Sbjct: 1   MSVLINKDTRVICQGFTGGQGTFHSEQALSY-GTQLVGGVSPGKGGTTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV +A E T A ASVIYVP     DAI+E+I+A I LIV ITEGIP LDM+ VK +L+++
Sbjct: 56  TVRDAVEATGATASVIYVPAPFCKDAILEAIDAGIKLIVTITEGIPTLDMLDVKVKLQET 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TP  CKIGIMPG I + G VGI+SRSGTLTYEAV QT+ EG GQST 
Sbjct: 116 GVRMIGPNCPGVITPGECKIGIMPGHIHKPGKVGIVSRSGTLTYEAVKQTTDEGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+LE+F  D  TE+IVM+GEIGG+AEE+AA ++K        KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILEMFQNDPQTEAIVMIGEIGGNAEEDAAAYIKAH----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            ++AG TAPPG+ MGHAGA+ISGGKG A +K  A+++AG+    S A IG++L E+ G
Sbjct: 232 SYIAGVTAPPGKRMGHAGAIISGGKGTAAEKFAALEDAGVKTVRSLADIGKALREVTG 289


>gi|56419744|ref|YP_147062.1| succinyl-CoA synthetase subunit alpha [Geobacillus kaustophilus
           HTA426]
 gi|261419409|ref|YP_003253091.1| succinyl-CoA synthetase subunit alpha [Geobacillus sp. Y412MC61]
 gi|297530616|ref|YP_003671891.1| succinyl-CoA synthetase, subunit alpha [Geobacillus sp. C56-T3]
 gi|319766224|ref|YP_004131725.1| succinyl-CoA synthetase, subunit alpha [Geobacillus sp. Y412MC52]
 gi|56379586|dbj|BAD75494.1| succinyl-CoA synthetase alpha subunit [Geobacillus kaustophilus
           HTA426]
 gi|261375866|gb|ACX78609.1| succinyl-CoA synthetase, alpha subunit [Geobacillus sp. Y412MC61]
 gi|297253868|gb|ADI27314.1| succinyl-CoA synthetase, alpha subunit [Geobacillus sp. C56-T3]
 gi|317111090|gb|ADU93582.1| succinyl-CoA synthetase, alpha subunit [Geobacillus sp. Y412MC52]
          Length = 300

 Score =  349 bits (895), Expect = 3e-94,   Method: Composition-based stats.
 Identities = 185/299 (61%), Positives = 231/299 (77%), Gaps = 9/299 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+ V+K+TKV+VQG+TG  G FHT+Q I Y  T +VGG+ P KG T   G    VPVF 
Sbjct: 1   MSVFVNKDTKVIVQGITGSQGLFHTKQMIEY-GTNIVGGVTPGKGGTEVEG----VPVFD 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV+EA ERT ANASVIYVPP+ A DAI+E+++A + L+VCITEGIPVLDMV+VK  +E  
Sbjct: 56  TVSEAVERTGANASVIYVPPAFAADAIMEAVDAGLDLVVCITEGIPVLDMVKVKRYMEGK 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            +RLIGPNCPG++TP+ CKIGIMPG I +KG VGI+SRSGTLTYEAV Q +Q G+GQSTA
Sbjct: 116 KTRLIGPNCPGVITPEECKIGIMPGYIHKKGHVGIVSRSGTLTYEAVHQLTQAGIGQSTA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPV GT FIDVL+ F  DE T +++M+GEIGG+AEEEAA+++K        KP+V
Sbjct: 176 VGIGGDPVNGTNFIDVLKAFNEDEETYAVIMIGEIGGTAEEEAAEWVKANM----TKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
           GF+ G+TAPPG+ MGHAGA+ISGGKG A +KI  M E GI +A +PA IG +L+ +L  
Sbjct: 232 GFIGGQTAPPGKRMGHAGAIISGGKGTAAEKIKKMTECGIKVAETPAVIGETLISVLKE 290


>gi|307130100|ref|YP_003882116.1| succinyl-CoA synthetase, NAD(P)-binding, subunit alpha [Dickeya
           dadantii 3937]
 gi|306527629|gb|ADM97559.1| succinyl-CoA synthetase, NAD(P)-binding, alpha subunit [Dickeya
           dadantii 3937]
          Length = 290

 Score =  349 bits (895), Expect = 3e-94,   Method: Composition-based stats.
 Identities = 179/298 (60%), Positives = 223/298 (74%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL+DKNTKV+ QG TG  G+FH+EQAI Y  TQ+VGG+ P KG T   G    +PVF 
Sbjct: 1   MSILIDKNTKVICQGFTGSQGSFHSEQAIAY-GTQMVGGVTPGKGGTEHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T A ASVIYVP     D+I+E+I+A I LI+CITEGIP LDM+ VK +LE+S
Sbjct: 56  TVREAVEATGATASVIYVPAPFCKDSILEAIDAGIELIICITEGIPTLDMLTVKVKLEQS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TP +CKIGIMPG I   G VGI+SRSGTLTYEAV QT+  GLGQST 
Sbjct: 116 GVRMIGPNCPGVITPGACKIGIMPGHIHLPGKVGIVSRSGTLTYEAVKQTTDAGLGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L+LF  D  TE+IVM+GEIGG+AEEEAA ++K+       KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILKLFEQDPQTEAIVMIGEIGGTAEEEAAAYIKEH----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           G++AG TAP G+ MGHAGA+I+GGKG A+DK  A++ AG+    S A IG ++  +LG
Sbjct: 232 GYIAGVTAPKGKRMGHAGAIIAGGKGTADDKFAALEAAGVKTVRSLADIGDAVKAVLG 289


>gi|86359470|ref|YP_471362.1| succinyl-CoA synthetase subunit alpha [Rhizobium etli CFN 42]
 gi|86283572|gb|ABC92635.1| succinyl-CoA synthetase alpha subunit protein [Rhizobium etli CFN
           42]
          Length = 300

 Score =  349 bits (895), Expect = 3e-94,   Method: Composition-based stats.
 Identities = 234/298 (78%), Positives = 271/298 (90%), Gaps = 1/298 (0%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTG-GNVNVPVF 59
           MSILV+K+TKVLVQGLTGK GTFHTEQA+ Y  TQ+VGGIHPKKG   WTG    ++P+F
Sbjct: 1   MSILVNKDTKVLVQGLTGKTGTFHTEQALAYYGTQMVGGIHPKKGGETWTGSKGESLPIF 60

Query: 60  TTVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEK 119
            TVAE KE+T A+A+VIYVPP+GA DAIIE+I+AEIP I CITEGIPV+DMVRVKARL++
Sbjct: 61  ATVAEGKEKTGADATVIYVPPAGAADAIIEAIDAEIPFITCITEGIPVMDMVRVKARLDR 120

Query: 120 SSSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQST 179
           S SRL+GPNCPGILTP+ CKIGIMPGSIFRKGSVGI+SRSGTLTYEAVFQTS EGLGQ+T
Sbjct: 121 SKSRLLGPNCPGILTPEECKIGIMPGSIFRKGSVGIVSRSGTLTYEAVFQTSNEGLGQTT 180

Query: 180 AVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPI 239
           AVGIGGDPVKGTEFIDVLE+FLADEAT+SI+M+GEIGGSAEE+AAQFLKDEAK+GRKKP+
Sbjct: 181 AVGIGGDPVKGTEFIDVLEMFLADEATQSIIMIGEIGGSAEEDAAQFLKDEAKKGRKKPM 240

Query: 240 VGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELL 297
            GF+AG+TAP GRTMGHAGAV+SGGKG AE KI AM+ AGI ++PSPAR+G++LVE+L
Sbjct: 241 AGFIAGRTAPKGRTMGHAGAVVSGGKGDAESKIAAMESAGIKVSPSPARLGKTLVEVL 298


>gi|251790491|ref|YP_003005212.1| succinyl-CoA synthetase subunit alpha [Dickeya zeae Ech1591]
 gi|247539112|gb|ACT07733.1| succinyl-CoA synthetase, alpha subunit [Dickeya zeae Ech1591]
          Length = 290

 Score =  349 bits (895), Expect = 3e-94,   Method: Composition-based stats.
 Identities = 178/298 (59%), Positives = 222/298 (74%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL+DKNTKV+ QG TG  G+FH+EQAI Y  TQ+VGG+ P KG T   G    +PVF 
Sbjct: 1   MSILIDKNTKVICQGFTGSQGSFHSEQAIAY-GTQMVGGVTPGKGGTEHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T A ASVIYVP     D+I+E+I+A I LI+CITEGIP LDM+ VK +LE+S
Sbjct: 56  TVREAVEATGATASVIYVPAPFCKDSILEAIDAGIQLIICITEGIPTLDMLTVKVKLEQS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TP +CKIGIMPG I   G VGI+SRSGTLTYEAV QT+  GLGQST 
Sbjct: 116 GVRMIGPNCPGVITPGACKIGIMPGHIHLPGKVGIVSRSGTLTYEAVKQTTDAGLGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L+LF  D  TE+IVM+GEIGG+AEEEAA ++K+       KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILKLFEQDPQTEAIVMIGEIGGTAEEEAAAYIKEH----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           G++AG TAP G+ MGHAGA+I+GGKG A+DK  A++ AG+    S A IG ++  +L 
Sbjct: 232 GYIAGVTAPKGKRMGHAGAIIAGGKGTADDKFAALEAAGVKTVRSLADIGDAVKSVLA 289


>gi|189499412|ref|YP_001958882.1| succinyl-CoA synthetase, alpha subunit [Chlorobium phaeobacteroides
           BS1]
 gi|189494853|gb|ACE03401.1| succinyl-CoA synthetase, alpha subunit [Chlorobium phaeobacteroides
           BS1]
          Length = 315

 Score =  349 bits (895), Expect = 3e-94,   Method: Composition-based stats.
 Identities = 168/304 (55%), Positives = 227/304 (74%), Gaps = 10/304 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVN----- 55
           MS+LV+K+T+++VQG+TG  GTFHT Q + Y  T VV G+ P KG   +TG + +     
Sbjct: 16  MSVLVNKDTRLVVQGITGGEGTFHTSQILEY-GTNVVAGVTPGKGGLEYTGNDRDTFLRP 74

Query: 56  VPVFTTVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKA 115
           VPVF TV +A     AN SVI+VP   A DAI+E+ EA + +I+CITEGIPV DM++   
Sbjct: 75  VPVFNTVKDAVVVAGANTSVIFVPAPFAADAIMEAAEAGLKVIICITEGIPVNDMMKAYR 134

Query: 116 RLEKSSSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGL 175
            +++  + L+GPNCPG++TP   K+GIMPG I +KGS+G++SRSGTLTYEAV Q ++ GL
Sbjct: 135 YVQEKGAVLVGPNCPGVITPGEAKVGIMPGFIHKKGSIGVVSRSGTLTYEAVHQLTEVGL 194

Query: 176 GQSTAVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGR 235
           GQST +GIGGDPV GT F+D ++LF  D+ TE +VM+GEIGGSAEEEA++++K       
Sbjct: 195 GQSTCIGIGGDPVIGTRFLDAIKLFAKDDETEGLVMIGEIGGSAEEEASEYIKKH----F 250

Query: 236 KKPIVGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVE 295
           KKP+VGF+AG+TAPPGR MGHAGA++SGGKG AEDKI AM++AGI +  +PA IG ++++
Sbjct: 251 KKPVVGFIAGRTAPPGRRMGHAGAIVSGGKGTAEDKIRAMEKAGIHVVENPADIGDTMLK 310

Query: 296 LLGS 299
            LG 
Sbjct: 311 ALGK 314


>gi|332535009|ref|ZP_08410825.1| succinyl-CoA ligase [ADP-forming] alpha chain [Pseudoalteromonas
           haloplanktis ANT/505]
 gi|332035576|gb|EGI72069.1| succinyl-CoA ligase [ADP-forming] alpha chain [Pseudoalteromonas
           haloplanktis ANT/505]
          Length = 290

 Score =  349 bits (895), Expect = 3e-94,   Method: Composition-based stats.
 Identities = 173/298 (58%), Positives = 220/298 (73%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+TKV+ QG TG  GTFH+EQA+ Y  TQ+VGG+ P KG     G    +PVF 
Sbjct: 1   MSVLINKDTKVICQGFTGGQGTFHSEQALEY-GTQMVGGVSPGKGGQTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV +A + T A ASVIYVP     DAI+E+I+A I LIVCITEGIP LDMV VK +L+++
Sbjct: 56  TVRDAVQETGATASVIYVPAPFCKDAILEAIDAGIELIVCITEGIPTLDMVDVKVKLDQT 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            +R+IGPNCPG++TP   KIGIMPG I + G VGI+SRSGTLTYEAV QT+  G GQST 
Sbjct: 116 GTRMIGPNCPGVITPGETKIGIMPGHIHKPGKVGIVSRSGTLTYEAVKQTTDAGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ GT FIDVLE+F  D  TE+IVM+GEIGG+AEEEAA+++K        KP+V
Sbjct: 176 VGIGGDPIPGTNFIDVLEMFEKDPQTEAIVMIGEIGGTAEEEAAEYIKAN----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            ++AG TAP G+ MGHAGA+I+GGKG A++K  A++ AG+    S A IG++L E  G
Sbjct: 232 SYIAGVTAPEGKRMGHAGAIIAGGKGTADEKFAALEAAGVKTVRSLAEIGKALKEKTG 289


>gi|325294373|ref|YP_004280887.1| succinyl-CoA synthetase, alpha subunit [Desulfurobacterium
           thermolithotrophum DSM 11699]
 gi|325064821|gb|ADY72828.1| succinyl-CoA synthetase, alpha subunit [Desulfurobacterium
           thermolithotrophum DSM 11699]
          Length = 300

 Score =  349 bits (895), Expect = 3e-94,   Method: Composition-based stats.
 Identities = 166/301 (55%), Positives = 225/301 (74%), Gaps = 7/301 (2%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNV--NVPV 58
           MS+L++K+TKV+VQGLTGK G+FH +Q + Y  TQVV G+ P KG   W        VPV
Sbjct: 1   MSVLINKDTKVVVQGLTGKEGSFHAKQCLDY-GTQVVAGVTPGKGGMIWEDDEKRHKVPV 59

Query: 59  FTTVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLE 118
           F TV EA + T ANAS+I+VPP+ A DAI+E+ +A I +I+CITEGIPV DMV+VK  LE
Sbjct: 60  FNTVEEAVKETGANASLIFVPPAFAADAIMEAADAGIKIIICITEGIPVNDMVKVKRALE 119

Query: 119 KSSSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQS 178
            +  R +GPNCPG++TP+ CK+GIMPG IF+KG VGI+SRSGTLTYEA +Q +Q G+GQS
Sbjct: 120 GTGVRYVGPNCPGVITPEECKMGIMPGHIFKKGKVGIVSRSGTLTYEAAYQLTQRGIGQS 179

Query: 179 TAVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKP 238
           T +GIGGDPV GT   + +E+F  D  T++IV++GEIGG+ EEEAA+++K+      +KP
Sbjct: 180 TVIGIGGDPVPGTTHKEAIEMFNNDPETDAIVLIGEIGGTMEEEAAEYIKEN----VEKP 235

Query: 239 IVGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           ++ ++AG TAPPGR MGHAGA+ISGGKG A+ K++A++ AG  +  +PA IG ++ + L 
Sbjct: 236 VIAYIAGVTAPPGRRMGHAGAIISGGKGDAKSKMDALRAAGAYVCETPAVIGETVEKALK 295

Query: 299 S 299
            
Sbjct: 296 E 296


>gi|156934779|ref|YP_001438695.1| succinyl-CoA synthetase subunit alpha [Cronobacter sakazakii ATCC
           BAA-894]
 gi|156533033|gb|ABU77859.1| hypothetical protein ESA_02619 [Cronobacter sakazakii ATCC BAA-894]
          Length = 289

 Score =  349 bits (895), Expect = 3e-94,   Method: Composition-based stats.
 Identities = 177/298 (59%), Positives = 220/298 (73%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL+DKNTKV+ QG TG  GTFH+EQAI Y  TQ+VGG+ P KG T   G    +PVF 
Sbjct: 1   MSILIDKNTKVICQGFTGSQGTFHSEQAIAY-GTQMVGGVTPGKGGTTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T A ASVIYVP     D+I+E+I+A I LI+ ITEGIP LDM+ VK +L+++
Sbjct: 56  TVREAVEATGATASVIYVPAPFCKDSILEAIDAGIKLIITITEGIPTLDMLTVKVKLDEA 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TP  CKIGIMPG I + G VGI+SRSGTLTYEAV QT+  G GQST 
Sbjct: 116 GVRMIGPNCPGVITPGECKIGIMPGHIHQPGRVGIVSRSGTLTYEAVKQTTDYGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L+LF  D  TE+IVM+GEIGGSAEEEAA ++KD       KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILKLFQEDPQTEAIVMIGEIGGSAEEEAAAYIKDH----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           G++AG TAP G+ MGHAGA+I+GGKG A++K  A++ AG+    S A IG +L  +L 
Sbjct: 232 GYIAGVTAPKGKRMGHAGAIIAGGKGTADEKFAALEAAGVKTVRSLADIGDALKTILK 289


>gi|77360585|ref|YP_340160.1| succinyl-CoA synthetase, alpha subunit, NAD(P)-binding
           [Pseudoalteromonas haloplanktis TAC125]
 gi|76875496|emb|CAI86717.1| succinyl-CoA synthetase, alpha subunit, NAD(P)-binding
           [Pseudoalteromonas haloplanktis TAC125]
          Length = 290

 Score =  349 bits (895), Expect = 3e-94,   Method: Composition-based stats.
 Identities = 174/298 (58%), Positives = 220/298 (73%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+TKV+ QG TG  GTFH+EQA+ Y  TQ+VGG+ P KG     G    +PVF 
Sbjct: 1   MSVLINKDTKVICQGFTGGQGTFHSEQALEY-GTQMVGGVSPGKGGQTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA + T A ASVIYVP     DAI+E+I+A I LIVCITEGIP LDMV VK +L+++
Sbjct: 56  TVREAVQETGATASVIYVPAPFCKDAILEAIDAGIELIVCITEGIPTLDMVDVKIKLDQT 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            +R+IGPNCPG++TP   KIGIMPG I + G VGI+SRSGTLTYEAV QT+  G GQST 
Sbjct: 116 GTRMIGPNCPGVITPGETKIGIMPGHIHKPGKVGIVSRSGTLTYEAVKQTTDAGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ GT FIDVLE+F  D  TE+IVM+GEIGG+AEEEAA+++K        KP+V
Sbjct: 176 VGIGGDPIPGTNFIDVLEMFEKDPQTEAIVMIGEIGGTAEEEAAEYIKAH----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            ++AG TAP G+ MGHAGA+I+GGKG A++K  A++ AG+    S A IG++L E  G
Sbjct: 232 SYIAGVTAPEGKRMGHAGAIIAGGKGTADEKFAALEAAGVKTVRSLADIGKALKEKTG 289


>gi|165918999|ref|ZP_02219085.1| succinate-CoA ligase (ADP-forming), alpha subunit [Coxiella
           burnetii RSA 334]
 gi|165917324|gb|EDR35928.1| succinate-CoA ligase (ADP-forming), alpha subunit [Coxiella
           burnetii RSA 334]
          Length = 294

 Score =  349 bits (895), Expect = 4e-94,   Method: Composition-based stats.
 Identities = 175/299 (58%), Positives = 224/299 (74%), Gaps = 10/299 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL+DK T+VL QG TGK GTFH+EQAI Y  TQ+VGG+ P KG     G    +P+F 
Sbjct: 1   MSILIDKETRVLCQGFTGKQGTFHSEQAIEY-GTQMVGGVTPGKGGQSHLG----LPIFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           +V EA E T+A+A++I+VP     D+I E+++A + L+VCITEGIPVLDM+ VKA L + 
Sbjct: 56  SVHEAVEETSADATMIFVPAPFCKDSISEAVDAGVRLVVCITEGIPVLDMLEVKAYLRQH 115

Query: 121 S-SRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQST 179
              R+IGPNCPG++TP  CKIGIMPG I ++G VGI+SRSGTLTYEAV QT+Q G GQST
Sbjct: 116 PDVRMIGPNCPGVITPGECKIGIMPGHIHQRGKVGIVSRSGTLTYEAVNQTTQMGFGQST 175

Query: 180 AVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPI 239
            VGIGGDP+ GT FIDVLE+F  D  T++IVMVGEIGG+AEEEAA+F++       KKP+
Sbjct: 176 CVGIGGDPIPGTSFIDVLEMFEKDSQTQAIVMVGEIGGTAEEEAAEFIQSN----VKKPV 231

Query: 240 VGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           + ++AG TAPPG+ MGHAGA+I+GGKG A DK  A++ AG+ +  SPA IG+ + E  G
Sbjct: 232 ISYIAGVTAPPGKRMGHAGAIIAGGKGTAADKYAALEAAGVFVVKSPAEIGKGVAEATG 290


>gi|254786518|ref|YP_003073947.1| succinyl-CoA ligase, subunit alpha [Teredinibacter turnerae T7901]
 gi|237685623|gb|ACR12887.1| succinyl-CoA ligase, alpha subunit [Teredinibacter turnerae T7901]
          Length = 290

 Score =  349 bits (895), Expect = 4e-94,   Method: Composition-based stats.
 Identities = 168/298 (56%), Positives = 215/298 (72%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K TKVL QG TG  GTFH+EQAI Y  T++VGG+ P KG     G    +PVF 
Sbjct: 1   MSVLINKETKVLCQGFTGSQGTFHSEQAIAY-GTKMVGGVTPGKGGQTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           T+AEA   T A+ASVIYVP     D+I+E+  + + L+VCITEGIP +DM+  K + ++ 
Sbjct: 56  TMAEAVAETGADASVIYVPAPFCKDSILEAAHSGVKLVVCITEGIPTMDMLDCKVKCDEL 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             RLIGPNCPG++TP  CKIGIMPG I   G VGI+SRSGTLTYEAV QT+  G GQST 
Sbjct: 116 GVRLIGPNCPGVITPGECKIGIMPGHIHLPGKVGIVSRSGTLTYEAVKQTTDYGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+LE+F  D  TE+IVM+GEIGG+AEEEAA ++K        KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILEMFQNDPQTEAIVMIGEIGGTAEEEAAAYIKAN----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            ++AG TAPPG+ MGHAGA+ISGGKG A++K  A+++AG+    S A IG +L E+ G
Sbjct: 232 SYIAGVTAPPGKRMGHAGAIISGGKGTADEKFAALEDAGVKTVRSLANIGDALKEVTG 289


>gi|296447746|ref|ZP_06889661.1| succinyl-CoA synthetase, alpha subunit [Methylosinus trichosporium
           OB3b]
 gi|296254723|gb|EFH01835.1| succinyl-CoA synthetase, alpha subunit [Methylosinus trichosporium
           OB3b]
          Length = 294

 Score =  349 bits (895), Expect = 4e-94,   Method: Composition-based stats.
 Identities = 211/298 (70%), Positives = 260/298 (87%), Gaps = 5/298 (1%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L+DKNTKV+ QG TGK GTFH+EQAILY  T++VGG+ P KG +      +++PVF 
Sbjct: 1   MSVLIDKNTKVICQGFTGKNGTFHSEQAILY-GTRMVGGVSPGKGGSKH----LDLPVFD 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TVAEA+E+T A+ASVIYVPP GA DAI E+I+AEIPLIV ITEG+PV DM+RV+  L  S
Sbjct: 56  TVAEAREKTGADASVIYVPPPGAADAICEAIDAEIPLIVAITEGVPVHDMIRVRRALSGS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            SRLIGPNCPG++T   CKIGIMPG+IF  GSVG++SRSGTLTYEAVFQT++EGLGQ++A
Sbjct: 116 KSRLIGPNCPGVVTAGECKIGIMPGNIFSNGSVGVVSRSGTLTYEAVFQTTREGLGQTSA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPVKGT+FI+VLELFLAD+AT+SI+M+GEIGGSAEE+AA+FL+DEAKRGRKKP+V
Sbjct: 176 VGIGGDPVKGTDFIEVLELFLADDATKSIIMIGEIGGSAEEDAAEFLRDEAKRGRKKPMV 235

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           GF+AG+TAPPGR MGHAGA++SGGKG AE KI AM+ AGI ++PSPAR+G++LVE+L 
Sbjct: 236 GFIAGRTAPPGRRMGHAGAIVSGGKGDAESKIAAMESAGIRVSPSPARLGKTLVEMLN 293


>gi|94496915|ref|ZP_01303489.1| succinyl-CoA synthetase, alpha subunit [Sphingomonas sp. SKA58]
 gi|94423591|gb|EAT08618.1| succinyl-CoA synthetase, alpha subunit [Sphingomonas sp. SKA58]
          Length = 294

 Score =  349 bits (895), Expect = 4e-94,   Method: Composition-based stats.
 Identities = 217/298 (72%), Positives = 252/298 (84%), Gaps = 5/298 (1%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSILV+KNTKV+ QG+TG  GTFHTEQA+ Y  TQ+V G+ P KG T   G    +P+F 
Sbjct: 1   MSILVNKNTKVITQGMTGATGTFHTEQALAY-GTQMVAGVTPGKGGTSHIG----LPMFD 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TVAEAK +T A+ASVIYVPP  A D+I+E+I+AEIPLIVCITEGIPVLDMVRVK  L  S
Sbjct: 56  TVAEAKSKTGADASVIYVPPPFAADSILEAIDAEIPLIVCITEGIPVLDMVRVKRALSGS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            SRLIGPNCPG+LTPD CKIGIMPGSIF+KGSVG++SRSGTLTYEAVFQTS  GLGQ+TA
Sbjct: 116 KSRLIGPNCPGVLTPDECKIGIMPGSIFKKGSVGVVSRSGTLTYEAVFQTSNAGLGQTTA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPV GT FIDVLELFLAD+ATESI+M+GEIGG AEE+AAQFL DEAK+GRKKP+ 
Sbjct: 176 VGIGGDPVNGTNFIDVLELFLADDATESIIMIGEIGGDAEEQAAQFLIDEAKKGRKKPMA 235

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           GF+AG+TAPPGR MGHAGA++SGGKG AE KI AM+ AGI +A SP+ +G +LVE+L 
Sbjct: 236 GFIAGRTAPPGRRMGHAGAIVSGGKGDAESKIAAMEAAGIKVAASPSELGSTLVEVLK 293


>gi|149913127|ref|ZP_01901661.1| dihydrolipoamide acetyltransferase [Roseobacter sp. AzwK-3b]
 gi|149813533|gb|EDM73359.1| dihydrolipoamide acetyltransferase [Roseobacter sp. AzwK-3b]
          Length = 294

 Score =  348 bits (894), Expect = 4e-94,   Method: Composition-based stats.
 Identities = 196/298 (65%), Positives = 242/298 (81%), Gaps = 5/298 (1%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           M++L+D+NTKV+ QGLTG  GTFHTEQAI Y  T++VGG+ P KG        +++PVF 
Sbjct: 1   MAVLIDENTKVICQGLTGSQGTFHTEQAIAY-GTKMVGGVTPGKGGQTH----LDLPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           +V EAK  T ANASVIYVPP  A D+I+E+I+AE+ +IVCITEGIPVLDM+RVK  LE S
Sbjct: 56  SVHEAKHATDANASVIYVPPPFAADSILEAIDAEMEVIVCITEGIPVLDMMRVKRALETS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            SRLIGPNCPG++TPD+CKIGIMPG I ++G VG++SRSGTLTYEAV QT+  GLGQST 
Sbjct: 116 KSRLIGPNCPGVITPDACKIGIMPGHIHKRGKVGVVSRSGTLTYEAVKQTTDVGLGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+KGTE IDVLE FLAD+ TE+I+M+GEIGGSAEE+AA FL  E K+GR KP  
Sbjct: 176 VGIGGDPIKGTEHIDVLEWFLADDETEAIIMIGEIGGSAEEDAAAFLASERKKGRWKPTA 235

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           GF+AG+TAPPGR MGHAGA+++GGKGGA+DKI AMK AGI +A SPA +G +++  + 
Sbjct: 236 GFIAGRTAPPGRRMGHAGAIVAGGKGGADDKIEAMKSAGITVAESPASLGEAVLTAIK 293


>gi|256822755|ref|YP_003146718.1| succinyl-CoA synthetase subunit alpha [Kangiella koreensis DSM
           16069]
 gi|256796294|gb|ACV26950.1| succinyl-CoA synthetase, alpha subunit [Kangiella koreensis DSM
           16069]
          Length = 290

 Score =  348 bits (894), Expect = 4e-94,   Method: Composition-based stats.
 Identities = 170/298 (57%), Positives = 211/298 (70%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL++K+TKV+ QG+TG  GTFHTEQAI Y  T +VGG+ P KG     G    +PVF 
Sbjct: 1   MSILINKDTKVICQGITGSQGTFHTEQAIEY-GTNMVGGVTPGKGGQTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV +A E T A ASVIYVP     D+I+E+    I L+VCITEGIP +DM+  K   +  
Sbjct: 56  TVKDAVEATGAEASVIYVPAPFCKDSILEAANGGIKLVVCITEGIPTMDMLEAKIVCDNL 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             RLIGPNCPG++TP  CKIGIMPG I   G VGI+SRSGTLTYEAV QT+  G GQST 
Sbjct: 116 GVRLIGPNCPGVITPGECKIGIMPGHIHLPGKVGIVSRSGTLTYEAVKQTTDFGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L++F  D ATE+IVM+GEIGGSAEEEAA F+K+       KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILKMFQDDPATEAIVMIGEIGGSAEEEAAAFIKEN----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            ++AG TAP G+ MGHAGA+I+GGKG A +K  A+++AG+    S A IG  L E+ G
Sbjct: 232 SYIAGVTAPAGKRMGHAGAIIAGGKGTAAEKFAALEDAGVKTVRSLADIGNGLKEVTG 289


>gi|190893736|ref|YP_001980278.1| succinyl-CoA synthetase, alpha subunit [Rhizobium etli CIAT 652]
 gi|190699015|gb|ACE93100.1| succinyl-CoA synthetase protein, alpha subunit [Rhizobium etli CIAT
           652]
          Length = 300

 Score =  348 bits (894), Expect = 4e-94,   Method: Composition-based stats.
 Identities = 232/299 (77%), Positives = 270/299 (90%), Gaps = 1/299 (0%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTG-GNVNVPVF 59
           MSILV+K+TKVLVQGLTGK GTFHTEQA+ Y  TQ+VGGIHPKKG   WTG    ++P+F
Sbjct: 1   MSILVNKDTKVLVQGLTGKTGTFHTEQALAYYGTQMVGGIHPKKGGETWTGAKGESLPIF 60

Query: 60  TTVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEK 119
            TVAE KE+T A+A+VIYVPP+GA DAIIE+I+AEIP I CITEGIPV+DMVRVKARL++
Sbjct: 61  ATVAEGKEKTGADATVIYVPPAGAADAIIEAIDAEIPFITCITEGIPVMDMVRVKARLDR 120

Query: 120 SSSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQST 179
           S SRL+GPNCPG+LTP+ CKIGIMPGSIFRKGSVGI+SRSGTLTYEAVFQTS EGLGQ+T
Sbjct: 121 SKSRLLGPNCPGVLTPEECKIGIMPGSIFRKGSVGIVSRSGTLTYEAVFQTSNEGLGQTT 180

Query: 180 AVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPI 239
           AVGIGGDPVKGTEFIDVLE+FLAD+AT SI+M+GEIGGSAEE+AAQFLKDEAK+GRKKP+
Sbjct: 181 AVGIGGDPVKGTEFIDVLEMFLADDATTSIIMIGEIGGSAEEDAAQFLKDEAKKGRKKPM 240

Query: 240 VGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            GF+AG+TAP GRTMGHAGAV+SGGKG AE KI AM+ AGI ++PSPAR+G++LVE+L 
Sbjct: 241 AGFIAGRTAPKGRTMGHAGAVVSGGKGDAESKIAAMESAGIKVSPSPARLGKTLVEVLK 299


>gi|114321695|ref|YP_743378.1| succinyl-CoA synthetase (ADP-forming) alpha subunit
           [Alkalilimnicola ehrlichii MLHE-1]
 gi|114228089|gb|ABI57888.1| succinyl-CoA synthetase (ADP-forming) alpha subunit
           [Alkalilimnicola ehrlichii MLHE-1]
          Length = 290

 Score =  348 bits (894), Expect = 4e-94,   Method: Composition-based stats.
 Identities = 179/298 (60%), Positives = 224/298 (75%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+LVDKNTKV+VQG TGK GTFH EQAI Y  T VVGG+ P +G        +++PVF 
Sbjct: 1   MSVLVDKNTKVIVQGFTGKQGTFHAEQAIAY-GTNVVGGVTPGRGGQTH----LDLPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV +A + T A+AS+IYVP + A DAI+E+ +A I +I CITEGIPVLDM++VKA L + 
Sbjct: 56  TVEDAVQETGADASMIYVPAAFAADAILEAADAGIKVIACITEGIPVLDMLKVKAALAQY 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            +RLIGPNCPG++TP  CKIGIMPG I + GS+GI+SRSGTLTYEAV QT+  GLGQST 
Sbjct: 116 DARLIGPNCPGVITPGECKIGIMPGHIHKAGSIGIVSRSGTLTYEAVKQTTDIGLGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           +GIGGDP+ G  FID LELF AD  T+ IVMVGEIGG+AEEEAA++++        KP+V
Sbjct: 176 IGIGGDPIHGMSFIDALELFQADPQTKGIVMVGEIGGTAEEEAAEYIQQN----VDKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            ++AG TAPPG+ MGHAGA+I+GGKG A+DK  A++ AG+    SPA IG+ L EL  
Sbjct: 232 AYIAGVTAPPGKRMGHAGAIIAGGKGTADDKFAALESAGVATVRSPAEIGQKLNELFS 289


>gi|240949390|ref|ZP_04753731.1| hypothetical protein AM305_10616 [Actinobacillus minor NM305]
 gi|240296139|gb|EER46795.1| hypothetical protein AM305_10616 [Actinobacillus minor NM305]
          Length = 290

 Score =  348 bits (894), Expect = 4e-94,   Method: Composition-based stats.
 Identities = 176/299 (58%), Positives = 224/299 (74%), Gaps = 9/299 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           M+IL+DKNTKV+ QG TG  GTFH+EQA+ Y  TQ+VGG+ P KG T   G    +PVF 
Sbjct: 1   MAILIDKNTKVICQGFTGAQGTFHSEQALAY-GTQLVGGVSPNKGGTTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T A A+VIYVP  G  DAI+E+I+A I LIVCITEGIP LDM+ +K +L ++
Sbjct: 56  TVREAVETTQATATVIYVPAPGCKDAILEAIDAGIQLIVCITEGIPTLDMLEIKQKLNQT 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TP+ CKIGIMP +I +KG +GI+SRSGTLTYEAV QT+ EG GQST 
Sbjct: 116 GVRMIGPNCPGVITPEECKIGIMPANIHKKGKIGIISRSGTLTYEAVKQTTDEGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L LF  D  TE+IVM+GEIGGSAEEEAA+F++        KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILRLFEQDPETEAIVMIGEIGGSAEEEAAEFIRKH----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
            ++AG TAP G+ MGHAGA+ISGGKG A++K  A++ AG+    S A IG +L +++ S
Sbjct: 232 SYIAGVTAPKGKRMGHAGAIISGGKGTADEKFAALEAAGVTTVRSLADIGSALRKVMKS 290


>gi|197284469|ref|YP_002150341.1| succinyl-CoA synthetase subunit alpha [Proteus mirabilis HI4320]
 gi|227356647|ref|ZP_03841033.1| succinyl-CoA synthetase alpha chain [Proteus mirabilis ATCC 29906]
 gi|194681956|emb|CAR41371.1| succinyl-CoA synthetase alpha chain [Proteus mirabilis HI4320]
 gi|227163155|gb|EEI48086.1| succinyl-CoA synthetase alpha chain [Proteus mirabilis ATCC 29906]
          Length = 290

 Score =  348 bits (894), Expect = 4e-94,   Method: Composition-based stats.
 Identities = 176/299 (58%), Positives = 220/299 (73%), Gaps = 9/299 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL+DKNTKV+ QG TG  GTFH+EQAI Y  TQ+VGG+ P KG T   G    +PVF 
Sbjct: 1   MSILIDKNTKVICQGFTGSQGTFHSEQAIAY-GTQMVGGVTPGKGGTTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T A A+VIYVP     D+I+E+I+A I LI+ ITEGIP LDM+ VK +L+++
Sbjct: 56  TVREAVEATGATATVIYVPAPFCKDSILEAIDAGIKLIITITEGIPTLDMLTVKVKLDEA 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TP  CKIGIMPG I   G VGI+SRSGTLTYEAV QT+  GLGQST 
Sbjct: 116 GVRMIGPNCPGVITPGECKIGIMPGHIHLPGKVGIVSRSGTLTYEAVKQTTDVGLGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L+LF  D  TE+IVM+GEIGG+AEEEAA ++KD       KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILKLFQEDPQTEAIVMIGEIGGTAEEEAAAYIKDH----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
           G++AG TAP G+ MGHAGA+I+GGKG A++K  A++ AG+    S A IG ++  LL  
Sbjct: 232 GYIAGVTAPKGKRMGHAGAIIAGGKGTADEKFAALEAAGVKTVRSLADIGDAVKSLLNK 290


>gi|257464604|ref|ZP_05628975.1| hypothetical protein AM202_05095 [Actinobacillus minor 202]
 gi|257450264|gb|EEV24307.1| hypothetical protein AM202_05095 [Actinobacillus minor 202]
          Length = 289

 Score =  348 bits (894), Expect = 5e-94,   Method: Composition-based stats.
 Identities = 176/298 (59%), Positives = 222/298 (74%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           M+IL+DKNTKV+ QG TG  GTFH+EQA+ Y  TQ+VGG+ P KG T   G    +PVF 
Sbjct: 1   MAILIDKNTKVICQGFTGAQGTFHSEQALAY-GTQLVGGVSPNKGGTTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T A A+VIYVP  G  DAI+E+I+A I LIVCITEGIP LDM+ +K +L ++
Sbjct: 56  TVREAVEATQATATVIYVPAPGCKDAILEAIDAGIQLIVCITEGIPTLDMLEIKQKLNQT 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TP+ CKIGIMP +I +KG +GI+SRSGTLTYEAV QT+ EG GQST 
Sbjct: 116 GVRMIGPNCPGVITPEECKIGIMPANIHKKGKIGIVSRSGTLTYEAVKQTTDEGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L LF  D  TE+IVM+GEIGGSAEEEAA+F++        KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILRLFEQDPETEAIVMIGEIGGSAEEEAAEFIRKH----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            ++AG TAP G+ MGHAGA+ISGGKG A++K  A++ AG+    S A IG +L  +L 
Sbjct: 232 SYIAGVTAPKGKRMGHAGAIISGGKGTADEKFAALEAAGVTTVRSLAEIGSALKRVLK 289


>gi|90411602|ref|ZP_01219612.1| succinyl-CoA synthetase alpha subunit [Photobacterium profundum
           3TCK]
 gi|90327492|gb|EAS43845.1| succinyl-CoA synthetase alpha subunit [Photobacterium profundum
           3TCK]
          Length = 290

 Score =  348 bits (894), Expect = 5e-94,   Method: Composition-based stats.
 Identities = 180/298 (60%), Positives = 225/298 (75%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+TKV+ QG TG  GTFH+EQAI Y  T++VGG+ P KG T      +++PVF 
Sbjct: 1   MSVLINKDTKVICQGFTGGQGTFHSEQAIAY-GTKMVGGVSPGKGGTTH----LDLPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T A ASVIYVP     DAI+E+I+A I LIV ITEGIP LD++ VK RL+++
Sbjct: 56  TVREAVEETGATASVIYVPAPFCKDAILEAIDAGIKLIVTITEGIPTLDLLDVKVRLDEA 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
              +IGPNCPG++TPD CKIGIMPG I +KG VGI+SRSGTLTYEAV QT+ EG GQST 
Sbjct: 116 GVVMIGPNCPGVITPDECKIGIMPGHIHQKGKVGIVSRSGTLTYEAVKQTTDEGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L+LF  D  TE+IVM+GEIGG+AEEEAA F+K        KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILKLFQEDPETEAIVMIGEIGGTAEEEAAAFIKAN----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            ++AG TAPPG+ MGHAGA+ISGGKG AEDK  A++EAG+    S A IG++L E+ G
Sbjct: 232 SYIAGVTAPPGKRMGHAGAIISGGKGTAEDKFAALEEAGVKTVKSLADIGKALREVTG 289


>gi|149183633|ref|ZP_01862050.1| succinyl-CoA synthetase subunit alpha [Bacillus sp. SG-1]
 gi|148848650|gb|EDL62883.1| succinyl-CoA synthetase subunit alpha [Bacillus sp. SG-1]
          Length = 300

 Score =  348 bits (894), Expect = 5e-94,   Method: Composition-based stats.
 Identities = 179/299 (59%), Positives = 230/299 (76%), Gaps = 9/299 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+ ++K+TKV+VQG+TG    FHT+Q + Y  TQ+V G+ P KG T   G    VPVF 
Sbjct: 1   MSVFINKDTKVIVQGITGSTALFHTKQMLEY-GTQIVAGVTPGKGGTEVEG----VPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EAK+ T ANASVIYVP   A DAI+E+++AE+ L +CITE IPVLDMV+VK  +E  
Sbjct: 56  TVEEAKKETGANASVIYVPAPFAADAILEAVDAELDLAICITEHIPVLDMVKVKRYMEGK 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            +RL+GPNCPG++TPD CKIGIMPG I  KG VG++SRSGTLTYEAV Q SQEG+GQSTA
Sbjct: 116 KTRLVGPNCPGVITPDECKIGIMPGYIHTKGHVGVVSRSGTLTYEAVHQLSQEGIGQSTA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPV GT+FIDVL+ F  DE T +++M+GEIGG+AEEEAA+++K        KP+V
Sbjct: 176 VGIGGDPVNGTDFIDVLKAFNEDEDTYAVIMIGEIGGTAEEEAAEWVKANM----TKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
           GF+ G+TAPPG+ MGHAGA+ISGGKG A++KI  M E GI +AP+P+ +G +L+++L  
Sbjct: 232 GFIGGRTAPPGKRMGHAGAIISGGKGTADEKIRVMNECGIEVAPTPSDMGETLIKVLKD 290


>gi|163869363|ref|YP_001610619.1| succinyl-CoA synthetase subunit alpha [Bartonella tribocorum CIP
           105476]
 gi|161019066|emb|CAK02624.1| succinyl-CoA synthetase, alpha chain [Bartonella tribocorum CIP
           105476]
          Length = 300

 Score =  348 bits (894), Expect = 5e-94,   Method: Composition-based stats.
 Identities = 230/299 (76%), Positives = 272/299 (90%), Gaps = 1/299 (0%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTG-GNVNVPVF 59
           MSILV+K+TKVLVQGLTGK GTFHTEQA+ Y  TQ+VGG++PKKG   W G     +P+F
Sbjct: 1   MSILVNKDTKVLVQGLTGKTGTFHTEQALAYYGTQMVGGVNPKKGGETWEGSKGETLPIF 60

Query: 60  TTVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEK 119
            +VAEAKE+T A+ASVIYVPP+GA  AI+E+IEAE+ LI+CITEGIPV+DMV+VKARLE 
Sbjct: 61  ASVAEAKEKTGADASVIYVPPAGAAAAILEAIEAEVRLIICITEGIPVMDMVKVKARLEN 120

Query: 120 SSSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQST 179
           S SRLIGPNCPGILTP+ CKIGIMPGSIFRKGSVG++SRSGTLTYEAVFQTSQEGLGQ+T
Sbjct: 121 SKSRLIGPNCPGILTPNECKIGIMPGSIFRKGSVGVVSRSGTLTYEAVFQTSQEGLGQTT 180

Query: 180 AVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPI 239
           A+GIGGDPVKGTEFIDVLE+FLAD+ T+SIVM+GEIGGSAEEEAAQFL+DEA++GRKKP+
Sbjct: 181 AIGIGGDPVKGTEFIDVLEMFLADDETQSIVMIGEIGGSAEEEAAQFLQDEARKGRKKPV 240

Query: 240 VGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           VGF+AG+TAPPGRTMGHAGAVISGGKGGAEDKI AM+ AGI ++PSP++IG++L+ +L 
Sbjct: 241 VGFIAGRTAPPGRTMGHAGAVISGGKGGAEDKIAAMESAGIRVSPSPSQIGKTLMSVLN 299


>gi|288553076|ref|YP_003425011.1| succinyl-CoA synthetase subunit alpha [Bacillus pseudofirmus OF4]
 gi|288544236|gb|ADC48119.1| succinyl-CoA synthetase subunit alpha [Bacillus pseudofirmus OF4]
          Length = 304

 Score =  348 bits (893), Expect = 5e-94,   Method: Composition-based stats.
 Identities = 179/299 (59%), Positives = 231/299 (77%), Gaps = 9/299 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL++K+TKV+VQG+TG  G FHT+QAI Y  TQ+VGG+ P KG T   G    VPVF 
Sbjct: 1   MSILINKDTKVIVQGITGATGLFHTQQAIEY-GTQIVGGVTPGKGGTEVEG----VPVFD 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV +A + T ANASVIYVPP+ A DAI+E+++AE+ L +CITEGIPV+DMV V+  +E  
Sbjct: 56  TVEDAVKATGANASVIYVPPAFAADAIMEAVDAELDLAICITEGIPVMDMVSVRRYMEGK 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            +RLIGPNCPG++TP+ CKIGIMPG I +KG VG++SRSGTLTYEAV Q S  G+GQSTA
Sbjct: 116 KTRLIGPNCPGVITPEECKIGIMPGYIHKKGHVGVVSRSGTLTYEAVHQLSTNGIGQSTA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPV GT FIDVLELF  D  T +++M+GEIGG+AEEEAA+++K       KKP+V
Sbjct: 176 VGIGGDPVNGTNFIDVLELFNEDPETYAVIMIGEIGGTAEEEAAEWIKANM----KKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
           GF+ G+TAPPG+ MGHAGA+ISGGKG A +KI  ++  G+ +A +P+ +G +L++ L  
Sbjct: 232 GFIGGQTAPPGKRMGHAGAIISGGKGTAAEKIKTLESCGVKVAETPSVMGETLIKALKE 290


>gi|330973463|gb|EGH73529.1| succinyl-CoA synthetase subunit alpha [Pseudomonas syringae pv.
           aceris str. M302273PT]
          Length = 293

 Score =  348 bits (893), Expect = 5e-94,   Method: Composition-based stats.
 Identities = 171/298 (57%), Positives = 217/298 (72%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+TKV+ QG TG  GTFH+EQAI Y  T++VGG+ P KG T      +N+PVF 
Sbjct: 1   MSVLINKDTKVICQGFTGSQGTFHSEQAIAY-GTKMVGGVTPGKGGTTH----LNLPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA + T A ASVIYVP     D+I+E+  + I LIVCITEGIP +DM+  K + ++ 
Sbjct: 56  TVKEAVDTTGATASVIYVPAPFCKDSILEAAFSGIKLIVCITEGIPTIDMLEAKVKCDEL 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
              LIGPNCPG++TP  CKIGIMPG I   G VGI+SRSGTLTYEAV QT+  G GQST 
Sbjct: 116 GVVLIGPNCPGVITPGECKIGIMPGHIHLPGKVGIVSRSGTLTYEAVKQTTDAGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L+LF  D  TE+IVM+GEIGGSAEEEAA ++K        KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILKLFQEDPKTEAIVMIGEIGGSAEEEAAAYIKAH----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            ++AG TAPPG+ MGHAGA+ISGGKG A++K  A+++AG+    S A IG++L EL G
Sbjct: 232 SYIAGVTAPPGKRMGHAGAIISGGKGTADEKFAALQDAGVKTVRSLADIGKALAELTG 289


>gi|157803808|ref|YP_001492357.1| succinyl-CoA synthetase subunit alpha [Rickettsia canadensis str.
           McKiel]
 gi|157785071|gb|ABV73572.1| succinyl-CoA synthetase alpha subunit [Rickettsia canadensis str.
           McKiel]
          Length = 292

 Score =  348 bits (893), Expect = 5e-94,   Method: Composition-based stats.
 Identities = 183/299 (61%), Positives = 232/299 (77%), Gaps = 8/299 (2%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL++K TKV+ QG TG  GTFH+EQAI Y  T +VGG+ P KG        +++PV+ 
Sbjct: 1   MSILINKKTKVICQGFTGSQGTFHSEQAIAY-GTNMVGGVTPGKGGDTH----LDLPVYN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EAK +T ANASVIYVPP  A D+I+E+I+AEI ++VCITEGIPVLDMV+VK  L  S
Sbjct: 56  TVHEAKAKTGANASVIYVPPGFAADSILEAIDAEIEVVVCITEGIPVLDMVKVKRALVGS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            +RLIGPNCPG++TP  CKIGIMPG I ++G VGI+SRSGTLTYEAV QT+  GLGQST 
Sbjct: 116 KTRLIGPNCPGVITPGECKIGIMPGYIHQRGIVGIVSRSGTLTYEAVAQTTAVGLGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPV GT F+D +E+FL D+ T++I+M+GEIGG+AEE+A+ F+K       KKPIV
Sbjct: 176 VGIGGDPVNGTNFVDCIEMFLKDDETKAIIMIGEIGGNAEEDASDFIKQ---SKIKKPIV 232

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
            F+AG TAPPG+ MGHAGA+I+GGKG AEDK+ A++ AGI I   PA IG+++++LL  
Sbjct: 233 SFIAGITAPPGKRMGHAGAIIAGGKGSAEDKLEALQSAGITITRCPADIGKTMLDLLNK 291


>gi|16273117|ref|NP_439353.1| succinyl-CoA synthetase subunit alpha [Haemophilus influenzae Rd
           KW20]
 gi|260581103|ref|ZP_05848924.1| succinyl-CoA synthetase alpha subunit [Haemophilus influenzae RdAW]
 gi|1174474|sp|P45102|SUCD_HAEIN RecName: Full=Succinyl-CoA ligase [ADP-forming] subunit alpha;
           AltName: Full=Succinyl-CoA synthetase subunit alpha;
           Short=SCS-alpha
 gi|1574126|gb|AAC22851.1| succinyl-CoA synthetase, alpha subunit (sucD) [Haemophilus
           influenzae Rd KW20]
 gi|260092232|gb|EEW76174.1| succinyl-CoA synthetase alpha subunit [Haemophilus influenzae RdAW]
          Length = 293

 Score =  348 bits (893), Expect = 5e-94,   Method: Composition-based stats.
 Identities = 183/299 (61%), Positives = 222/299 (74%), Gaps = 9/299 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           M+IL+DKNTKV+ QG TG  GTFH+EQA+ Y  TQ+VGG+ P KG T   G    +PVF 
Sbjct: 1   MAILIDKNTKVICQGFTGGQGTFHSEQALAY-GTQLVGGVSPNKGGTTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T   A+VIYVP S   DAIIE+I+A I LIVCITEGIP LDM++VK +L ++
Sbjct: 56  TVREAVENTGVTATVIYVPASFCKDAIIEAIDAGIQLIVCITEGIPTLDMLKVKQKLNET 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
              +IGPNCPG++TPD CKIGIMP  I +KG VGI+SRSGTLTYEAV QT+ EG GQST 
Sbjct: 116 GVVMIGPNCPGVITPDECKIGIMPAHIHKKGKVGIVSRSGTLTYEAVKQTTDEGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+LE F  D  TE+IVM+GEIGGSAEEEAA F+KD       KP+V
Sbjct: 176 VGIGGDPIPGSSFIDILERFQQDPETEAIVMIGEIGGSAEEEAAIFIKDN----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
            ++AG TAP G+ MGHAGA+ISGGKG A +KI A++ AG+    S A IG +L +LL S
Sbjct: 232 AYIAGITAPKGKRMGHAGAIISGGKGTAVEKIAALEAAGVTCVKSLAEIGEALRKLLKS 290


>gi|157692289|ref|YP_001486751.1| succinyl-CoA synthetase subunit alpha [Bacillus pumilus SAFR-032]
 gi|194014871|ref|ZP_03053488.1| succinate-CoA ligase, alpha subunit subfamily [Bacillus pumilus
           ATCC 7061]
 gi|157681047|gb|ABV62191.1| succinate--CoA ligase (ADP-forming) alpha subunit [Bacillus pumilus
           SAFR-032]
 gi|194013897|gb|EDW23462.1| succinate-CoA ligase, alpha subunit subfamily [Bacillus pumilus
           ATCC 7061]
          Length = 300

 Score =  348 bits (893), Expect = 5e-94,   Method: Composition-based stats.
 Identities = 174/299 (58%), Positives = 229/299 (76%), Gaps = 9/299 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+ ++KNT+V+VQG+TG    FHT+Q I Y  T +VGG+ P KG T   G    VPVF 
Sbjct: 1   MSVFINKNTRVIVQGITGSTALFHTKQMIEY-GTNIVGGVTPGKGGTEVEG----VPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV+EA + T ANASVIYVP   A DAI+E+++AE+ L++CITE IPVLDMV+VK  +E  
Sbjct: 56  TVSEAVQTTGANASVIYVPAPFAADAILEAVDAEVDLVICITEHIPVLDMVKVKRYMEGK 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            +RL+GPNCPG++TP+ CKIGIMPG I +KG VG++SRSGTLTYEAV Q S+ G+GQSTA
Sbjct: 116 KTRLVGPNCPGVITPEECKIGIMPGYIHKKGHVGVVSRSGTLTYEAVHQLSEAGVGQSTA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPV GT FIDVL+ F  D  T +++M+GEIGG+AEEEAA+++K        KP+V
Sbjct: 176 VGIGGDPVNGTNFIDVLKAFNEDPDTHAVIMIGEIGGTAEEEAAEWVKANM----TKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
           GF+ GKTAPPG+ MGHAGA+ISGGKG A++K+  M+E GI +A +P+ +G +L+++L  
Sbjct: 232 GFIGGKTAPPGKRMGHAGAIISGGKGTADEKVKTMRECGIEVAETPSVMGETLIKVLKE 290


>gi|271499754|ref|YP_003332779.1| succinyl-CoA synthetase subunit alpha [Dickeya dadantii Ech586]
 gi|270343309|gb|ACZ76074.1| succinyl-CoA synthetase, alpha subunit [Dickeya dadantii Ech586]
          Length = 290

 Score =  348 bits (893), Expect = 5e-94,   Method: Composition-based stats.
 Identities = 178/297 (59%), Positives = 222/297 (74%), Gaps = 9/297 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL+DKNTKV+ QG TG  G+FH+EQAI Y  TQ+VGG+ P KG T   G    +PVF 
Sbjct: 1   MSILIDKNTKVICQGFTGSQGSFHSEQAIAY-GTQMVGGVTPGKGGTEHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T A ASVIYVP     D+I+E+I+A I LI+CITEGIP LDM+ VK +LE+S
Sbjct: 56  TVREAVEATGATASVIYVPAPFCKDSILEAIDAGIQLIICITEGIPTLDMLTVKVKLEQS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TP +CKIGIMPG I   G VGI+SRSGTLTYEAV QT+  GLGQST 
Sbjct: 116 GVRMIGPNCPGVITPGACKIGIMPGHIHLPGKVGIVSRSGTLTYEAVKQTTDAGLGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L+LF  D  TE+IVM+GEIGG+AEEEAA ++K+       KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILKLFEQDPQTEAIVMIGEIGGTAEEEAAAYIKEH----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELL 297
           G++AG TAP G+ MGHAGA+I+GGKG A+DK  A++ AG+    S A IG ++  +L
Sbjct: 232 GYIAGVTAPKGKRMGHAGAIIAGGKGTADDKFAALEAAGVKTVRSLADIGDAVKAVL 288


>gi|212639578|ref|YP_002316098.1| succinyl-CoA synthetase subunit alpha [Anoxybacillus flavithermus
           WK1]
 gi|212561058|gb|ACJ34113.1| Succinyl-CoA synthetase, alpha subunit [Anoxybacillus flavithermus
           WK1]
          Length = 300

 Score =  348 bits (893), Expect = 5e-94,   Method: Composition-based stats.
 Identities = 186/299 (62%), Positives = 232/299 (77%), Gaps = 9/299 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+ V+K+TKV+VQG+TG  G FHT+Q I Y  T +VGG+ P KG T   G    VPVF 
Sbjct: 1   MSVFVNKDTKVIVQGITGSQGLFHTKQMIEY-GTNIVGGVTPGKGGTEVEG----VPVFD 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV+EA E+T ANASVIYVPP+ A DAI+E+++AEI L+VCITEGIPVLDMV+VK  +E  
Sbjct: 56  TVSEAVEKTGANASVIYVPPAFAADAIMEAVDAEIDLVVCITEGIPVLDMVKVKRYMEGK 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            +RLIGPNCPG++TP+ CKIGIMPG I +KG VGI+SRSGTLTYEAV Q +Q G+GQSTA
Sbjct: 116 KTRLIGPNCPGVITPEECKIGIMPGYIHKKGHVGIVSRSGTLTYEAVHQLTQAGIGQSTA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPV GT FIDVL+ F  DE T +++M+GEIGG+AEEEAA+++K        KP+V
Sbjct: 176 VGIGGDPVNGTNFIDVLKAFNEDEDTYAVIMIGEIGGTAEEEAAEWVKANM----TKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
           GF+ G+TAPPG+ MGHAGA+ISGGKG AE+KI  M   GI +A +PA IG +L+ +L  
Sbjct: 232 GFIGGQTAPPGKRMGHAGAIISGGKGTAEEKIKTMTACGIKVAETPAVIGETLISVLKE 290


>gi|319649578|ref|ZP_08003734.1| succinyl-CoA ligase subunit alpha [Bacillus sp. 2_A_57_CT2]
 gi|317398740|gb|EFV79422.1| succinyl-CoA ligase subunit alpha [Bacillus sp. 2_A_57_CT2]
          Length = 300

 Score =  348 bits (893), Expect = 6e-94,   Method: Composition-based stats.
 Identities = 176/299 (58%), Positives = 226/299 (75%), Gaps = 9/299 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+ ++K+TKV+VQG+TG    FHT+Q + Y  TQ+VGG+ P KG T   G    VPVF 
Sbjct: 1   MSVFINKDTKVIVQGITGSTALFHTKQMLEY-GTQIVGGVTPGKGGTEVEG----VPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA + T ANASVIYVP   A DAI+E+++AE+ L +CITE IPVLDMV+VK  +E  
Sbjct: 56  TVEEAVKATGANASVIYVPAPFAADAILEAVDAELDLAICITEHIPVLDMVKVKRYMEGK 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            +RL+GPNCPG++TPD CKIGIMPG I  KG VG++SRSGTLTYEAV Q SQ G+GQSTA
Sbjct: 116 KTRLVGPNCPGVITPDECKIGIMPGYIHTKGHVGVVSRSGTLTYEAVHQLSQAGIGQSTA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPV GT FIDVL+ F  D  T +++M+GEIGG+AEEEAA+++K        KP+V
Sbjct: 176 VGIGGDPVNGTNFIDVLKAFNEDPETYAVIMIGEIGGTAEEEAAEWVKANM----TKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
           GF+ G+TAPPG+ MGHAGA+ISGGKG A++KI  M E GI +A +P+ +G +L+++L  
Sbjct: 232 GFIGGRTAPPGKRMGHAGAIISGGKGTADEKIRVMNECGIQVADTPSVMGETLIKVLKE 290


>gi|157825717|ref|YP_001493437.1| succinyl-CoA synthetase subunit alpha [Rickettsia akari str.
           Hartford]
 gi|157799675|gb|ABV74929.1| succinyl-CoA synthetase subunit alpha [Rickettsia akari str.
           Hartford]
          Length = 292

 Score =  348 bits (893), Expect = 6e-94,   Method: Composition-based stats.
 Identities = 179/299 (59%), Positives = 234/299 (78%), Gaps = 8/299 (2%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           M+IL++K TKV+ QG TG  GTFH+EQAI Y  T +VGGI P KG        +++PV+ 
Sbjct: 1   MAILINKKTKVICQGFTGSQGTFHSEQAIAY-GTNMVGGITPGKGGHTH----LDLPVYN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EAK +T ANASVIYVPPS A D+I+E+I+A+I ++VCITEGIP+LDMV+VK  L  S
Sbjct: 56  TVHEAKAKTGANASVIYVPPSFAADSILEAIDAKIEVVVCITEGIPILDMVKVKRALVGS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            +RLIGPNCPG++TP  CKIGIMPG I ++G++GI+SRSGTLTYEAV QT+  GLGQST 
Sbjct: 116 KTRLIGPNCPGVITPGECKIGIMPGHIHKRGTIGIVSRSGTLTYEAVAQTTAVGLGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPV GT F+D +++FL D+ T++I+M+GEIGG+AEE+AA+F+K       KKPIV
Sbjct: 176 VGIGGDPVNGTNFVDCIDMFLKDDETKAIIMIGEIGGNAEEDAAEFIKQ---SKIKKPIV 232

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
            F+AG TAPPG+ MGHAGA+I+GG+G AEDK+  ++ AG+ I  SPA IG+++ +LL  
Sbjct: 233 SFIAGITAPPGKRMGHAGAIIAGGQGSAEDKLEVLQSAGVTITKSPADIGKTMFDLLNK 291


>gi|28869405|ref|NP_792024.1| succinyl-CoA synthase subunit alpha [Pseudomonas syringae pv.
           tomato str. DC3000]
 gi|213968180|ref|ZP_03396325.1| succinyl-CoA synthase, alpha subunit [Pseudomonas syringae pv.
           tomato T1]
 gi|301383815|ref|ZP_07232233.1| succinyl-CoA synthetase subunit alpha [Pseudomonas syringae pv.
           tomato Max13]
 gi|302059593|ref|ZP_07251134.1| succinyl-CoA synthetase subunit alpha [Pseudomonas syringae pv.
           tomato K40]
 gi|302133382|ref|ZP_07259372.1| succinyl-CoA synthetase subunit alpha [Pseudomonas syringae pv.
           tomato NCPPB 1108]
 gi|28852646|gb|AAO55719.1| succinyl-CoA synthase, alpha subunit [Pseudomonas syringae pv.
           tomato str. DC3000]
 gi|213927160|gb|EEB60710.1| succinyl-CoA synthase, alpha subunit [Pseudomonas syringae pv.
           tomato T1]
 gi|330875692|gb|EGH09841.1| succinyl-CoA synthetase subunit alpha [Pseudomonas syringae pv.
           morsprunorum str. M302280PT]
 gi|331018593|gb|EGH98649.1| succinyl-CoA synthetase subunit alpha [Pseudomonas syringae pv.
           lachrymans str. M302278PT]
          Length = 293

 Score =  348 bits (893), Expect = 6e-94,   Method: Composition-based stats.
 Identities = 171/298 (57%), Positives = 216/298 (72%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+TKV+ QG TG  GTFH+EQAI Y  T++VGG+ P KG T      +N+PVF 
Sbjct: 1   MSVLINKDTKVICQGFTGSQGTFHSEQAIAY-GTKMVGGVTPGKGGTTH----LNLPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA + T A ASVIYVP     D+I+E+    I LIVCITEGIP +DM+  K + ++ 
Sbjct: 56  TVKEAVDTTGATASVIYVPAPFCKDSILEAAFGGIKLIVCITEGIPTIDMLEAKVKCDEL 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
              LIGPNCPG++TP  CKIGIMPG I   G VGI+SRSGTLTYEAV QT+  G GQST 
Sbjct: 116 GVILIGPNCPGVITPGECKIGIMPGHIHLPGKVGIVSRSGTLTYEAVKQTTDAGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L+LF  D  TE+IVM+GEIGGSAEEEAA ++K        KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILKLFQEDPQTEAIVMIGEIGGSAEEEAAAYIKAH----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            ++AG TAPPG+ MGHAGA+ISGGKG A++K  A+++AG+    S A IG++L EL G
Sbjct: 232 SYIAGVTAPPGKRMGHAGAIISGGKGTADEKFAALQDAGVKTVRSLADIGKALAELTG 289


>gi|84393475|ref|ZP_00992231.1| succinyl-CoA synthetase alpha subunit [Vibrio splendidus 12B01]
 gi|218710208|ref|YP_002417829.1| succinyl-CoA synthetase subunit alpha [Vibrio splendidus LGP32]
 gi|84375903|gb|EAP92794.1| succinyl-CoA synthetase alpha subunit [Vibrio splendidus 12B01]
 gi|218323227|emb|CAV19404.1| Succinyl-CoA synthetase alpha chain [Vibrio splendidus LGP32]
          Length = 290

 Score =  348 bits (892), Expect = 7e-94,   Method: Composition-based stats.
 Identities = 179/298 (60%), Positives = 222/298 (74%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+TKV+ QG TG  GTFH++QAI Y  TQ+VGG+ P KG     G    +PVF 
Sbjct: 1   MSVLINKDTKVICQGFTGGQGTFHSDQAIAY-GTQMVGGVSPGKGGQTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T A A+VIYVP     DAI+E+I+A I LIV ITEGIP  DM+ VK +LE++
Sbjct: 56  TVREAVEVTGATATVIYVPAPFCKDAILEAIDAGIELIVTITEGIPTTDMIDVKVKLEET 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TPD CKIGIMPG I +KG VGI+SRSGTLTYEAV QT+ EG GQST 
Sbjct: 116 GVRMIGPNCPGLITPDECKIGIMPGHIHKKGKVGIVSRSGTLTYEAVKQTTDEGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L+LF  D  TE+IVM+GEIGG+AEEEAA+F+K        KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILKLFQEDPETEAIVMIGEIGGTAEEEAAEFIKAN----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            ++AG TAPPG+ MGHAGA+ISGGKG AEDK  A++ AG+    S A IG+ L E+ G
Sbjct: 232 SYIAGVTAPPGKRMGHAGAIISGGKGTAEDKFAALEAAGVKTVKSLADIGKGLREITG 289


>gi|145637049|ref|ZP_01792712.1| succinyl-CoA synthetase alpha subunit [Haemophilus influenzae
           PittHH]
 gi|260582126|ref|ZP_05849920.1| succinyl-CoA synthetase alpha subunit [Haemophilus influenzae
           NT127]
 gi|145269703|gb|EDK09643.1| succinyl-CoA synthetase alpha subunit [Haemophilus influenzae
           PittHH]
 gi|260094758|gb|EEW78652.1| succinyl-CoA synthetase alpha subunit [Haemophilus influenzae
           NT127]
          Length = 293

 Score =  348 bits (892), Expect = 7e-94,   Method: Composition-based stats.
 Identities = 184/299 (61%), Positives = 223/299 (74%), Gaps = 9/299 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           M+IL+DKNTKV+ QG TG  GTFH+EQA+ Y  TQ+VGG+ P KG T   G    +PVF 
Sbjct: 1   MAILIDKNTKVICQGFTGGQGTFHSEQALAY-GTQLVGGVSPNKGGTTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T A A+VIYVP S   DAIIE+I+A I LIVCITEGIP LDM++VK +L ++
Sbjct: 56  TVREAVENTGATATVIYVPASFCKDAIIEAIDAGIQLIVCITEGIPTLDMLKVKQKLNET 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
              +IGPNCPG++TPD CKIGIMP  I +KG VGI+SRSGTLTYEAV QT+ EG GQST 
Sbjct: 116 GVVMIGPNCPGVITPDECKIGIMPAHIHKKGKVGIVSRSGTLTYEAVKQTTDEGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+LE F  D  TE+IVM+GEIGGSAEEEAA F+KD       KP+V
Sbjct: 176 VGIGGDPILGSSFIDILERFQQDPETEAIVMIGEIGGSAEEEAAIFIKDN----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
            ++AG TAP G+ MGHAGA+ISGGKG A +KI A++ AG+    S A IG +L +LL S
Sbjct: 232 AYIAGITAPKGKRMGHAGAIISGGKGTAVEKIAALEAAGVTCVKSLAEIGEALRKLLKS 290


>gi|260914170|ref|ZP_05920643.1| succinyl-CoA synthetase subunit alpha [Pasteurella dagmatis ATCC
           43325]
 gi|260631803|gb|EEX49981.1| succinyl-CoA synthetase subunit alpha [Pasteurella dagmatis ATCC
           43325]
          Length = 289

 Score =  348 bits (892), Expect = 7e-94,   Method: Composition-based stats.
 Identities = 177/298 (59%), Positives = 225/298 (75%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL++K+TKV+ QG TG  GTFH+EQA+ Y  TQ+VGG+ P KG T   G    +PVF 
Sbjct: 1   MSILINKDTKVICQGFTGGQGTFHSEQALAY-GTQLVGGVSPGKGGTTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV +A E T A A+VIYVP  G  DAI+E+I+A I L++CITEGIP LDM++VK RL ++
Sbjct: 56  TVRDAVETTGATATVIYVPAPGCKDAILEAIDAGIKLVICITEGIPTLDMLQVKQRLTQA 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TP+ CKIGIMPG+I +KG +GI+SRSGTLTYEAV QT+ EG GQST 
Sbjct: 116 GVRMIGPNCPGVITPEECKIGIMPGNIHKKGKIGIVSRSGTLTYEAVKQTTDEGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L+LF  D  TE+IVM+GEIGGSAEEEAA F+K+       KP+V
Sbjct: 176 VGIGGDPIPGSSFIDILKLFQDDPQTEAIVMIGEIGGSAEEEAASFIKEY----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            ++AG TAP G+ MGHAGA+ISGGKG A++K  A++ AG+    S A IG +L  LL 
Sbjct: 232 SYIAGVTAPKGKRMGHAGAIISGGKGTADEKFAALEAAGVKTVRSLAEIGTALKSLLK 289


>gi|146282242|ref|YP_001172395.1| succinyl-CoA synthetase subunit alpha [Pseudomonas stutzeri A1501]
 gi|145570447|gb|ABP79553.1| succinyl-CoA synthetase alpha chain [Pseudomonas stutzeri A1501]
          Length = 294

 Score =  348 bits (892), Expect = 7e-94,   Method: Composition-based stats.
 Identities = 174/298 (58%), Positives = 216/298 (72%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+TKV+ QG TG  GTFH+EQAI Y  T++VGG+ P KG T   G    +PVF 
Sbjct: 1   MSVLINKDTKVICQGFTGSQGTFHSEQAIAY-GTKMVGGVTPGKGGTMHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T A+ASVIYVP     D+I+E+    I LIVCITEGIP LDM+ VK + ++ 
Sbjct: 56  TVREAVEATGADASVIYVPAPFCKDSILEAAFGGIKLIVCITEGIPTLDMLEVKIKCDEL 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             RLIGPNCPG++TP  CKIGI PG I   G VGI+SRSGTLTYEAV QT+  G GQST 
Sbjct: 116 GVRLIGPNCPGVITPGECKIGIQPGHIHMPGKVGIVSRSGTLTYEAVKQTTDAGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L+LF  D  TE+IVM+GEIGGSAEEEAA F+K        KP+V
Sbjct: 176 VGIGGDPIPGSTFIDILKLFQDDPQTEAIVMIGEIGGSAEEEAAAFIKAN----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            ++AG TAP G+ MGHAGA+ISGGKG AE+K  A+++AG+    S A IG++L E+ G
Sbjct: 232 SYIAGVTAPAGKRMGHAGAIISGGKGTAEEKFAALQDAGVKTVRSLADIGKALAEVTG 289


>gi|295399797|ref|ZP_06809778.1| succinyl-CoA synthetase, alpha subunit [Geobacillus
           thermoglucosidasius C56-YS93]
 gi|312111691|ref|YP_003990007.1| succinyl-CoA synthetase, subunit alpha [Geobacillus sp. Y4.1MC1]
 gi|294978200|gb|EFG53797.1| succinyl-CoA synthetase, alpha subunit [Geobacillus
           thermoglucosidasius C56-YS93]
 gi|311216792|gb|ADP75396.1| succinyl-CoA synthetase, alpha subunit [Geobacillus sp. Y4.1MC1]
          Length = 300

 Score =  348 bits (892), Expect = 7e-94,   Method: Composition-based stats.
 Identities = 185/299 (61%), Positives = 234/299 (78%), Gaps = 9/299 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+ ++K+TKV+VQG+TG  G FHT+Q I Y  T++VGG+ P KG T   G    VPVF 
Sbjct: 1   MSVFINKDTKVIVQGITGSQGLFHTKQMIEY-GTKIVGGVTPGKGGTEIEG----VPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV+EA E+T ANASVIYVPP+ A DAI+E+++AE+ L+VCITEGIPVLDMV+VK  +E  
Sbjct: 56  TVSEAVEKTGANASVIYVPPAFAADAIMEAVDAELDLVVCITEGIPVLDMVKVKRYMEGK 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            +RLIGPNCPG++TP+ CKIGIMPG I +KG VGI+SRSGTLTYEAV Q +Q G+GQSTA
Sbjct: 116 KTRLIGPNCPGVITPEECKIGIMPGYIHKKGHVGIVSRSGTLTYEAVHQLTQAGIGQSTA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPV GT FIDVL+ F  DE T +++M+GEIGG+AEEEAA+++K       KKP+V
Sbjct: 176 VGIGGDPVNGTNFIDVLKAFNEDEETYAVIMIGEIGGTAEEEAAEWVKANM----KKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
           GF+ G+TAPPG+ MGHAGA+ISGGKG A +KI  M E GI +A +PA IG +L+ +L  
Sbjct: 232 GFIGGQTAPPGKRMGHAGAIISGGKGTAAEKIKKMNECGIKVAETPAVIGETLIAVLKE 290


>gi|149191115|ref|ZP_01869374.1| succinyl-CoA synthetase subunit alpha [Vibrio shilonii AK1]
 gi|148835043|gb|EDL52021.1| succinyl-CoA synthetase subunit alpha [Vibrio shilonii AK1]
          Length = 290

 Score =  348 bits (892), Expect = 7e-94,   Method: Composition-based stats.
 Identities = 181/298 (60%), Positives = 222/298 (74%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+TKV+ QG TG  GTFH+EQAI Y  TQ+VGG+ P KG     G    +PVF 
Sbjct: 1   MSVLINKDTKVICQGFTGGQGTFHSEQAIEY-GTQMVGGVSPGKGGQTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T A ASVIYVP     DAI+E+I+A I LIV ITEGIP LD++ VK RL+++
Sbjct: 56  TVREAVEETGATASVIYVPAPFCKDAILEAIDAGIKLIVTITEGIPTLDLLDVKVRLDEA 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
              +IGPNCPG++TPD CKIGIMPG I +KG VGI+SRSGTLTYEAV QT+ EG GQST 
Sbjct: 116 GVVMIGPNCPGVITPDECKIGIMPGHIHKKGKVGIVSRSGTLTYEAVKQTTDEGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L+LF  D  TE+IVM+GEIGG+AEEEAA F+KD       KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILKLFEQDPETEAIVMIGEIGGTAEEEAAAFIKDN----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            ++AG TAPPG+ MGHAGA+ISGGKG AEDK  A++ AG+    S A IG+ L E+ G
Sbjct: 232 SYIAGVTAPPGKRMGHAGAIISGGKGTAEDKFAALEAAGVKTVKSLADIGKGLREITG 289


>gi|54308244|ref|YP_129264.1| succinyl-CoA synthetase subunit alpha [Photobacterium profundum
           SS9]
 gi|46912672|emb|CAG19462.1| putative succinyl-CoA synthase, alpha subunit [Photobacterium
           profundum SS9]
          Length = 290

 Score =  348 bits (892), Expect = 7e-94,   Method: Composition-based stats.
 Identities = 180/298 (60%), Positives = 225/298 (75%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+TKV+ QG TG  GTFH+EQAI Y  T++VGG+ P KG T   G    +PVF 
Sbjct: 1   MSVLINKDTKVICQGFTGGQGTFHSEQAIAY-GTKMVGGVSPGKGGTTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T A ASVIYVP     DAI+E+I+A I LIV ITEGIP LD++ VK RL+++
Sbjct: 56  TVREAVEETGATASVIYVPAPFCKDAILEAIDAGIKLIVTITEGIPTLDLLDVKVRLDEA 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
              +IGPNCPG++TPD CKIGIMPG+I +KG VGI+SRSGTLTYEAV QT+ EG GQST 
Sbjct: 116 GVVMIGPNCPGVITPDECKIGIMPGNIHQKGKVGIVSRSGTLTYEAVKQTTDEGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L+LF  D  TE+IVM+GEIGG+AEEEAA F+K        KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILKLFQEDPETEAIVMIGEIGGTAEEEAAAFIKAN----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            ++AG TAPPG+ MGHAGA+ISGGKG AEDK  A+++AG+    S A IG++L E+ G
Sbjct: 232 SYIAGVTAPPGKRMGHAGAIISGGKGTAEDKFAALEDAGVKTVKSLADIGKALREVTG 289


>gi|327480490|gb|AEA83800.1| succinyl-CoA synthetase subunit alpha [Pseudomonas stutzeri DSM
           4166]
          Length = 294

 Score =  348 bits (892), Expect = 7e-94,   Method: Composition-based stats.
 Identities = 173/298 (58%), Positives = 216/298 (72%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+TKV+ QG TG  GTFH+EQAI Y  T++VGG+ P KG T   G    +PVF 
Sbjct: 1   MSVLINKDTKVICQGFTGSQGTFHSEQAIAY-GTKMVGGVTPGKGGTMHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T A+ASVIYVP     D+I+E+    I LIVCITEGIP LDM+ VK + ++ 
Sbjct: 56  TVREAVEATGADASVIYVPAPFCKDSILEAAFGGIKLIVCITEGIPTLDMLEVKIKCDEL 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             RLIGPNCPG++TP  CKIGI PG I   G VGI+SRSGTLTYEAV QT+  G GQST 
Sbjct: 116 GVRLIGPNCPGVITPGECKIGIQPGHIHMPGKVGIVSRSGTLTYEAVKQTTDAGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L+LF  D  TE+IVM+GEIGGSAEEEAA F+K        KP+V
Sbjct: 176 VGIGGDPIPGSTFIDILKLFQDDPQTEAIVMIGEIGGSAEEEAAAFIKAN----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            ++AG TAP G+ MGHAGA+ISGGKG A++K  A+++AG+    S A IG++L E+ G
Sbjct: 232 SYIAGVTAPAGKRMGHAGAIISGGKGTADEKFAALQDAGVKTVRSLADIGKALAEVTG 289


>gi|293397231|ref|ZP_06641504.1| succinyl-CoA synthetase subunit alpha [Serratia odorifera DSM 4582]
 gi|291420251|gb|EFE93507.1| succinyl-CoA synthetase subunit alpha [Serratia odorifera DSM 4582]
          Length = 290

 Score =  348 bits (892), Expect = 7e-94,   Method: Composition-based stats.
 Identities = 174/298 (58%), Positives = 220/298 (73%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL+DKNTKV+ QG TG  GTFH+EQAI Y  T++VGG+ P KG T   G    +PVF 
Sbjct: 1   MSILIDKNTKVICQGFTGSQGTFHSEQAIAY-GTKMVGGVTPGKGGTTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T A ASVIYVP     D+I+E+I+A I LI+ ITEGIP LDM+ VK +L+++
Sbjct: 56  TVREAVETTGATASVIYVPAPFCKDSILEAIDAGIKLIITITEGIPTLDMLTVKVKLDEA 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TP  CKIGIMPG I   G VGI+SRSGTLTYEAV QT+  GLGQST 
Sbjct: 116 GVRMIGPNCPGVITPGECKIGIMPGHIHLPGKVGIVSRSGTLTYEAVKQTTDAGLGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L++F  D  TE+IVM+GEIGGSAEEEAA ++K+       KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILKMFQEDPQTEAIVMIGEIGGSAEEEAAAYIKEH----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           G++AG TAP G+ MGHAGA+I+GGKG A++K  A++ AG+    S A IG ++  +L 
Sbjct: 232 GYIAGVTAPKGKRMGHAGAIIAGGKGTADEKFAALEAAGVKTVRSLADIGDAVKAVLN 289


>gi|222087459|ref|YP_002545996.1| succinyl-CoA synthetase alpha subunit protein [Agrobacterium
           radiobacter K84]
 gi|221724907|gb|ACM28063.1| succinyl-CoA synthetase alpha subunit protein [Agrobacterium
           radiobacter K84]
          Length = 300

 Score =  348 bits (892), Expect = 7e-94,   Method: Composition-based stats.
 Identities = 232/299 (77%), Positives = 271/299 (90%), Gaps = 1/299 (0%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGN-VNVPVF 59
           MSIL++K+TKVLVQGLTGK GTFHTEQA+ Y  T++VGGIHP KG   WTG     +P+F
Sbjct: 1   MSILINKDTKVLVQGLTGKTGTFHTEQALAYHGTKMVGGIHPSKGGETWTGKEGEKLPIF 60

Query: 60  TTVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEK 119
            +VAE K+ T ANASVIYVPP+GA  AI+E+I+AEIPLIVCITEGIPV DMV+VKARL+K
Sbjct: 61  KSVAEGKDATGANASVIYVPPAGAAAAILEAIDAEIPLIVCITEGIPVADMVKVKARLDK 120

Query: 120 SSSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQST 179
           S SRLIGPNCPG+LTP+ CKIGIMPGSIF+KGSVG+LSRSGTLTYEAVFQT+ EGLGQ+T
Sbjct: 121 SKSRLIGPNCPGVLTPNECKIGIMPGSIFKKGSVGVLSRSGTLTYEAVFQTTNEGLGQTT 180

Query: 180 AVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPI 239
           AVGIGGDPVKGTEFID+LE+FLAD+ T+SI+M+GEIGGSAEEEAAQFLKDEAK+GRKKP+
Sbjct: 181 AVGIGGDPVKGTEFIDILEMFLADDETKSIIMIGEIGGSAEEEAAQFLKDEAKKGRKKPM 240

Query: 240 VGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           VGF+AG+TAPPGRTMGHAGAVISGGKGGAEDKI AM+ AGI ++PSPAR+G++LVE+L 
Sbjct: 241 VGFIAGRTAPPGRTMGHAGAVISGGKGGAEDKIAAMEAAGIRVSPSPARLGKTLVEVLK 299


>gi|215485747|ref|YP_002328178.1| succinyl-CoA synthetase subunit alpha [Escherichia coli O127:H6
           str. E2348/69]
 gi|312965159|ref|ZP_07779396.1| succinyl-CoA ligase [ADP-forming] subunit alpha [Escherichia coli
           2362-75]
 gi|215263819|emb|CAS08156.1| succinyl-CoA synthetase, NAD(P)-binding, alpha subunit [Escherichia
           coli O127:H6 str. E2348/69]
 gi|312290250|gb|EFR18133.1| succinyl-CoA ligase [ADP-forming] subunit alpha [Escherichia coli
           2362-75]
 gi|323191073|gb|EFZ76338.1| succinyl-CoA ligase [ADP-forming] subunit alpha [Escherichia coli
           RN587/1]
          Length = 289

 Score =  348 bits (892), Expect = 8e-94,   Method: Composition-based stats.
 Identities = 173/298 (58%), Positives = 218/298 (73%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL+DKNTKV+ QG TG  GTFH+EQAI Y  T++VGG+ P KG T   G    +PVF 
Sbjct: 1   MSILIDKNTKVICQGFTGSQGTFHSEQAIAY-GTKMVGGVTPGKGGTTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA   T A ASVIYVP     D+I+E+I+A I LI+ ITEGIP LDM+ VK +L+++
Sbjct: 56  TVREAVAATGATASVIYVPAPFCKDSILEAIDAGIKLIITITEGIPTLDMLIVKVKLDEA 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TP  CKIGI PG I + G VGI+SRSGTLTYEAV QT+  G GQST 
Sbjct: 116 GVRMIGPNCPGVITPGECKIGIQPGHIHKPGKVGIVSRSGTLTYEAVKQTTDYGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+LE+F  D  TE+IVM+GEIGGSAEEEAA ++K+       KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILEMFEKDPQTEAIVMIGEIGGSAEEEAAAYIKEH----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           G++AG TAP G+ MGHAGA+I+GGKG A++K  A++ AG+    S A IG +L  +L 
Sbjct: 232 GYIAGVTAPKGKRMGHAGAIIAGGKGTADEKFAALEAAGVKTVRSLADIGEALKTVLQ 289


>gi|325498097|gb|EGC95956.1| Succinyl-CoA synthetase alpha chain (SCS-alpha) [Escherichia
           fergusonii ECD227]
          Length = 289

 Score =  348 bits (892), Expect = 8e-94,   Method: Composition-based stats.
 Identities = 173/298 (58%), Positives = 218/298 (73%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL+DKNTKV+ QG TG  GTFH+EQAI Y  T++VGG+ P KG T   G    +PVF 
Sbjct: 1   MSILIDKNTKVICQGFTGSQGTFHSEQAIAY-GTKMVGGVTPGKGGTTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA   T A ASVIYVP     D+I+E+I+A I LI+ ITEGIP LDM+ VK +L+++
Sbjct: 56  TVREAVAATGATASVIYVPAPFCKDSILEAIDAGIKLIITITEGIPTLDMLAVKVKLDEA 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TP  CKIGI PG I + G VGI+SRSGTLTYEAV QT+  G GQST 
Sbjct: 116 GVRMIGPNCPGVITPGECKIGIQPGHIHKPGKVGIVSRSGTLTYEAVKQTTDYGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+LE+F  D  TE+IVM+GEIGGSAEEEAA ++K+       KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILEMFEKDPQTEAIVMIGEIGGSAEEEAAAYIKEH----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           G++AG TAP G+ MGHAGA+I+GGKG A++K  A++ AG+    S A IG +L  +L 
Sbjct: 232 GYIAGVTAPKGKRMGHAGAIIAGGKGTADEKFAALEAAGVKTVRSLADIGEALKTVLK 289


>gi|15892521|ref|NP_360235.1| succinyl-CoA synthetase subunit alpha [Rickettsia conorii str.
           Malish 7]
 gi|81528265|sp|Q92I22|SUCD_RICCN RecName: Full=Succinyl-CoA ligase [ADP-forming] subunit alpha;
           AltName: Full=Succinyl-CoA synthetase subunit alpha;
           Short=SCS-alpha
 gi|15619681|gb|AAL03136.1| succinyl-CoA synthetase alpha chain [Rickettsia conorii str. Malish
           7]
          Length = 292

 Score =  348 bits (892), Expect = 8e-94,   Method: Composition-based stats.
 Identities = 178/299 (59%), Positives = 232/299 (77%), Gaps = 8/299 (2%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           M+IL++K T+V+ QG TG  GTFH+EQAI Y  T +VGG+ P KG        +++PV+ 
Sbjct: 1   MAILINKKTQVICQGFTGLQGTFHSEQAIAY-GTNMVGGVTPGKGGHTH----LDLPVYN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EAK +T ANASVIYVPP  A D+I+E+I+AEI ++VCITEGIPVLDMV+VK  L  S
Sbjct: 56  TVHEAKAKTGANASVIYVPPGFAADSILEAIDAEIEVVVCITEGIPVLDMVKVKRALVGS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            +RLIGPNCPG++TP  CKIGIMPG I ++G++GI+SRSGTLTYEAV QT+  GLGQST 
Sbjct: 116 KTRLIGPNCPGVITPGECKIGIMPGHIHKRGTIGIVSRSGTLTYEAVAQTTAVGLGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           +GIGGDPV GT F+D +E+FL D+ T++I+M+GEIGG+AEE+AA+F+K       KKPIV
Sbjct: 176 IGIGGDPVNGTNFVDCIEMFLKDDETKAIIMIGEIGGNAEEDAAEFIKQ---SKIKKPIV 232

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
            F+AG TAPPG+ MGHAGA+I G  G AEDK+ A++ AG+ I  SPA IG+++++LL  
Sbjct: 233 SFIAGITAPPGKRMGHAGAIIVGRTGSAEDKLEALQSAGVIITRSPADIGKTMLDLLNK 291


>gi|319899503|ref|YP_004159600.1| succinyl-CoA synthetase, alpha chain [Bartonella clarridgeiae 73]
 gi|319403471|emb|CBI77051.1| succinyl-CoA synthetase, alpha chain [Bartonella clarridgeiae 73]
          Length = 300

 Score =  348 bits (892), Expect = 8e-94,   Method: Composition-based stats.
 Identities = 235/300 (78%), Positives = 268/300 (89%), Gaps = 1/300 (0%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTG-GNVNVPVF 59
           MSI V+KNTKVLVQGLTGK GTFHTEQA+ Y  TQ+VGGI+PKKG   W G     +P+F
Sbjct: 1   MSIFVNKNTKVLVQGLTGKTGTFHTEQALAYHGTQMVGGINPKKGGETWKGSKGETLPIF 60

Query: 60  TTVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEK 119
            +V E KE+T ANASVIYVPP GA DAIIE+I+AEI LIVCITEGIPV+DMV+VKA+LEK
Sbjct: 61  ASVVEGKEKTGANASVIYVPPVGAADAIIEAIDAEIGLIVCITEGIPVMDMVKVKAKLEK 120

Query: 120 SSSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQST 179
           S SRLIGPNCPG+LTPD CKIGIMPG+IF+KGSVG++SRSGTLTYEAVFQTS EGLGQ+T
Sbjct: 121 SKSRLIGPNCPGVLTPDECKIGIMPGAIFKKGSVGVVSRSGTLTYEAVFQTSHEGLGQTT 180

Query: 180 AVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPI 239
           AVGIGGDPVKGTEFIDVLE+FLAD  TESIVM+GEIGGSAEEEAAQFLKDEAK+GRKKP+
Sbjct: 181 AVGIGGDPVKGTEFIDVLEMFLADNETESIVMIGEIGGSAEEEAAQFLKDEAKKGRKKPM 240

Query: 240 VGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
           VGF+AG+TAPPGRTMGHAGAVISGGKGGAEDKI AM+ AGI ++PSP++IG++LV +L  
Sbjct: 241 VGFIAGRTAPPGRTMGHAGAVISGGKGGAEDKIAAMESAGIRVSPSPSQIGKTLVAVLND 300


>gi|152979224|ref|YP_001344853.1| succinyl-CoA synthetase, alpha subunit [Actinobacillus succinogenes
           130Z]
 gi|150840947|gb|ABR74918.1| succinyl-CoA synthetase, alpha subunit [Actinobacillus succinogenes
           130Z]
          Length = 289

 Score =  348 bits (892), Expect = 8e-94,   Method: Composition-based stats.
 Identities = 177/298 (59%), Positives = 223/298 (74%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL++KNTKV+ QG TG  GTFH+EQA+ Y  T++VGG  P KG T   G    +PVF 
Sbjct: 1   MSILINKNTKVICQGFTGGQGTFHSEQALAY-GTKLVGGTSPGKGGTTHLG----LPVFD 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA ++T A ASVIYVP     DAI+E+I+A I LIVCITEGIP LDM++VK +L+++
Sbjct: 56  TVREAVQKTGATASVIYVPAPFCKDAILEAIDAGIRLIVCITEGIPTLDMLQVKEKLDET 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
              +IGPNCPG++TP+ CKIGIMP +I +KG VGI+SRSGTLTYEAV QT+ EG GQST 
Sbjct: 116 GVVMIGPNCPGVITPEECKIGIMPANIHKKGCVGIVSRSGTLTYEAVKQTTDEGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FI++L+ F  D  TE+IVM+GEIGGSAEEEAA F+K        KP+V
Sbjct: 176 VGIGGDPIPGSSFIEILQRFEDDPETEAIVMIGEIGGSAEEEAADFIKHH----ITKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            ++AG TAP G+ MGHAGA+ISGGKG A +KI A++EAG+    S A IG +L  +LG
Sbjct: 232 SYIAGITAPKGKRMGHAGAIISGGKGTAAEKIKALQEAGVTTVQSLADIGSALRNILG 289


>gi|297584025|ref|YP_003699805.1| succinyl-CoA synthetase subunit alpha [Bacillus selenitireducens
           MLS10]
 gi|297142482|gb|ADH99239.1| succinyl-CoA synthetase, alpha subunit [Bacillus selenitireducens
           MLS10]
          Length = 303

 Score =  347 bits (891), Expect = 8e-94,   Method: Composition-based stats.
 Identities = 175/299 (58%), Positives = 232/299 (77%), Gaps = 9/299 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL++K+TKV+VQG+TG  G FHT+QAI Y  T +VGG+ P KG T   G    VPVF 
Sbjct: 1   MSILINKDTKVIVQGITGATGLFHTKQAIEY-GTNIVGGVTPGKGGTEIEG----VPVFD 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV++A + T A+ASVIYVPP  A DAI+E+ +A + +++ ITEGIPV DM++VK  +E  
Sbjct: 56  TVSDAVKETGAHASVIYVPPPFAADAIMEATDAGVDVVITITEGIPVTDMIKVKRYMEGK 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            +RLIGPNCPG++TP+ CKIGIMPG I +KG VG++SRSGTLTYEAV Q S EG+GQSTA
Sbjct: 116 KTRLIGPNCPGVITPEECKIGIMPGYIHKKGHVGVVSRSGTLTYEAVHQLSTEGIGQSTA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPV GT+FIDVL++F  D  TE+++M+GEIGG+AEEEAA+++K        KP+V
Sbjct: 176 VGIGGDPVNGTDFIDVLKMFNEDPDTEAVIMIGEIGGTAEEEAAEWIKANM----TKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
           GF+ G+TAPPG+ MGHAGA+ISGGKG A++KI  +  AG+ +A +PA +G +L+++L  
Sbjct: 232 GFIGGRTAPPGKRMGHAGAIISGGKGTADEKIKTLNAAGVQVADTPAVMGETLIKVLKE 290


>gi|170769129|ref|ZP_02903582.1| succinate-CoA ligase, alpha subunit [Escherichia albertii TW07627]
 gi|170122201|gb|EDS91132.1| succinate-CoA ligase, alpha subunit [Escherichia albertii TW07627]
          Length = 289

 Score =  347 bits (891), Expect = 8e-94,   Method: Composition-based stats.
 Identities = 174/298 (58%), Positives = 218/298 (73%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL+DKNTKV+ QG TG  GTFH+EQAI Y  T++VGG+ P KG T   G    +PVF 
Sbjct: 1   MSILIDKNTKVICQGFTGSQGTFHSEQAIAY-GTKMVGGVTPGKGGTTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA   T A ASVIYVP     D+I+E+I+A I LI+ ITEGIP LDM+ VK +L+++
Sbjct: 56  TVREAVAATGATASVIYVPAPFCKDSILEAIDAGIKLIITITEGIPTLDMLTVKVKLDEA 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TP  CKIGI PG I R G VGI+SRSGTLTYEAV QT+  G GQST 
Sbjct: 116 GVRMIGPNCPGVITPGECKIGIQPGHIHRPGKVGIVSRSGTLTYEAVKQTTDYGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+LE+F  D  TE+IVM+GEIGGSAEEEAA ++K+       KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILEMFEKDPQTEAIVMIGEIGGSAEEEAAAYIKEH----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           G++AG TAP G+ MGHAGA+I+GGKG A++K  A++ AG+    S A IG +L  +L 
Sbjct: 232 GYIAGVTAPKGKRMGHAGAIIAGGKGTADEKFAALEAAGVKTVRSLADIGEALKTVLK 289


>gi|306843376|ref|ZP_07475977.1| succinyl-CoA synthetase, alpha subunit [Brucella sp. BO1]
 gi|306276067|gb|EFM57767.1| succinyl-CoA synthetase, alpha subunit [Brucella sp. BO1]
          Length = 300

 Score =  347 bits (891), Expect = 9e-94,   Method: Composition-based stats.
 Identities = 236/299 (78%), Positives = 270/299 (90%), Gaps = 1/299 (0%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTG-GNVNVPVF 59
           MSILV+K+TKVLVQGLTGK GTFHTEQA+ Y  TQ+VGGIHPKKG   W G     +P+F
Sbjct: 1   MSILVNKDTKVLVQGLTGKTGTFHTEQALAYYGTQMVGGIHPKKGGETWEGSKGEKLPIF 60

Query: 60  TTVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEK 119
            TVAE KERT A+ASVIYVPP+GA DAIIE+IEAEI  IVCITEGIPV+DMVRVK RLE+
Sbjct: 61  ATVAEGKERTGADASVIYVPPAGAADAIIEAIEAEIRFIVCITEGIPVMDMVRVKERLER 120

Query: 120 SSSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQST 179
           S SRL+GPNCPGILTP+ CKIGIMPG+IF+KGSVG++SRSGTLTYEAVFQTS EGLGQ+T
Sbjct: 121 SKSRLLGPNCPGILTPEECKIGIMPGNIFKKGSVGVVSRSGTLTYEAVFQTSNEGLGQTT 180

Query: 180 AVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPI 239
           AVGIGGDPVKGTEFIDVLE+FLAD+ T+SIVM+GEIGGSAEE+AAQFLKDEAKRGRKKP+
Sbjct: 181 AVGIGGDPVKGTEFIDVLEMFLADDETKSIVMIGEIGGSAEEDAAQFLKDEAKRGRKKPM 240

Query: 240 VGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           VGF+AG+TAP GRTMGHAGAVISGGKGGAEDKI AM+ AGI ++PSPA++G++LVE+L 
Sbjct: 241 VGFIAGRTAPAGRTMGHAGAVISGGKGGAEDKIAAMESAGIRVSPSPAQLGKTLVEVLK 299


>gi|86147658|ref|ZP_01065967.1| succinyl-CoA synthetase alpha subunit [Vibrio sp. MED222]
 gi|85834569|gb|EAQ52718.1| succinyl-CoA synthetase alpha subunit [Vibrio sp. MED222]
          Length = 290

 Score =  347 bits (891), Expect = 9e-94,   Method: Composition-based stats.
 Identities = 179/298 (60%), Positives = 223/298 (74%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+TKV+ QG TG  GTFH++QAI Y  TQ+VGG+ P KG     G    +PVF 
Sbjct: 1   MSVLINKDTKVICQGFTGGQGTFHSDQAIAY-GTQMVGGVSPGKGGQTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T A A+VIYVP     DAI+E+I+A I LIV ITEGIP +DM+ VK +LE++
Sbjct: 56  TVREAVEATGATATVIYVPAPFCKDAILEAIDAGIELIVTITEGIPTIDMIDVKVKLEET 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TPD CKIGIMPG I +KG VGI+SRSGTLTYEAV QT+ EG GQST 
Sbjct: 116 GVRMIGPNCPGLITPDECKIGIMPGHIHKKGKVGIVSRSGTLTYEAVKQTTDEGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L+LF  D  TE+IVM+GEIGG+AEEEAA+F+K        KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILKLFQEDPETEAIVMIGEIGGTAEEEAAEFIKAN----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            ++AG TAPPG+ MGHAGA+ISGGKG AEDK  A++ AG+    S A IG+ L E+ G
Sbjct: 232 SYIAGVTAPPGKRMGHAGAIISGGKGTAEDKFAALEAAGVKTVKSLADIGKGLREITG 289


>gi|153008267|ref|YP_001369482.1| succinyl-CoA synthetase subunit alpha [Ochrobactrum anthropi ATCC
           49188]
 gi|151560155|gb|ABS13653.1| succinyl-CoA synthetase, alpha subunit [Ochrobactrum anthropi ATCC
           49188]
          Length = 300

 Score =  347 bits (891), Expect = 9e-94,   Method: Composition-based stats.
 Identities = 238/299 (79%), Positives = 272/299 (90%), Gaps = 1/299 (0%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTG-GNVNVPVF 59
           MSILV+K+TKVLVQGLTGK GTFHTEQA+ Y  TQ+VGGIHPKKG   W G     +P+F
Sbjct: 1   MSILVNKDTKVLVQGLTGKTGTFHTEQALAYYGTQMVGGIHPKKGGETWEGQKGEKLPIF 60

Query: 60  TTVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEK 119
            TVAEAKERT A+ASVIYVPP+GA DAIIE+IEAEIP IVCITEGIPV+DMVRVK RLE+
Sbjct: 61  ATVAEAKERTGADASVIYVPPAGAADAIIEAIEAEIPFIVCITEGIPVMDMVRVKERLER 120

Query: 120 SSSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQST 179
           S SRL+GPNCPGILTP+ CKIGIMPG+IF+KGSVG++SRSGTLTYEAVFQTS EGLGQ+T
Sbjct: 121 SKSRLLGPNCPGILTPEECKIGIMPGNIFKKGSVGVVSRSGTLTYEAVFQTSNEGLGQTT 180

Query: 180 AVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPI 239
           AVGIGGDPVKGTEFIDVLE+FLAD+ T+SIVM+GEIGGSAEE+AAQFLKDEAKRGRKKP+
Sbjct: 181 AVGIGGDPVKGTEFIDVLEMFLADDETKSIVMIGEIGGSAEEDAAQFLKDEAKRGRKKPM 240

Query: 240 VGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           VGF+AG+TAP GRTMGHAGAVISGGKGGAEDKI AM+ AGI ++PSPA++G++LVE+L 
Sbjct: 241 VGFIAGRTAPAGRTMGHAGAVISGGKGGAEDKIAAMESAGIRVSPSPAQLGKTLVEVLK 299


>gi|94498998|ref|ZP_01305536.1| Succinyl-CoA synthetase, alpha subunit [Oceanobacter sp. RED65]
 gi|94428630|gb|EAT13602.1| Succinyl-CoA synthetase, alpha subunit [Oceanobacter sp. RED65]
          Length = 290

 Score =  347 bits (891), Expect = 9e-94,   Method: Composition-based stats.
 Identities = 171/298 (57%), Positives = 215/298 (72%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL++KNTKV+ QG TG  GTFH+EQAI Y  T +VGG+ P KG T   G    +PVF 
Sbjct: 1   MSILLEKNTKVICQGFTGSQGTFHSEQAIEY-GTNMVGGVTPGKGGTTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E+T A ASVIYVP     D+I+E+  A I LIVCITEGIP LDM+  K + ++ 
Sbjct: 56  TVKEAVEQTGAEASVIYVPAPFCKDSILEAANAGIQLIVCITEGIPTLDMMYCKVKCDEL 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
              LIGPNCPG++TP   KIGIMPG I + G VGI+SRSGTLTYEAV QT+  G GQST 
Sbjct: 116 GVVLIGPNCPGVITPGQSKIGIMPGHIHKPGKVGIVSRSGTLTYEAVKQTTDFGYGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L+ F  D  TE+IVM+GEIGG+AEEEAA+++K+       KP+V
Sbjct: 176 VGIGGDPIPGSSFIDILKRFEEDPQTEAIVMIGEIGGTAEEEAAEYIKEN----VSKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            ++AG TAPPG+ MGHAGA+I+GGKG A++K  A++ AG+    S A IG++L E  G
Sbjct: 232 SYIAGVTAPPGKRMGHAGAIIAGGKGTADEKFAALEAAGVQTVKSLADIGKALKEKTG 289


>gi|89068135|ref|ZP_01155552.1| succinyl-CoA synthase, alpha subunit [Oceanicola granulosus
           HTCC2516]
 gi|89046374|gb|EAR52431.1| succinyl-CoA synthase, alpha subunit [Oceanicola granulosus
           HTCC2516]
          Length = 293

 Score =  347 bits (891), Expect = 9e-94,   Method: Composition-based stats.
 Identities = 202/298 (67%), Positives = 249/298 (83%), Gaps = 5/298 (1%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           M++L+D+ TKV+ QGLTG  GTFH+EQAI Y  T++VGG+ P KG        +++PVF 
Sbjct: 1   MAVLIDETTKVICQGLTGSQGTFHSEQAIAY-GTKMVGGVTPGKGGQTH----LDLPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           +V EA+  T ANASVIYVPP  A D+I+E+I+A++ LIVCITEGIPVLDM+RVK  LE S
Sbjct: 56  SVHEARAATEANASVIYVPPPFAADSILEAIDAQMELIVCITEGIPVLDMMRVKRALEGS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
           +S LIGPNCPG++TPD+CKIGIMPG I ++G+VG++SRSGTLTYEAV QT+  GLGQST 
Sbjct: 116 ASVLIGPNCPGVITPDACKIGIMPGHIHKRGTVGVVSRSGTLTYEAVKQTTDVGLGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+KGTE IDVLE FLAD+ TESI+M+GEIGGSAEEEAAQFLKDEAKRGR KP+ 
Sbjct: 176 VGIGGDPIKGTEHIDVLEWFLADDETESIIMIGEIGGSAEEEAAQFLKDEAKRGRTKPVA 235

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           GF+AG+TAPPGR MGHAGA+++GGKGGAEDKI AMK AGI +A SPA +G +++E +G
Sbjct: 236 GFIAGRTAPPGRRMGHAGAIVAGGKGGAEDKIEAMKSAGIVVADSPATLGEAVLEAIG 293


>gi|241206655|ref|YP_002977751.1| succinyl-CoA synthetase subunit alpha [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240860545|gb|ACS58212.1| succinyl-CoA synthetase, alpha subunit [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 300

 Score =  347 bits (891), Expect = 9e-94,   Method: Composition-based stats.
 Identities = 235/299 (78%), Positives = 271/299 (90%), Gaps = 1/299 (0%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTG-GNVNVPVF 59
           MSILV+K+TKVLVQGLTGK GTFHTEQA+ Y  TQ+VGGIHPKKG   WTG    ++P+F
Sbjct: 1   MSILVNKDTKVLVQGLTGKTGTFHTEQALAYYGTQMVGGIHPKKGGETWTGAKGESLPIF 60

Query: 60  TTVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEK 119
            TVAE KE+T ANASVIYVPP+GA DAIIE+I+AEIP I CITEGIPV+DMVRVKARL++
Sbjct: 61  ATVAEGKEKTGANASVIYVPPAGAADAIIEAIDAEIPFITCITEGIPVMDMVRVKARLDR 120

Query: 120 SSSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQST 179
           S SRL+GPNCPGILTP+ CKIGIMPGSIFRKGSVGI+SRSGTLTYEAVFQTS EGLGQ+T
Sbjct: 121 SKSRLLGPNCPGILTPEECKIGIMPGSIFRKGSVGIVSRSGTLTYEAVFQTSNEGLGQTT 180

Query: 180 AVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPI 239
           AVGIGGDPVKGTEFIDVLE+FLADEAT+SI+M+GEIGG+AEE+AAQFLKDEAK+GRKKP+
Sbjct: 181 AVGIGGDPVKGTEFIDVLEMFLADEATQSIIMIGEIGGAAEEDAAQFLKDEAKKGRKKPM 240

Query: 240 VGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            GF+AG+TAP GRTMGHAGAV+SGGKG AE KI AM+ AGI ++PSPAR+G++LVE+L 
Sbjct: 241 AGFIAGRTAPKGRTMGHAGAVVSGGKGDAESKIAAMESAGIKVSPSPARLGKTLVEVLK 299


>gi|27363637|ref|NP_759165.1| succinyl-CoA synthetase subunit alpha [Vibrio vulnificus CMCP6]
 gi|27359753|gb|AAO08692.1| Succinyl-CoA ligase [ADP-forming] alpha chain [Vibrio vulnificus
           CMCP6]
          Length = 290

 Score =  347 bits (891), Expect = 9e-94,   Method: Composition-based stats.
 Identities = 177/298 (59%), Positives = 223/298 (74%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+TKV+ QG TG  GTFH+EQA+ Y  TQ+VGG+ P KG     G    +PVF 
Sbjct: 1   MSVLINKDTKVICQGFTGGQGTFHSEQALAY-GTQMVGGVSPGKGGQTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T A A+VIYVP     DAI+E+I+A I LIV ITEGIP  DM+ VK +LE++
Sbjct: 56  TVREAVEATGATATVIYVPAPFCKDAILEAIDAGIELIVTITEGIPTTDMIDVKVKLEQT 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TPD CKIGIMPG I +KG VGI+SRSGTLTYEAV QT+ EG GQST 
Sbjct: 116 GVRMIGPNCPGVITPDECKIGIMPGHIHKKGKVGIVSRSGTLTYEAVKQTTDEGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L+LF  D  TE+IVM+GEIGG+AEEEAA F+K+       KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILKLFQEDPETEAIVMIGEIGGTAEEEAAAFIKEN----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            ++AG TAPPG+ MGHAGA+ISGGKG A++K  A++ AG+    S A IG++L E+ G
Sbjct: 232 SYIAGVTAPPGKRMGHAGAIISGGKGTADEKFAALESAGVKTVKSLAEIGQALREVTG 289


>gi|159045422|ref|YP_001534216.1| succinyl-CoA ligase [ADP-forming] subunit alpha [Dinoroseobacter
           shibae DFL 12]
 gi|157913182|gb|ABV94615.1| succinyl-CoA ligase [ADP-forming] subunit alpha [Dinoroseobacter
           shibae DFL 12]
          Length = 293

 Score =  347 bits (891), Expect = 9e-94,   Method: Composition-based stats.
 Identities = 199/298 (66%), Positives = 247/298 (82%), Gaps = 5/298 (1%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           M++L+D+NTKV+ QG TG  GTFH+EQAI Y  T++VGG+ P KG        +N+PVF 
Sbjct: 1   MAVLIDENTKVICQGFTGSQGTFHSEQAIAY-GTKMVGGVTPGKGGQTH----LNLPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           +V EAK  T ANA+VIYVPP  A D+I+E+I+AE+ +IVCITEGIPVLDM++VK  LE S
Sbjct: 56  SVHEAKAVTEANATVIYVPPPFAADSILEAIDAEMEVIVCITEGIPVLDMMKVKRALEGS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
           +SRLIGPNCPG++TPD+CKIGIMPG I ++G+VG++SRSGTLTYEAV QT+  GLGQST 
Sbjct: 116 ASRLIGPNCPGVITPDACKIGIMPGHIHKRGTVGVVSRSGTLTYEAVKQTTDVGLGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+KGTE IDVLE FLAD+ TESI+M+GEIGGSAEEEAAQFL DE KRGR KP  
Sbjct: 176 VGIGGDPIKGTEHIDVLEWFLADDETESIIMIGEIGGSAEEEAAQFLADEKKRGRWKPTA 235

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           GF+AG+TAPPGR MGHAGA+++GGKGGAEDKI AM+ AGI +A SPA +G ++++ +G
Sbjct: 236 GFIAGRTAPPGRRMGHAGAIVAGGKGGAEDKIEAMQSAGIVVAESPAGLGEAVLKAIG 293


>gi|66045253|ref|YP_235094.1| succinyl-CoA synthetase subunit alpha [Pseudomonas syringae pv.
           syringae B728a]
 gi|289679952|ref|ZP_06500842.1| succinyl-CoA synthetase subunit alpha [Pseudomonas syringae pv.
           syringae FF5]
 gi|63255960|gb|AAY37056.1| Succinyl-CoA ligase, alpha subunit [Pseudomonas syringae pv.
           syringae B728a]
 gi|330899191|gb|EGH30610.1| succinyl-CoA synthetase subunit alpha [Pseudomonas syringae pv.
           japonica str. M301072PT]
 gi|330940362|gb|EGH43467.1| succinyl-CoA synthetase subunit alpha [Pseudomonas syringae pv.
           pisi str. 1704B]
 gi|330951687|gb|EGH51947.1| succinyl-CoA synthetase subunit alpha [Pseudomonas syringae Cit 7]
          Length = 293

 Score =  347 bits (891), Expect = 9e-94,   Method: Composition-based stats.
 Identities = 171/298 (57%), Positives = 216/298 (72%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+TKV+ QG TG  GTFH+EQAI Y  T++VGG+ P KG T      +N+PVF 
Sbjct: 1   MSVLINKDTKVICQGFTGSQGTFHSEQAIAY-GTKMVGGVTPGKGGTTH----LNLPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA + T A ASVIYVP     D+I+E+    I LIVCITEGIP +DM+  K + ++ 
Sbjct: 56  TVKEAVDTTGATASVIYVPAPFCKDSILEAAFGGIKLIVCITEGIPTIDMLEAKVKCDEL 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
              LIGPNCPG++TP  CKIGIMPG I   G VGI+SRSGTLTYEAV QT+  G GQST 
Sbjct: 116 GVVLIGPNCPGVITPGECKIGIMPGHIHLPGKVGIVSRSGTLTYEAVKQTTDAGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L+LF  D  TE+IVM+GEIGGSAEEEAA ++K        KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILKLFQEDPKTEAIVMIGEIGGSAEEEAAAYIKAH----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            ++AG TAPPG+ MGHAGA+ISGGKG A++K  A+++AG+    S A IG++L EL G
Sbjct: 232 SYIAGVTAPPGKRMGHAGAIISGGKGTADEKFAALQDAGVKTVRSLADIGKALAELTG 289


>gi|239993690|ref|ZP_04714214.1| Succinyl-CoA synthetase, alpha subunit [Alteromonas macleodii ATCC
           27126]
 gi|332141300|ref|YP_004427038.1| Succinyl-CoA synthetase, alpha subunit [Alteromonas macleodii str.
           'Deep ecotype']
 gi|327551322|gb|AEA98040.1| Succinyl-CoA synthetase, alpha subunit [Alteromonas macleodii str.
           'Deep ecotype']
          Length = 290

 Score =  347 bits (891), Expect = 9e-94,   Method: Composition-based stats.
 Identities = 173/295 (58%), Positives = 218/295 (73%), Gaps = 9/295 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+TKV+ QG TG  GTFH+EQAI Y  TQ+VGG+ P KG T   G    +PVF 
Sbjct: 1   MSVLINKDTKVICQGFTGGQGTFHSEQAIAY-GTQMVGGVTPGKGGTEHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T A A+VIYVP     D+I+E+ +A I LIVCITEGIP LDM+ VK  +E  
Sbjct: 56  TVREAVEATGATATVIYVPAPFCKDSIVEAADAGIELIVCITEGIPTLDMLYVKEYVEAK 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TP  CKIGIMPG I + G VGI+SRSGTLTYEAV QT+ EG GQST 
Sbjct: 116 GVRMIGPNCPGVITPGECKIGIMPGHIHKPGKVGIVSRSGTLTYEAVKQTTDEGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L++F  D  TE+IVM+GEIGG+AEEEAA F+K        KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILQMFQDDPQTEAIVMIGEIGGTAEEEAAAFIKAN----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVE 295
            ++AG TAPPG+ MGHAGA+I+GGKG A++K  A+++AG+    S A IG++L E
Sbjct: 232 SYIAGVTAPPGKRMGHAGAIIAGGKGTADEKFKALEDAGVKTVRSLAEIGKALRE 286


>gi|24111995|ref|NP_706505.1| succinyl-CoA synthetase subunit alpha [Shigella flexneri 2a str.
           301]
 gi|30062108|ref|NP_836279.1| succinyl-CoA synthetase subunit alpha [Shigella flexneri 2a str.
           2457T]
 gi|110804644|ref|YP_688164.1| succinyl-CoA synthetase subunit alpha [Shigella flexneri 5 str.
           8401]
 gi|24050809|gb|AAN42212.1| succinyl-CoA synthetase, alpha subunit [Shigella flexneri 2a str.
           301]
 gi|30040353|gb|AAP16085.1| succinyl-CoA synthetase, alpha subunit [Shigella flexneri 2a str.
           2457T]
 gi|110614192|gb|ABF02859.1| succinyl-CoA synthetase, alpha subunit [Shigella flexneri 5 str.
           8401]
 gi|281599956|gb|ADA72940.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Shigella flexneri
           2002017]
 gi|313649630|gb|EFS14054.1| succinyl-CoA ligase [ADP-forming] subunit alpha [Shigella flexneri
           2a str. 2457T]
 gi|332760906|gb|EGJ91194.1| succinyl-CoA ligase [ADP-forming] subunit alpha [Shigella flexneri
           4343-70]
 gi|332761313|gb|EGJ91599.1| succinyl-CoA ligase [ADP-forming] subunit alpha [Shigella flexneri
           2747-71]
 gi|332763953|gb|EGJ94191.1| succinyl-CoA ligase [ADP-forming] subunit alpha [Shigella flexneri
           K-671]
 gi|332768174|gb|EGJ98359.1| succinyl-CoA synthetase, alpha subunit [Shigella flexneri 2930-71]
 gi|333007362|gb|EGK26842.1| succinyl-CoA ligase [ADP-forming] subunit alpha [Shigella flexneri
           VA-6]
 gi|333008045|gb|EGK27521.1| succinyl-CoA ligase [ADP-forming] subunit alpha [Shigella flexneri
           K-218]
 gi|333010155|gb|EGK29590.1| succinyl-CoA ligase [ADP-forming] subunit alpha [Shigella flexneri
           K-272]
 gi|333021110|gb|EGK40367.1| succinyl-CoA ligase [ADP-forming] subunit alpha [Shigella flexneri
           K-227]
 gi|333021490|gb|EGK40740.1| succinyl-CoA ligase [ADP-forming] subunit alpha [Shigella flexneri
           K-304]
          Length = 289

 Score =  347 bits (891), Expect = 1e-93,   Method: Composition-based stats.
 Identities = 173/298 (58%), Positives = 219/298 (73%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL+DKNTKV+ QG TG  GTFH+EQAI Y  T++VGG+ P KG T   G    +PVF 
Sbjct: 1   MSILIDKNTKVICQGFTGSQGTFHSEQAIAY-GTKMVGGVTPGKGGTTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA   T A+ASVIYVP     D+I+E+I+A I LI+ ITEGIP LDM+ VK +L+++
Sbjct: 56  TVREAVAATGASASVIYVPAPFCKDSILEAIDAGIKLIITITEGIPTLDMLTVKVKLDEA 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TP  CKIGI PG I + G VGI+SRSGTLTYEAV QT+  G GQST 
Sbjct: 116 GVRMIGPNCPGVITPGECKIGIQPGHIHKPGKVGIVSRSGTLTYEAVKQTTDYGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+LE+F  D  TE+IVM+GEIGGSAEEEAA ++K+       KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILEMFEKDPQTEAIVMIGEIGGSAEEEAAAYIKEH----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           G++AG TAP G+ MGHAGA+I+GGKG A++K  A++ AG+    S A IG +L  +L 
Sbjct: 232 GYIAGVTAPKGKRMGHAGAIIAGGKGTADEKFAALEAAGVKTVRSLADIGEALKTVLK 289


>gi|15800433|ref|NP_286445.1| succinyl-CoA synthetase subunit alpha [Escherichia coli O157:H7
           EDL933]
 gi|15830008|ref|NP_308781.1| succinyl-CoA synthetase subunit alpha [Escherichia coli O157:H7
           str. Sakai]
 gi|16128704|ref|NP_415257.1| succinyl-CoA synthetase, NAD(P)-binding, alpha subunit [Escherichia
           coli str. K-12 substr. MG1655]
 gi|26246696|ref|NP_752736.1| succinyl-CoA synthetase subunit alpha [Escherichia coli CFT073]
 gi|74311253|ref|YP_309672.1| succinyl-CoA synthetase subunit alpha [Shigella sonnei Ss046]
 gi|82543156|ref|YP_407103.1| succinyl-CoA synthetase subunit alpha [Shigella boydii Sb227]
 gi|89107586|ref|AP_001366.1| succinyl-CoA synthetase, NAD(P)-binding, alpha subunit [Escherichia
           coli str. K-12 substr. W3110]
 gi|91209762|ref|YP_539748.1| succinyl-CoA synthetase subunit alpha [Escherichia coli UTI89]
 gi|110640937|ref|YP_668665.1| succinyl-CoA synthetase subunit alpha [Escherichia coli 536]
 gi|117622922|ref|YP_851835.1| succinyl-CoA synthetase subunit alpha [Escherichia coli APEC O1]
 gi|157158239|ref|YP_001461888.1| succinyl-CoA synthetase subunit alpha [Escherichia coli E24377A]
 gi|157160208|ref|YP_001457526.1| succinyl-CoA synthetase subunit alpha [Escherichia coli HS]
 gi|168750660|ref|ZP_02775682.1| succinate-CoA ligase, alpha subunit [Escherichia coli O157:H7 str.
           EC4113]
 gi|168757182|ref|ZP_02782189.1| succinate-CoA ligase, alpha subunit [Escherichia coli O157:H7 str.
           EC4401]
 gi|168764010|ref|ZP_02789017.1| succinate-CoA ligase, alpha subunit [Escherichia coli O157:H7 str.
           EC4501]
 gi|168767169|ref|ZP_02792176.1| succinate-CoA ligase, alpha subunit [Escherichia coli O157:H7 str.
           EC4486]
 gi|168777545|ref|ZP_02802552.1| succinate-CoA ligase, alpha subunit [Escherichia coli O157:H7 str.
           EC4196]
 gi|168779212|ref|ZP_02804219.1| succinate-CoA ligase, alpha subunit [Escherichia coli O157:H7 str.
           EC4076]
 gi|168786882|ref|ZP_02811889.1| succinate-CoA ligase, alpha subunit [Escherichia coli O157:H7 str.
           EC869]
 gi|168801362|ref|ZP_02826369.1| succinate-CoA ligase, alpha subunit [Escherichia coli O157:H7 str.
           EC508]
 gi|170020927|ref|YP_001725881.1| succinyl-CoA synthetase subunit alpha [Escherichia coli ATCC 8739]
 gi|170080395|ref|YP_001729715.1| succinyl-CoA synthetase, NAD(P)-binding, alpha subunit [Escherichia
           coli str. K-12 substr. DH10B]
 gi|170682614|ref|YP_001742829.1| succinyl-CoA synthetase subunit alpha [Escherichia coli SMS-3-5]
 gi|187731649|ref|YP_001879384.1| succinyl-CoA synthetase subunit alpha [Shigella boydii CDC 3083-94]
 gi|188494364|ref|ZP_03001634.1| succinyl-CoA synthetase alpha chain [Escherichia coli 53638]
 gi|191167206|ref|ZP_03029025.1| succinate-CoA ligase, alpha subunit [Escherichia coli B7A]
 gi|191174037|ref|ZP_03035553.1| succinate-CoA ligase, alpha subunit [Escherichia coli F11]
 gi|193065546|ref|ZP_03046614.1| succinate-CoA ligase, alpha subunit [Escherichia coli E22]
 gi|193070667|ref|ZP_03051604.1| succinate-CoA ligase, alpha subunit [Escherichia coli E110019]
 gi|194429074|ref|ZP_03061605.1| succinate-CoA ligase, alpha subunit [Escherichia coli B171]
 gi|194433979|ref|ZP_03066250.1| succinate-CoA ligase, alpha subunit [Shigella dysenteriae 1012]
 gi|194439235|ref|ZP_03071315.1| succinate-CoA ligase, alpha subunit [Escherichia coli 101-1]
 gi|195939070|ref|ZP_03084452.1| succinyl-CoA synthetase subunit alpha [Escherichia coli O157:H7
           str. EC4024]
 gi|208807584|ref|ZP_03249921.1| succinate-CoA ligase, alpha subunit [Escherichia coli O157:H7 str.
           EC4206]
 gi|208816368|ref|ZP_03257547.1| succinate-CoA ligase, alpha subunit [Escherichia coli O157:H7 str.
           EC4045]
 gi|208823169|ref|ZP_03263487.1| succinate-CoA ligase, alpha subunit [Escherichia coli O157:H7 str.
           EC4042]
 gi|209395766|ref|YP_002269352.1| succinate-CoA ligase, alpha subunit [Escherichia coli O157:H7 str.
           EC4115]
 gi|209917979|ref|YP_002292063.1| succinyl-CoA synthetase subunit alpha [Escherichia coli SE11]
 gi|217324254|ref|ZP_03440338.1| succinate-CoA ligase, alpha subunit [Escherichia coli O157:H7 str.
           TW14588]
 gi|218549707|ref|YP_002383498.1| succinyl-CoA synthetase subunit alpha [Escherichia fergusonii ATCC
           35469]
 gi|218553255|ref|YP_002386168.1| succinyl-CoA synthetase subunit alpha [Escherichia coli IAI1]
 gi|218557644|ref|YP_002390557.1| succinyl-CoA synthetase subunit alpha [Escherichia coli S88]
 gi|218688522|ref|YP_002396734.1| succinyl-CoA synthetase subunit alpha [Escherichia coli ED1a]
 gi|218694152|ref|YP_002401819.1| succinyl-CoA synthetase subunit alpha [Escherichia coli 55989]
 gi|218699083|ref|YP_002406712.1| succinyl-CoA synthetase subunit alpha [Escherichia coli IAI39]
 gi|218704045|ref|YP_002411564.1| succinyl-CoA synthetase subunit alpha [Escherichia coli UMN026]
 gi|227884305|ref|ZP_04002110.1| succinyl-CoA synthetase subunit alpha [Escherichia coli 83972]
 gi|237707309|ref|ZP_04537790.1| succinyl-CoA synthetase subunit alpha [Escherichia sp. 3_2_53FAA]
 gi|238899993|ref|YP_002925789.1| succinyl-CoA synthetase, NAD(P)-binding, alpha subunit [Escherichia
           coli BW2952]
 gi|253774301|ref|YP_003037132.1| succinyl-CoA synthetase subunit alpha [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|254160798|ref|YP_003043906.1| succinyl-CoA synthetase subunit alpha [Escherichia coli B str.
           REL606]
 gi|254791875|ref|YP_003076712.1| succinyl-CoA synthetase subunit alpha [Escherichia coli O157:H7
           str. TW14359]
 gi|256021198|ref|ZP_05435063.1| succinyl-CoA synthetase subunit alpha [Shigella sp. D9]
 gi|256023670|ref|ZP_05437535.1| succinyl-CoA synthetase subunit alpha [Escherichia sp. 4_1_40B]
 gi|260842935|ref|YP_003220713.1| succinyl-CoA synthetase, NAD(P)-binding, alpha subunit [Escherichia
           coli O103:H2 str. 12009]
 gi|260853963|ref|YP_003227854.1| succinyl-CoA synthetase, NAD(P)-binding, alpha subunit [Escherichia
           coli O26:H11 str. 11368]
 gi|260866859|ref|YP_003233261.1| succinyl-CoA synthetase, NAD(P)-binding, alpha subunit [Escherichia
           coli O111:H- str. 11128]
 gi|261224429|ref|ZP_05938710.1| succinyl-CoA synthetase, NAD(P)-binding, alpha subunit [Escherichia
           coli O157:H7 str. FRIK2000]
 gi|261254580|ref|ZP_05947113.1| succinyl-CoA synthetase, NAD(P)-binding, alpha subunit [Escherichia
           coli O157:H7 str. FRIK966]
 gi|291281661|ref|YP_003498479.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Escherichia coli
           O55:H7 str. CB9615]
 gi|293403972|ref|ZP_06647966.1| succinyl-CoA synthetase alpha subunit [Escherichia coli FVEC1412]
 gi|293409102|ref|ZP_06652678.1| succinyl-CoA ligase subunit alpha [Escherichia coli B354]
 gi|293414006|ref|ZP_06656655.1| succinyl-CoA ligase subunit alpha [Escherichia coli B185]
 gi|293432997|ref|ZP_06661425.1| succinyl-CoA ligase subunit alpha [Escherichia coli B088]
 gi|298379748|ref|ZP_06989353.1| succinyl-CoA ligase subunit alpha [Escherichia coli FVEC1302]
 gi|300816376|ref|ZP_07096598.1| succinyl-CoA synthetase subunit alpha [Escherichia coli MS 107-1]
 gi|300822984|ref|ZP_07103119.1| succinyl-CoA synthetase subunit alpha [Escherichia coli MS 119-7]
 gi|300900723|ref|ZP_07118872.1| succinyl-CoA synthetase subunit alpha [Escherichia coli MS 198-1]
 gi|300906986|ref|ZP_07124655.1| succinyl-CoA synthetase subunit alpha [Escherichia coli MS 84-1]
 gi|300918388|ref|ZP_07134988.1| succinyl-CoA synthetase subunit alpha [Escherichia coli MS 115-1]
 gi|300929467|ref|ZP_07144935.1| succinyl-CoA synthetase subunit alpha [Escherichia coli MS 187-1]
 gi|300937815|ref|ZP_07152611.1| succinyl-CoA synthetase subunit alpha [Escherichia coli MS 21-1]
 gi|300957676|ref|ZP_07169865.1| succinyl-CoA synthetase subunit alpha [Escherichia coli MS 175-1]
 gi|300972377|ref|ZP_07171914.1| succinyl-CoA synthetase subunit alpha [Escherichia coli MS 200-1]
 gi|300993154|ref|ZP_07180237.1| succinyl-CoA synthetase subunit alpha [Escherichia coli MS 45-1]
 gi|301020811|ref|ZP_07184875.1| succinyl-CoA synthetase subunit alpha [Escherichia coli MS 69-1]
 gi|301027091|ref|ZP_07190463.1| succinyl-CoA synthetase subunit alpha [Escherichia coli MS 196-1]
 gi|301051352|ref|ZP_07198175.1| succinyl-CoA synthetase subunit alpha [Escherichia coli MS 185-1]
 gi|301305215|ref|ZP_07211313.1| succinyl-CoA synthetase subunit alpha [Escherichia coli MS 124-1]
 gi|301327920|ref|ZP_07221091.1| succinyl-CoA synthetase subunit alpha [Escherichia coli MS 78-1]
 gi|301648032|ref|ZP_07247799.1| succinyl-CoA synthetase subunit alpha [Escherichia coli MS 146-1]
 gi|306812863|ref|ZP_07447056.1| succinyl-CoA synthetase subunit alpha [Escherichia coli NC101]
 gi|307137340|ref|ZP_07496696.1| succinyl-CoA synthetase subunit alpha [Escherichia coli H736]
 gi|307314807|ref|ZP_07594401.1| succinyl-CoA synthetase, alpha subunit [Escherichia coli W]
 gi|309797441|ref|ZP_07691833.1| succinyl-CoA synthetase subunit alpha [Escherichia coli MS 145-7]
 gi|312970806|ref|ZP_07784985.1| succinyl-CoA ligase [ADP-forming] subunit alpha [Escherichia coli
           1827-70]
 gi|331641229|ref|ZP_08342364.1| succinyl-CoA synthetase subunit alpha [Escherichia coli H736]
 gi|331645877|ref|ZP_08346980.1| succinyl-CoA synthetase subunit alpha [Escherichia coli M605]
 gi|331651726|ref|ZP_08352745.1| succinyl-CoA synthetase subunit alpha [Escherichia coli M718]
 gi|331662081|ref|ZP_08363004.1| succinyl-CoA synthetase subunit alpha [Escherichia coli TA143]
 gi|331667095|ref|ZP_08367960.1| succinyl-CoA synthetase subunit alpha [Escherichia coli TA271]
 gi|331672243|ref|ZP_08373034.1| succinyl-CoA synthetase subunit alpha [Escherichia coli TA280]
 gi|331676410|ref|ZP_08377107.1| succinyl-CoA synthetase subunit alpha [Escherichia coli H591]
 gi|331682159|ref|ZP_08382781.1| succinyl-CoA synthetase subunit alpha [Escherichia coli H299]
 gi|332282424|ref|ZP_08394837.1| succinyl-CoA synthetase subunit alpha [Shigella sp. D9]
 gi|84027800|sp|P0AGF1|SUCD_ECO57 RecName: Full=Succinyl-CoA ligase [ADP-forming] subunit alpha;
           AltName: Full=Succinyl-CoA synthetase subunit alpha;
           Short=SCS-alpha
 gi|84027801|sp|P0AGF0|SUCD_ECOL6 RecName: Full=Succinyl-CoA ligase [ADP-forming] subunit alpha;
           AltName: Full=Succinyl-CoA synthetase subunit alpha;
           Short=SCS-alpha
 gi|84027802|sp|P0AGE9|SUCD_ECOLI RecName: Full=Succinyl-CoA ligase [ADP-forming] subunit alpha;
           AltName: Full=Succinyl-CoA synthetase subunit alpha;
           Short=SCS-alpha
 gi|12513647|gb|AAG55053.1|AE005251_2 succinyl-CoA synthetase, alpha subunit [Escherichia coli O157:H7
           str. EDL933]
 gi|26107095|gb|AAN79279.1|AE016757_183 Succinyl-CoA synthetase alpha chain [Escherichia coli CFT073]
 gi|146204|gb|AAA23900.1| succinyl-CoA synthetase alpha-subunit [Escherichia coli K-12]
 gi|1651324|dbj|BAA35395.1| succinyl-CoA synthetase, NAD(P)-binding, alpha subunit [Escherichia
           coli str. K12 substr. W3110]
 gi|1786949|gb|AAC73823.1| succinyl-CoA synthetase, NAD(P)-binding, alpha subunit [Escherichia
           coli str. K-12 substr. MG1655]
 gi|13360213|dbj|BAB34177.1| succinyl-CoA synthetase alpha subunit [Escherichia coli O157:H7
           str. Sakai]
 gi|73854730|gb|AAZ87437.1| succinyl-CoA synthetase, alpha subunit [Shigella sonnei Ss046]
 gi|81244567|gb|ABB65275.1| succinyl-CoA synthetase, alpha subunit [Shigella boydii Sb227]
 gi|91071336|gb|ABE06217.1| succinyl-CoA synthetase, alpha subunit [Escherichia coli UTI89]
 gi|110342529|gb|ABG68766.1| succinyl-CoA synthetase alpha chain [Escherichia coli 536]
 gi|115512046|gb|ABJ00121.1| succinyl-CoA synthetase alpha subunit [Escherichia coli APEC O1]
 gi|157065888|gb|ABV05143.1| succinate-CoA ligase, alpha subunit [Escherichia coli HS]
 gi|157080269|gb|ABV19977.1| succinate-CoA ligase, alpha subunit [Escherichia coli E24377A]
 gi|169755855|gb|ACA78554.1| succinyl-CoA synthetase, alpha subunit [Escherichia coli ATCC 8739]
 gi|169888230|gb|ACB01937.1| succinyl-CoA synthetase, NAD(P)-binding, alpha subunit [Escherichia
           coli str. K-12 substr. DH10B]
 gi|170520332|gb|ACB18510.1| succinate-CoA ligase, alpha subunit [Escherichia coli SMS-3-5]
 gi|187428641|gb|ACD07915.1| succinate-CoA ligase, alpha subunit [Shigella boydii CDC 3083-94]
 gi|187767223|gb|EDU31067.1| succinate-CoA ligase, alpha subunit [Escherichia coli O157:H7 str.
           EC4196]
 gi|188015186|gb|EDU53308.1| succinate-CoA ligase, alpha subunit [Escherichia coli O157:H7 str.
           EC4113]
 gi|188489563|gb|EDU64666.1| succinyl-CoA synthetase alpha chain [Escherichia coli 53638]
 gi|189002716|gb|EDU71702.1| succinate-CoA ligase, alpha subunit [Escherichia coli O157:H7 str.
           EC4076]
 gi|189355809|gb|EDU74228.1| succinate-CoA ligase, alpha subunit [Escherichia coli O157:H7 str.
           EC4401]
 gi|189363351|gb|EDU81770.1| succinate-CoA ligase, alpha subunit [Escherichia coli O157:H7 str.
           EC4486]
 gi|189365933|gb|EDU84349.1| succinate-CoA ligase, alpha subunit [Escherichia coli O157:H7 str.
           EC4501]
 gi|189373079|gb|EDU91495.1| succinate-CoA ligase, alpha subunit [Escherichia coli O157:H7 str.
           EC869]
 gi|189376494|gb|EDU94910.1| succinate-CoA ligase, alpha subunit [Escherichia coli O157:H7 str.
           EC508]
 gi|190902754|gb|EDV62484.1| succinate-CoA ligase, alpha subunit [Escherichia coli B7A]
 gi|190905645|gb|EDV65268.1| succinate-CoA ligase, alpha subunit [Escherichia coli F11]
 gi|192926835|gb|EDV81461.1| succinate-CoA ligase, alpha subunit [Escherichia coli E22]
 gi|192956055|gb|EDV86521.1| succinate-CoA ligase, alpha subunit [Escherichia coli E110019]
 gi|194412905|gb|EDX29196.1| succinate-CoA ligase, alpha subunit [Escherichia coli B171]
 gi|194417744|gb|EDX33842.1| succinate-CoA ligase, alpha subunit [Shigella dysenteriae 1012]
 gi|194421820|gb|EDX37827.1| succinate-CoA ligase, alpha subunit [Escherichia coli 101-1]
 gi|208727385|gb|EDZ76986.1| succinate-CoA ligase, alpha subunit [Escherichia coli O157:H7 str.
           EC4206]
 gi|208733016|gb|EDZ81704.1| succinate-CoA ligase, alpha subunit [Escherichia coli O157:H7 str.
           EC4045]
 gi|208737362|gb|EDZ85046.1| succinate-CoA ligase, alpha subunit [Escherichia coli O157:H7 str.
           EC4042]
 gi|209157166|gb|ACI34599.1| succinate-CoA ligase, alpha subunit [Escherichia coli O157:H7 str.
           EC4115]
 gi|209776458|gb|ACI86541.1| succinyl-CoA synthetase alpha subunit [Escherichia coli]
 gi|209776460|gb|ACI86542.1| succinyl-CoA synthetase alpha subunit [Escherichia coli]
 gi|209776462|gb|ACI86543.1| succinyl-CoA synthetase alpha subunit [Escherichia coli]
 gi|209776466|gb|ACI86545.1| succinyl-CoA synthetase alpha subunit [Escherichia coli]
 gi|209911238|dbj|BAG76312.1| succinyl-CoA synthase alpha subunit [Escherichia coli SE11]
 gi|217320475|gb|EEC28899.1| succinate-CoA ligase, alpha subunit [Escherichia coli O157:H7 str.
           TW14588]
 gi|218350884|emb|CAU96582.1| succinyl-CoA synthetase, NAD(P)-binding, alpha subunit [Escherichia
           coli 55989]
 gi|218357248|emb|CAQ89883.1| succinyl-CoA synthetase, NAD(P)-binding, alpha subunit [Escherichia
           fergusonii ATCC 35469]
 gi|218360023|emb|CAQ97570.1| succinyl-CoA synthetase, NAD(P)-binding, alpha subunit [Escherichia
           coli IAI1]
 gi|218364413|emb|CAR02093.1| succinyl-CoA synthetase, NAD(P)-binding, alpha subunit [Escherichia
           coli S88]
 gi|218369069|emb|CAR16823.1| succinyl-CoA synthetase, NAD(P)-binding, alpha subunit [Escherichia
           coli IAI39]
 gi|218426086|emb|CAR06904.1| succinyl-CoA synthetase, NAD(P)-binding, alpha subunit [Escherichia
           coli ED1a]
 gi|218431142|emb|CAR12018.1| succinyl-CoA synthetase, NAD(P)-binding, alpha subunit [Escherichia
           coli UMN026]
 gi|222032465|emb|CAP75204.1| Succinyl-CoA ligase [adP-forming] subunit alpha [Escherichia coli
           LF82]
 gi|226898519|gb|EEH84778.1| succinyl-CoA synthetase subunit alpha [Escherichia sp. 3_2_53FAA]
 gi|227838726|gb|EEJ49192.1| succinyl-CoA synthetase subunit alpha [Escherichia coli 83972]
 gi|238863593|gb|ACR65591.1| succinyl-CoA synthetase, NAD(P)-binding, alpha subunit [Escherichia
           coli BW2952]
 gi|242376490|emb|CAQ31194.1| succinyl-CoA synthetase, alpha subunit, subunit of succinyl-CoA
           synthetase [Escherichia coli BL21(DE3)]
 gi|253325345|gb|ACT29947.1| succinyl-CoA synthetase, alpha subunit [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|253972699|gb|ACT38370.1| succinyl-CoA synthetase subunit alpha [Escherichia coli B str.
           REL606]
 gi|253976893|gb|ACT42563.1| succinyl-CoA synthetase subunit alpha [Escherichia coli BL21(DE3)]
 gi|254591275|gb|ACT70636.1| succinyl-CoA synthetase, NAD(P)-binding, alpha subunit [Escherichia
           coli O157:H7 str. TW14359]
 gi|257752612|dbj|BAI24114.1| succinyl-CoA synthetase, NAD(P)-binding, alpha subunit [Escherichia
           coli O26:H11 str. 11368]
 gi|257758082|dbj|BAI29579.1| succinyl-CoA synthetase, NAD(P)-binding, alpha subunit [Escherichia
           coli O103:H2 str. 12009]
 gi|257763215|dbj|BAI34710.1| succinyl-CoA synthetase, NAD(P)-binding, alpha subunit [Escherichia
           coli O111:H- str. 11128]
 gi|260450118|gb|ACX40540.1| succinyl-CoA synthetase, alpha subunit [Escherichia coli DH1]
 gi|281177871|dbj|BAI54201.1| succinyl-CoA synthetase alpha subunit [Escherichia coli SE15]
 gi|284920507|emb|CBG33569.1| succinyl-CoA synthetase alpha chain [Escherichia coli 042]
 gi|290761534|gb|ADD55495.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Escherichia coli
           O55:H7 str. CB9615]
 gi|291323816|gb|EFE63238.1| succinyl-CoA ligase subunit alpha [Escherichia coli B088]
 gi|291428558|gb|EFF01583.1| succinyl-CoA synthetase alpha subunit [Escherichia coli FVEC1412]
 gi|291434064|gb|EFF07037.1| succinyl-CoA ligase subunit alpha [Escherichia coli B185]
 gi|291469570|gb|EFF12054.1| succinyl-CoA ligase subunit alpha [Escherichia coli B354]
 gi|294493816|gb|ADE92572.1| succinate-CoA ligase, alpha subunit [Escherichia coli IHE3034]
 gi|298279446|gb|EFI20954.1| succinyl-CoA ligase subunit alpha [Escherichia coli FVEC1302]
 gi|299879425|gb|EFI87636.1| succinyl-CoA synthetase subunit alpha [Escherichia coli MS 196-1]
 gi|300297014|gb|EFJ53399.1| succinyl-CoA synthetase subunit alpha [Escherichia coli MS 185-1]
 gi|300309176|gb|EFJ63696.1| succinyl-CoA synthetase subunit alpha [Escherichia coli MS 200-1]
 gi|300315594|gb|EFJ65378.1| succinyl-CoA synthetase subunit alpha [Escherichia coli MS 175-1]
 gi|300355782|gb|EFJ71652.1| succinyl-CoA synthetase subunit alpha [Escherichia coli MS 198-1]
 gi|300398457|gb|EFJ81995.1| succinyl-CoA synthetase subunit alpha [Escherichia coli MS 69-1]
 gi|300401207|gb|EFJ84745.1| succinyl-CoA synthetase subunit alpha [Escherichia coli MS 84-1]
 gi|300406684|gb|EFJ90222.1| succinyl-CoA synthetase subunit alpha [Escherichia coli MS 45-1]
 gi|300414451|gb|EFJ97761.1| succinyl-CoA synthetase subunit alpha [Escherichia coli MS 115-1]
 gi|300457180|gb|EFK20673.1| succinyl-CoA synthetase subunit alpha [Escherichia coli MS 21-1]
 gi|300462576|gb|EFK26069.1| succinyl-CoA synthetase subunit alpha [Escherichia coli MS 187-1]
 gi|300524525|gb|EFK45594.1| succinyl-CoA synthetase subunit alpha [Escherichia coli MS 119-7]
 gi|300531066|gb|EFK52128.1| succinyl-CoA synthetase subunit alpha [Escherichia coli MS 107-1]
 gi|300839527|gb|EFK67287.1| succinyl-CoA synthetase subunit alpha [Escherichia coli MS 124-1]
 gi|300845563|gb|EFK73323.1| succinyl-CoA synthetase subunit alpha [Escherichia coli MS 78-1]
 gi|301073858|gb|EFK88664.1| succinyl-CoA synthetase subunit alpha [Escherichia coli MS 146-1]
 gi|305853626|gb|EFM54065.1| succinyl-CoA synthetase subunit alpha [Escherichia coli NC101]
 gi|306905705|gb|EFN36233.1| succinyl-CoA synthetase, alpha subunit [Escherichia coli W]
 gi|307552580|gb|ADN45355.1| succinyl-CoA ligase subunit alpha [Escherichia coli ABU 83972]
 gi|307627857|gb|ADN72161.1| succinyl-CoA synthetase subunit alpha [Escherichia coli UM146]
 gi|308118965|gb|EFO56227.1| succinyl-CoA synthetase subunit alpha [Escherichia coli MS 145-7]
 gi|309700950|emb|CBJ00247.1| succinyl-CoA synthetase alpha chain [Escherichia coli ETEC H10407]
 gi|310336567|gb|EFQ01734.1| succinyl-CoA ligase [ADP-forming] subunit alpha [Escherichia coli
           1827-70]
 gi|312945253|gb|ADR26080.1| succinyl-CoA synthetase subunit alpha [Escherichia coli O83:H1 str.
           NRG 857C]
 gi|315059971|gb|ADT74298.1| succinyl-CoA synthetase, NAD(P)-binding, alpha subunit [Escherichia
           coli W]
 gi|315135384|dbj|BAJ42543.1| succinyl-CoA ligase [ADP-forming] subunit alpha [Escherichia coli
           DH1]
 gi|315257646|gb|EFU37614.1| succinyl-CoA synthetase subunit alpha [Escherichia coli MS 85-1]
 gi|315287157|gb|EFU46569.1| succinyl-CoA synthetase subunit alpha [Escherichia coli MS 110-3]
 gi|315292642|gb|EFU51994.1| succinyl-CoA synthetase subunit alpha [Escherichia coli MS 153-1]
 gi|315299269|gb|EFU58521.1| succinyl-CoA synthetase subunit alpha [Escherichia coli MS 16-3]
 gi|315614603|gb|EFU95245.1| succinyl-CoA ligase [ADP-forming] subunit alpha [Escherichia coli
           3431]
 gi|320177272|gb|EFW52278.1| Succinyl-CoA ligase [ADP-forming] alpha chain [Shigella dysenteriae
           CDC 74-1112]
 gi|320179431|gb|EFW54388.1| Succinyl-CoA ligase [ADP-forming] alpha chain [Shigella boydii ATCC
           9905]
 gi|320182933|gb|EFW57802.1| Succinyl-CoA ligase [ADP-forming] alpha chain [Shigella flexneri
           CDC 796-83]
 gi|320193123|gb|EFW67763.1| Succinyl-CoA ligase [ADP-forming] alpha chain [Escherichia coli
           O157:H7 str. EC1212]
 gi|320194114|gb|EFW68746.1| Succinyl-CoA ligase [ADP-forming] alpha chain [Escherichia coli
           WV_060327]
 gi|320198153|gb|EFW72757.1| Succinyl-CoA ligase [ADP-forming] alpha chain [Escherichia coli
           EC4100B]
 gi|320637976|gb|EFX07745.1| succinyl-CoA synthetase subunit alpha [Escherichia coli O157:H7
           str. G5101]
 gi|320643371|gb|EFX12551.1| succinyl-CoA synthetase subunit alpha [Escherichia coli O157:H-
           str. 493-89]
 gi|320648720|gb|EFX17353.1| succinyl-CoA synthetase subunit alpha [Escherichia coli O157:H-
           str. H 2687]
 gi|320654304|gb|EFX22357.1| succinyl-CoA synthetase subunit alpha [Escherichia coli O55:H7 str.
           3256-97 TW 07815]
 gi|320659937|gb|EFX27479.1| succinyl-CoA synthetase subunit alpha [Escherichia coli O55:H7 str.
           USDA 5905]
 gi|320664761|gb|EFX31899.1| succinyl-CoA synthetase subunit alpha [Escherichia coli O157:H7
           str. LSU-61]
 gi|323153758|gb|EFZ40005.1| succinyl-CoA ligase [ADP-forming] subunit alpha [Escherichia coli
           EPECa14]
 gi|323163887|gb|EFZ49697.1| succinyl-CoA ligase [ADP-forming] subunit alpha [Shigella sonnei
           53G]
 gi|323170848|gb|EFZ56498.1| succinyl-CoA ligase [ADP-forming] subunit alpha [Escherichia coli
           LT-68]
 gi|323180033|gb|EFZ65589.1| succinyl-CoA ligase [ADP-forming] subunit alpha [Escherichia coli
           1180]
 gi|323185113|gb|EFZ70479.1| succinyl-CoA ligase [ADP-forming] subunit alpha [Escherichia coli
           1357]
 gi|323379469|gb|ADX51737.1| succinyl-CoA synthetase, alpha subunit [Escherichia coli KO11]
 gi|323938306|gb|EGB34563.1| succinate-CoA ligase [Escherichia coli E1520]
 gi|323942950|gb|EGB39114.1| succinate-CoA ligase [Escherichia coli E482]
 gi|323952713|gb|EGB48581.1| succinate-CoA ligase [Escherichia coli H252]
 gi|323958473|gb|EGB54179.1| succinate-CoA ligase [Escherichia coli H263]
 gi|323963109|gb|EGB58679.1| succinate-CoA ligase [Escherichia coli H489]
 gi|323967435|gb|EGB62855.1| succinate-CoA ligase [Escherichia coli M863]
 gi|323972013|gb|EGB67233.1| succinate-CoA ligase [Escherichia coli TA007]
 gi|323976301|gb|EGB71391.1| succinate-CoA ligase [Escherichia coli TW10509]
 gi|324009578|gb|EGB78797.1| succinyl-CoA synthetase subunit alpha [Escherichia coli MS 57-2]
 gi|324010450|gb|EGB79669.1| succinyl-CoA synthetase subunit alpha [Escherichia coli MS 60-1]
 gi|324020365|gb|EGB89584.1| succinyl-CoA synthetase subunit alpha [Escherichia coli MS 117-3]
 gi|324114838|gb|EGC08806.1| succinate-CoA ligase [Escherichia fergusonii B253]
 gi|324116269|gb|EGC10190.1| succinate-CoA ligase [Escherichia coli E1167]
 gi|326341533|gb|EGD65323.1| Succinyl-CoA ligase [ADP-forming] alpha chain [Escherichia coli
           O157:H7 str. 1044]
 gi|326345751|gb|EGD69490.1| Succinyl-CoA ligase [ADP-forming] alpha chain [Escherichia coli
           O157:H7 str. 1125]
 gi|327254407|gb|EGE66029.1| succinyl-CoA ligase [ADP-forming] subunit alpha [Escherichia coli
           STEC_7v]
 gi|330910477|gb|EGH38987.1| succinyl-CoA ligase [ADP-forming] alpha chain [Escherichia coli
           AA86]
 gi|331038027|gb|EGI10247.1| succinyl-CoA synthetase subunit alpha [Escherichia coli H736]
 gi|331044629|gb|EGI16756.1| succinyl-CoA synthetase subunit alpha [Escherichia coli M605]
 gi|331050004|gb|EGI22062.1| succinyl-CoA synthetase subunit alpha [Escherichia coli M718]
 gi|331060503|gb|EGI32467.1| succinyl-CoA synthetase subunit alpha [Escherichia coli TA143]
 gi|331065451|gb|EGI37344.1| succinyl-CoA synthetase subunit alpha [Escherichia coli TA271]
 gi|331070438|gb|EGI41802.1| succinyl-CoA synthetase subunit alpha [Escherichia coli TA280]
 gi|331075903|gb|EGI47200.1| succinyl-CoA synthetase subunit alpha [Escherichia coli H591]
 gi|331080583|gb|EGI51759.1| succinyl-CoA synthetase subunit alpha [Escherichia coli H299]
 gi|332093789|gb|EGI98843.1| succinyl-CoA ligase [ADP-forming] subunit alpha [Shigella boydii
           5216-82]
 gi|332096447|gb|EGJ01443.1| succinyl-CoA ligase [ADP-forming] subunit alpha [Shigella
           dysenteriae 155-74]
 gi|332097685|gb|EGJ02660.1| succinyl-CoA ligase [ADP-forming] subunit alpha [Shigella boydii
           3594-74]
 gi|332104776|gb|EGJ08122.1| succinyl-CoA synthetase subunit alpha [Shigella sp. D9]
 gi|332342064|gb|AEE55398.1| succinyl-CoA ligase, alpha subunit SucD [Escherichia coli UMNK88]
          Length = 289

 Score =  347 bits (891), Expect = 1e-93,   Method: Composition-based stats.
 Identities = 173/298 (58%), Positives = 218/298 (73%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL+DKNTKV+ QG TG  GTFH+EQAI Y  T++VGG+ P KG T   G    +PVF 
Sbjct: 1   MSILIDKNTKVICQGFTGSQGTFHSEQAIAY-GTKMVGGVTPGKGGTTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA   T A ASVIYVP     D+I+E+I+A I LI+ ITEGIP LDM+ VK +L+++
Sbjct: 56  TVREAVAATGATASVIYVPAPFCKDSILEAIDAGIKLIITITEGIPTLDMLTVKVKLDEA 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TP  CKIGI PG I + G VGI+SRSGTLTYEAV QT+  G GQST 
Sbjct: 116 GVRMIGPNCPGVITPGECKIGIQPGHIHKPGKVGIVSRSGTLTYEAVKQTTDYGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+LE+F  D  TE+IVM+GEIGGSAEEEAA ++K+       KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILEMFEKDPQTEAIVMIGEIGGSAEEEAAAYIKEH----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           G++AG TAP G+ MGHAGA+I+GGKG A++K  A++ AG+    S A IG +L  +L 
Sbjct: 232 GYIAGVTAPKGKRMGHAGAIIAGGKGTADEKFAALEAAGVKTVRSLADIGEALKTVLK 289


>gi|157369513|ref|YP_001477502.1| succinyl-CoA synthetase subunit alpha [Serratia proteamaculans 568]
 gi|157321277|gb|ABV40374.1| succinyl-CoA synthetase, alpha subunit [Serratia proteamaculans
           568]
          Length = 290

 Score =  347 bits (891), Expect = 1e-93,   Method: Composition-based stats.
 Identities = 175/298 (58%), Positives = 220/298 (73%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL+DKNTKV+ QG TG  GTFH+EQAI Y  T++VGG+ P KG T   G    +PVF 
Sbjct: 1   MSILIDKNTKVICQGFTGSQGTFHSEQAIAY-GTKMVGGVTPGKGGTEHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T A ASVIYVP     D+I+E+I+A I LI+ ITEGIP LDM+ VK +L+++
Sbjct: 56  TVREAVEATGATASVIYVPAPFCKDSILEAIDAGIKLIITITEGIPTLDMLTVKVKLDEA 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TP  CKIGIMPG I   G VGI+SRSGTLTYEAV QT+  GLGQST 
Sbjct: 116 GVRMIGPNCPGVITPGECKIGIMPGHIHLPGKVGIVSRSGTLTYEAVKQTTDTGLGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L+LF  D  TE+IVM+GEIGGSAEEEAA ++K+       KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILKLFQEDPQTEAIVMIGEIGGSAEEEAAAYIKEH----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           G++AG TAP G+ MGHAGA+I+GGKG A++K  A++ AG+    S A IG ++  +L 
Sbjct: 232 GYIAGVTAPKGKRMGHAGAIIAGGKGTADEKFAALEAAGVKTVRSLADIGEAVKAVLN 289


>gi|34580487|ref|ZP_00141967.1| succinyl-CoA synthetase alpha chain [Rickettsia sibirica 246]
 gi|28261872|gb|EAA25376.1| succinyl-CoA synthetase alpha chain [Rickettsia sibirica 246]
          Length = 292

 Score =  347 bits (891), Expect = 1e-93,   Method: Composition-based stats.
 Identities = 179/299 (59%), Positives = 232/299 (77%), Gaps = 8/299 (2%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           M+IL++K T+V+ QG TG  GTFH+EQAI Y  T +VGG+ P KG        +++PV+ 
Sbjct: 1   MAILINKKTQVICQGFTGLQGTFHSEQAIAY-GTNMVGGVTPGKGGHTH----LDLPVYN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EAK +T ANASVIYVPP  A D+I+E+I+AEI ++VCITEGIPVLDMV+VK  L  S
Sbjct: 56  TVHEAKAKTGANASVIYVPPGFAADSILEAIDAEIEVVVCITEGIPVLDMVKVKRALAGS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            +RLIGPNCPG++TP  CKIGIMPG I ++G++GI+SRSGTLTYEAV QT+  GLGQST 
Sbjct: 116 KTRLIGPNCPGVITPGECKIGIMPGHIHKRGTIGIVSRSGTLTYEAVAQTTAVGLGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPV GT F+D +E+FL D+ T++I+M+GEIGG+AEE+AA+F+K       KKPIV
Sbjct: 176 VGIGGDPVNGTNFVDCIEMFLKDDETKAIIMIGEIGGNAEEDAAEFIKQ---SKIKKPIV 232

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
            F+AG TAPPG+ MGHAGA+I G  G AEDK+ A++ AG+ I  SPA IG+++++LL  
Sbjct: 233 SFIAGITAPPGKRMGHAGAIIVGRTGSAEDKLEALQSAGVIITRSPADIGKTMLDLLNK 291


>gi|157828469|ref|YP_001494711.1| succinyl-CoA synthetase subunit alpha [Rickettsia rickettsii str.
           'Sheila Smith']
 gi|165933187|ref|YP_001649976.1| succinyl-CoA synthetase subunit alpha [Rickettsia rickettsii str.
           Iowa]
 gi|13235367|emb|CAC33660.1| Succinyl-CoA synthetase alpha subunit [Rickettsia rickettsii]
 gi|157800950|gb|ABV76203.1| succinyl-CoA synthetase subunit alpha [Rickettsia rickettsii str.
           'Sheila Smith']
 gi|165908274|gb|ABY72570.1| succinyl-CoA synthetase alpha chain [Rickettsia rickettsii str.
           Iowa]
          Length = 292

 Score =  347 bits (891), Expect = 1e-93,   Method: Composition-based stats.
 Identities = 178/299 (59%), Positives = 232/299 (77%), Gaps = 8/299 (2%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           M+IL++K T+V+ QG TG  GTFH+EQAI Y  T +VGG+ P KG        +++PV+ 
Sbjct: 1   MAILINKKTQVICQGFTGLQGTFHSEQAIAY-GTNMVGGVTPGKGGHTH----LDLPVYN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EAK +T ANASVIYVPP  A D+I+E+I+AEI ++VCITEGIPVLDMV+VK  L  S
Sbjct: 56  TVHEAKAKTGANASVIYVPPGFAADSILEAIDAEIEVVVCITEGIPVLDMVKVKRALVGS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            +RLIGPNCPG++TP  CKIGIMPG I ++G++GI+SRSGTLTYEAV QT+  GLGQST 
Sbjct: 116 KTRLIGPNCPGVITPGECKIGIMPGHIHKRGTIGIVSRSGTLTYEAVAQTTAVGLGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPV GT F+D +E+FL D+ T++++M+GEIGG+AEE+AA+F+K       KKPIV
Sbjct: 176 VGIGGDPVNGTNFVDCIEMFLKDDETKAVIMIGEIGGNAEEDAAEFIKQ---SKIKKPIV 232

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
            F+AG TAPPG+ MGHAGA+I G  G AEDK+ A++ AG+ I  SPA IG+++++LL  
Sbjct: 233 SFIAGITAPPGKRMGHAGAIIVGRTGSAEDKLEALQSAGVVITRSPADIGKTMLDLLNK 291


>gi|71734822|ref|YP_274208.1| succinyl-CoA synthetase subunit alpha [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|257485469|ref|ZP_05639510.1| succinyl-CoA synthetase subunit alpha [Pseudomonas syringae pv.
           tabaci ATCC 11528]
 gi|289624397|ref|ZP_06457351.1| succinyl-CoA synthetase subunit alpha [Pseudomonas syringae pv.
           aesculi str. NCPPB3681]
 gi|289646689|ref|ZP_06478032.1| succinyl-CoA synthetase subunit alpha [Pseudomonas syringae pv.
           aesculi str. 2250]
 gi|71555375|gb|AAZ34586.1| succinyl-CoA synthetase, alpha subunit [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|320324900|gb|EFW80972.1| succinyl-CoA synthetase subunit alpha [Pseudomonas syringae pv.
           glycinea str. B076]
 gi|320329266|gb|EFW85263.1| succinyl-CoA synthetase subunit alpha [Pseudomonas syringae pv.
           glycinea str. race 4]
 gi|330867449|gb|EGH02158.1| succinyl-CoA synthetase subunit alpha [Pseudomonas syringae pv.
           aesculi str. 0893_23]
 gi|330888159|gb|EGH20820.1| succinyl-CoA synthetase subunit alpha [Pseudomonas syringae pv.
           mori str. 301020]
 gi|330987446|gb|EGH85549.1| succinyl-CoA synthetase subunit alpha [Pseudomonas syringae pv.
           lachrymans str. M301315]
          Length = 293

 Score =  347 bits (891), Expect = 1e-93,   Method: Composition-based stats.
 Identities = 171/298 (57%), Positives = 216/298 (72%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+TKV+ QG TG  GTFH+EQAI Y  T++VGG+ P KG T      +N+PVF 
Sbjct: 1   MSVLINKDTKVICQGFTGSQGTFHSEQAIAY-GTKMVGGVTPGKGGTTH----LNLPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA + T A ASVIYVP     D+I+E+    I LIVCITEGIP +DM+  K + ++ 
Sbjct: 56  TVKEAVDTTGATASVIYVPAPFCKDSILEAAFGGIKLIVCITEGIPTIDMLEAKVKCDEL 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
              LIGPNCPG++TP  CKIGIMPG I   G VGI+SRSGTLTYEAV QT+  G GQST 
Sbjct: 116 GVILIGPNCPGVITPGECKIGIMPGHIHLPGKVGIVSRSGTLTYEAVKQTTDAGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L+LF  D  TE+IVM+GEIGGSAEEEAA ++K        KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILKLFQEDPKTEAIVMIGEIGGSAEEEAAAYIKAH----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            ++AG TAPPG+ MGHAGA+ISGGKG A++K  A+++AG+    S A IG++L EL G
Sbjct: 232 SYIAGVTAPPGKRMGHAGAIISGGKGTADEKFAALQDAGVKTVRSLADIGKALAELTG 289


>gi|332992991|gb|AEF03046.1| Succinyl-CoA synthetase subunit alpha [Alteromonas sp. SN2]
          Length = 290

 Score =  347 bits (891), Expect = 1e-93,   Method: Composition-based stats.
 Identities = 171/295 (57%), Positives = 218/295 (73%), Gaps = 9/295 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+TKV+ QG TG  GTFH+EQAI Y  TQ+VGG+ P KG T   G    +PVF 
Sbjct: 1   MSVLINKDTKVICQGFTGGQGTFHSEQAIAY-GTQMVGGVTPGKGGTEHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T A A+VIYVP +   D+I+E+ +A I LIVCITEGIP LDM+ VK  +   
Sbjct: 56  TVREAVEATGATATVIYVPAAFCKDSIVEAADAGIELIVCITEGIPTLDMLYVKEYVNAK 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TP  CKIGIMPG I + G VGI+SRSGTLTYEAV QT+ EG GQS+ 
Sbjct: 116 GVRMIGPNCPGVITPGECKIGIMPGHIHKPGKVGIVSRSGTLTYEAVKQTTDEGFGQSSC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L+LF  D  TE+IVM+GEIGG+AEEEAA+F+K        KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILQLFQDDPQTEAIVMIGEIGGTAEEEAAEFIKAN----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVE 295
            ++AG TAP G+ MGHAGA+I+GGKG A++K  A+++AG+    S A IG++L E
Sbjct: 232 SYIAGVTAPEGKRMGHAGAIIAGGKGTADEKFKALEDAGVKTVRSLAEIGKALRE 286


>gi|145641203|ref|ZP_01796783.1| succinyl-CoA synthetase alpha subunit [Haemophilus influenzae
           R3021]
 gi|145274040|gb|EDK13906.1| succinyl-CoA synthetase alpha subunit [Haemophilus influenzae
           22.4-21]
          Length = 293

 Score =  347 bits (891), Expect = 1e-93,   Method: Composition-based stats.
 Identities = 182/299 (60%), Positives = 222/299 (74%), Gaps = 9/299 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           M+IL+DKNTKV+ QG TG  GTFH+EQA+ Y  TQ+VGG+ P KG +   G    +PVF 
Sbjct: 1   MAILIDKNTKVICQGFTGGQGTFHSEQALAY-GTQLVGGVSPNKGGSSHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T A A+VIYVP S   D IIE+I+A I LIVCITEGIP LDM++VK +L ++
Sbjct: 56  TVREAVENTGATATVIYVPASFCKDVIIEAIDAGIQLIVCITEGIPTLDMLKVKQKLNET 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
              +IGPNCPG++TPD CKIGIMP  I +KG VGI+SRSGTLTYEAV QT+ EG GQST 
Sbjct: 116 GVVMIGPNCPGVITPDECKIGIMPAHIHKKGKVGIVSRSGTLTYEAVKQTTDEGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+LE F  D  TE+IVM+GEIGGSAEEEAA F+KD       KP+V
Sbjct: 176 VGIGGDPILGSSFIDILERFQQDPETEAIVMIGEIGGSAEEEAAIFIKDN----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
            ++AG TAP G+ MGHAGA+ISGGKG A +KI A++ AG+    S A IG +L +LL S
Sbjct: 232 AYIAGITAPKGKRMGHAGAIISGGKGTAVEKIAALEAAGVICVKSLAEIGEALRKLLKS 290


>gi|68249743|ref|YP_248855.1| succinyl-CoA synthetase alpha chain [Haemophilus influenzae
           86-028NP]
 gi|68057942|gb|AAX88195.1| succinyl-CoA synthetase alpha chain [Haemophilus influenzae
           86-028NP]
          Length = 293

 Score =  347 bits (891), Expect = 1e-93,   Method: Composition-based stats.
 Identities = 183/299 (61%), Positives = 222/299 (74%), Gaps = 9/299 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           M+IL+DKNTKV+ QG TG  G FH+EQA+ Y  TQ+VGG+ P KG T   G    +PVF 
Sbjct: 1   MAILIDKNTKVICQGFTGGQGAFHSEQALAY-GTQLVGGVSPNKGGTTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T A A+VIYVP S   DAIIE+I+A I LIVCITEGIP LDM++VK +L ++
Sbjct: 56  TVREAVENTGATATVIYVPASFCKDAIIEAIDAGIQLIVCITEGIPTLDMLKVKQKLNET 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
              +IGPNCPG++TPD CKIGIMP  I +KG VGI+SRSGTLTYEAV QT+ EG GQST 
Sbjct: 116 GVVMIGPNCPGVITPDECKIGIMPAHIHKKGKVGIVSRSGTLTYEAVKQTTDEGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+LE F  D  TE+IVM+GEIGGSAEEEAA F+KD       KP+V
Sbjct: 176 VGIGGDPIPGSSFIDILERFQQDPETEAIVMIGEIGGSAEEEAAIFIKDN----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
            ++AG TAP G+ MGHAGA+ISGGKG A +KI A++ AG+    S A IG +L +LL S
Sbjct: 232 AYIAGITAPKGKRMGHAGAIISGGKGTAVEKIAALEAAGVTCVKSLAEIGEALRKLLKS 290


>gi|330967006|gb|EGH67266.1| succinyl-CoA synthetase subunit alpha [Pseudomonas syringae pv.
           actinidiae str. M302091]
          Length = 293

 Score =  347 bits (891), Expect = 1e-93,   Method: Composition-based stats.
 Identities = 170/298 (57%), Positives = 216/298 (72%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+TKV+ QG TG  GTFH+EQAI Y  T++VGG+ P KG T      +N+PVF 
Sbjct: 1   MSVLINKDTKVICQGFTGSQGTFHSEQAIAY-GTKMVGGVTPGKGGTTH----LNLPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA + T A ASVIYVP     D+I+E+    I LIVCITEGIP +DM+  K + ++ 
Sbjct: 56  TVKEAVDTTGATASVIYVPAPFCKDSILEAAFGGIKLIVCITEGIPTIDMLEAKVKCDEL 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
              +IGPNCPG++TP  CKIGIMPG I   G VGI+SRSGTLTYEAV QT+  G GQST 
Sbjct: 116 GVIVIGPNCPGVITPGECKIGIMPGHIHLPGKVGIVSRSGTLTYEAVKQTTDAGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L+LF  D  TE+IVM+GEIGGSAEEEAA ++K        KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILKLFQEDPQTEAIVMIGEIGGSAEEEAAAYIKAH----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            ++AG TAPPG+ MGHAGA+ISGGKG A++K  A+++AG+    S A IG++L EL G
Sbjct: 232 SYIAGVTAPPGKRMGHAGAIISGGKGTADEKFAALQDAGVKTVRSLADIGKALAELTG 289


>gi|103487710|ref|YP_617271.1| succinyl-CoA synthetase, alpha subunit [Sphingopyxis alaskensis
           RB2256]
 gi|98977787|gb|ABF53938.1| succinyl-CoA synthetase (ADP-forming) alpha subunit [Sphingopyxis
           alaskensis RB2256]
          Length = 296

 Score =  347 bits (891), Expect = 1e-93,   Method: Composition-based stats.
 Identities = 209/299 (69%), Positives = 248/299 (82%), Gaps = 5/299 (1%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL+DKNTKV+ QG+TG  GTFHTEQA+ Y  T++VGG+ P KG T   G    +P+F 
Sbjct: 1   MSILIDKNTKVITQGMTGATGTFHTEQALAY-GTKMVGGVTPGKGGTTHIG----LPMFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EAK  T A ASVIYVPP  A D+I+E+I+AE+ LIVCITEGIPVLDMV+VK  L  S
Sbjct: 56  TVEEAKHATGATASVIYVPPPFAADSILEAIDAEVELIVCITEGIPVLDMVKVKRALSGS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            SRLIGPNCPG+LTP+ CKIGIMPG+IF+KGSVG++SRSGTLTYEAVFQTS  GLGQ+TA
Sbjct: 116 KSRLIGPNCPGVLTPEECKIGIMPGNIFKKGSVGVVSRSGTLTYEAVFQTSNVGLGQTTA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPV GT FIDVLELFLAD+AT+SI+M+GEIGG AEE+AAQFL DEAKRGRKKP+ 
Sbjct: 176 VGIGGDPVNGTNFIDVLELFLADDATKSIIMIGEIGGDAEEQAAQFLIDEAKRGRKKPMA 235

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
           GF+AG+TAPPGR MGHAGA++SGGKG AE KI AM+ AGI ++ SP+ +G +L E+L  
Sbjct: 236 GFIAGRTAPPGRRMGHAGAIVSGGKGDAESKIAAMEAAGIKVSASPSELGTTLAEVLKE 294


>gi|37679219|ref|NP_933828.1| succinyl-CoA synthetase subunit alpha [Vibrio vulnificus YJ016]
 gi|320157038|ref|YP_004189417.1| succinyl-CoA ligase (ADP-forming) subunit beta [Vibrio vulnificus
           MO6-24/O]
 gi|37197962|dbj|BAC93799.1| succinyl-CoA synthetase, alpha subunit [Vibrio vulnificus YJ016]
 gi|319932350|gb|ADV87214.1| succinyl-CoA ligase [ADP-forming] beta chain [Vibrio vulnificus
           MO6-24/O]
          Length = 290

 Score =  347 bits (891), Expect = 1e-93,   Method: Composition-based stats.
 Identities = 177/298 (59%), Positives = 223/298 (74%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+TKV+ QG TG  GTFH+EQA+ Y  TQ+VGG+ P KG     G    +PVF 
Sbjct: 1   MSVLINKDTKVICQGFTGGQGTFHSEQALAY-GTQMVGGVSPGKGGQTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T A A+VIYVP     DAI+E+I+A I LIV ITEGIP  DM+ VK +LE++
Sbjct: 56  TVREAVEATGATATVIYVPAPFCKDAILEAIDAGIELIVTITEGIPTTDMIDVKVKLEQT 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TPD CKIGIMPG I +KG VGI+SRSGTLTYEAV QT+ EG GQST 
Sbjct: 116 GVRMIGPNCPGVITPDECKIGIMPGHIHKKGKVGIVSRSGTLTYEAVKQTTDEGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L+LF  D  TE+IVM+GEIGG+AEEEAA F+K+       KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILKLFQEDPETEAIVMIGEIGGTAEEEAAAFIKEN----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            ++AG TAPPG+ MGHAGA+ISGGKG A++K  A++ AG+    S A IG++L E+ G
Sbjct: 232 SYIAGVTAPPGKRMGHAGAIISGGKGTADEKFAALESAGVKTVKSLADIGQALREVTG 289


>gi|163752207|ref|ZP_02159409.1| succinyl-CoA synthase, alpha subunit [Shewanella benthica KT99]
 gi|161327888|gb|EDP99066.1| succinyl-CoA synthase, alpha subunit [Shewanella benthica KT99]
          Length = 290

 Score =  347 bits (891), Expect = 1e-93,   Method: Composition-based stats.
 Identities = 178/294 (60%), Positives = 218/294 (74%), Gaps = 9/294 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL++K+TKV+ QG TG  GTFH+EQAI Y  TQ+VGG+ P KG     G    +PVF 
Sbjct: 1   MSILINKDTKVICQGFTGGQGTFHSEQAIDY-GTQMVGGVSPGKGGKVHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA   T A ASVIYVP     DAI+E+I+  I LIVCITEGIP LDM++VK +LE++
Sbjct: 56  TVKEAVAETGATASVIYVPAPFCKDAILEAIDGGIELIVCITEGIPTLDMLQVKVKLEET 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TP  CKIGIMPG I + G VGI+SRSGTLTYEAV QT+ EG GQST 
Sbjct: 116 GVRMIGPNCPGVITPGECKIGIMPGHIHKPGKVGIVSRSGTLTYEAVKQTTDEGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ GT FIDVLELF  D  TE+IVM+GEIGG+AEEEAA+++K        KP+V
Sbjct: 176 VGIGGDPIPGTNFIDVLELFQNDPQTEAIVMIGEIGGTAEEEAAEYIKAH----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLV 294
            ++AG TAP G+ MGHAGA+I+GGKG AEDK  A++ AG+    S A IG++L 
Sbjct: 232 SYIAGVTAPEGKRMGHAGAIIAGGKGTAEDKFAALEAAGVTTVRSLADIGKALR 285


>gi|332288474|ref|YP_004419326.1| succinyl-CoA synthetase subunit alpha [Gallibacterium anatis
           UMN179]
 gi|330431370|gb|AEC16429.1| succinyl-CoA synthetase subunit alpha [Gallibacterium anatis
           UMN179]
          Length = 289

 Score =  347 bits (890), Expect = 1e-93,   Method: Composition-based stats.
 Identities = 182/298 (61%), Positives = 225/298 (75%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL+DKNTKV+ QG TG  GTFH+EQA+ Y  TQ+VGG+ P KG T   G    +PVF 
Sbjct: 1   MSILIDKNTKVICQGFTGGQGTFHSEQALAY-GTQLVGGVSPNKGGTTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T A ASVIYVP  G  DAI+E+I+A I LIVCITEGIP  DM+ VK +L ++
Sbjct: 56  TVREAVEATGATASVIYVPAPGCKDAILEAIDAGIQLIVCITEGIPTEDMLVVKQKLNQT 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TPD CKIGIMP  I +KGS+GI+SRSGTLTYEAV QT+ EG GQST 
Sbjct: 116 GVRMIGPNCPGVITPDECKIGIMPAHIHKKGSIGIVSRSGTLTYEAVKQTTDEGYGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L+LF AD  T++IVM+GEIGGSAEEEAA ++K        KP+V
Sbjct: 176 VGIGGDPIPGSSFIDILKLFQADPETKAIVMIGEIGGSAEEEAAAYIKQN----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            ++AG TAP G+ MGHAGA+ISGGKG A++K  A++ AG+    S A IG++L E+LG
Sbjct: 232 SYIAGVTAPKGKRMGHAGAIISGGKGTADEKYAALEAAGVRTVRSLADIGKALREILG 289


>gi|90021747|ref|YP_527574.1| succinyl-CoA synthetase (ADP-forming) subunit alpha [Saccharophagus
           degradans 2-40]
 gi|89951347|gb|ABD81362.1| succinyl-CoA synthetase (ADP-forming) alpha subunit [Saccharophagus
           degradans 2-40]
          Length = 290

 Score =  347 bits (890), Expect = 1e-93,   Method: Composition-based stats.
 Identities = 170/298 (57%), Positives = 217/298 (72%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+TKVL QG TG  GTFH++QAI Y  TQ+VGG+ P KG     G    +PVF 
Sbjct: 1   MSVLINKDTKVLCQGFTGSQGTFHSQQAIEY-GTQMVGGVTPGKGGQTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           T+AEA E T A+ASVIYVP     D+I+E+  + + L+VCITEGIP LDM+  K + ++ 
Sbjct: 56  TMAEAVEATGADASVIYVPAPFCKDSILEAAHSGVKLVVCITEGIPTLDMLEAKVKCDEL 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             RLIGPNCPG++TP  CKIGIMPG I   G VGI+SRSGTLTYEAV QT+  G GQST 
Sbjct: 116 GVRLIGPNCPGVITPGECKIGIMPGHIHLPGKVGIVSRSGTLTYEAVKQTTDFGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+LE+F  DE TE+IVM+GEIGG+AEEEAA ++K        KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILEMFEKDEKTEAIVMIGEIGGTAEEEAAAYIKAN----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            ++AG TAP G+ MGHAGA+ISGGKG A++K  A+++AG+    S A IG +L E+ G
Sbjct: 232 SYIAGVTAPAGKRMGHAGAIISGGKGTADEKFAALEDAGVKTVRSLAEIGNALKEITG 289


>gi|302187416|ref|ZP_07264089.1| succinyl-CoA synthetase subunit alpha [Pseudomonas syringae pv.
           syringae 642]
          Length = 293

 Score =  347 bits (890), Expect = 1e-93,   Method: Composition-based stats.
 Identities = 172/298 (57%), Positives = 216/298 (72%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+TKV+ QG TG  GTFH+EQAI Y  T++VGG+ P KG T      +N+PVF 
Sbjct: 1   MSVLINKDTKVICQGFTGSQGTFHSEQAIAY-GTKMVGGVTPGKGGTTH----LNLPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T A ASVIYVP     D+I+E+    I LIVCITEGIP +DM+  K + ++ 
Sbjct: 56  TVKEAVETTGATASVIYVPAPFCKDSILEAAFGGIKLIVCITEGIPTIDMLEAKVKCDEL 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
              LIGPNCPG++TP  CKIGIMPG I   G VGI+SRSGTLTYEAV QT+  G GQST 
Sbjct: 116 GVVLIGPNCPGVITPGECKIGIMPGHIHLPGKVGIVSRSGTLTYEAVKQTTDAGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L+LF  D  TE+IVM+GEIGGSAEEEAA ++K        KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILKLFQEDPKTEAIVMIGEIGGSAEEEAAAYIKAH----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            ++AG TAPPG+ MGHAGA+ISGGKG A++K  A+++AG+    S A IG++L EL G
Sbjct: 232 SYIAGVTAPPGKRMGHAGAIISGGKGTADEKFAALQDAGVKTVRSLADIGKALAELTG 289


>gi|260772362|ref|ZP_05881278.1| succinyl-CoA ligase [ADP-forming] alpha chain [Vibrio metschnikovii
           CIP 69.14]
 gi|260611501|gb|EEX36704.1| succinyl-CoA ligase [ADP-forming] alpha chain [Vibrio metschnikovii
           CIP 69.14]
          Length = 290

 Score =  347 bits (890), Expect = 1e-93,   Method: Composition-based stats.
 Identities = 178/298 (59%), Positives = 223/298 (74%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+TKV+ QG TG  GTFH+EQA+ Y  TQ+VGG+ P KG     G    +PVF 
Sbjct: 1   MSVLINKDTKVICQGFTGGQGTFHSEQALAY-GTQMVGGVSPGKGGQTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T A A+VIYVP     DAI+E+I+A I LIV ITEGIP +DM+ VK +LE++
Sbjct: 56  TVREAVEATGATATVIYVPAPFCKDAILEAIDAGIELIVTITEGIPTIDMIDVKVKLEQT 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TPD CKIGIMPG I +KG VGI+SRSGTLTYEAV QT+ EG GQST 
Sbjct: 116 GVRMIGPNCPGVITPDECKIGIMPGHIHKKGKVGIVSRSGTLTYEAVKQTTDEGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L+LF  D  TE+IVM+GEIGG+AEEEAA F+K        KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILKLFQDDPETEAIVMIGEIGGTAEEEAAAFIKQH----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            ++AG TAPPG+ MGHAGA+ISGGKG AE+K  A++ AG+    S A IG++L E+ G
Sbjct: 232 SYIAGVTAPPGKRMGHAGAIISGGKGTAEEKFAALESAGVKTVKSLADIGQALREVTG 289


>gi|326794799|ref|YP_004312619.1| succinyl-CoA synthetase, subunit alpha [Marinomonas mediterranea
           MMB-1]
 gi|326545563|gb|ADZ90783.1| succinyl-CoA synthetase, alpha subunit [Marinomonas mediterranea
           MMB-1]
          Length = 290

 Score =  347 bits (890), Expect = 1e-93,   Method: Composition-based stats.
 Identities = 174/298 (58%), Positives = 211/298 (70%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL++K+TKV+ QG TG  GTFH+EQAI Y  TQ+VGG+ P KG     G    +PVF 
Sbjct: 1   MSILINKDTKVICQGFTGGQGTFHSEQAIAY-GTQMVGGVTPGKGGQTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T A ASVIYVP     D+I+E+  A I LIVCITEGIP LDM+  K + ++ 
Sbjct: 56  TVKEAVEETGAEASVIYVPAPFCKDSILEAANAGIKLIVCITEGIPTLDMLDCKVKCDEL 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             RLIGPNCPG++TP   KIGIMPG I   G VGI+SRSGTLTYEAV QT+  G GQST 
Sbjct: 116 GVRLIGPNCPGVITPGQSKIGIMPGHIHMPGKVGIVSRSGTLTYEAVKQTTDAGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+LE+F  D  TE+IVM+GEIGG+AEEEAA F+K        KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILEMFQNDPQTEAIVMIGEIGGTAEEEAAAFIKAN----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            ++AG TAP G+ MGHAGA+ISGGKG A +K  A+++AG+    S A IG  L EL G
Sbjct: 232 SYIAGVTAPAGKRMGHAGAIISGGKGTAAEKFAALEDAGVKTVRSLADIGAGLKELTG 289


>gi|192360780|ref|YP_001981995.1| succinyl-CoA synthetase subunit alpha [Cellvibrio japonicus
           Ueda107]
 gi|190686945|gb|ACE84623.1| succinyl-CoA synthetase alpha chain [Cellvibrio japonicus Ueda107]
          Length = 290

 Score =  347 bits (890), Expect = 1e-93,   Method: Composition-based stats.
 Identities = 172/298 (57%), Positives = 216/298 (72%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+TKV+ QG TG  GTFH+EQAI Y  T++VGG+ P KG     G    +PVF 
Sbjct: 1   MSVLINKDTKVICQGFTGSQGTFHSEQAIAY-GTKMVGGVTPGKGGQTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA + T A ASVIYVP     D+I+E+  A I LIVCITEGIP +DM+  K + ++ 
Sbjct: 56  TVKEAVDATGAEASVIYVPAPFCKDSILEAANAGIKLIVCITEGIPTMDMLDAKVKCDEL 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             RLIGPNCPG++TP  CKIGIMPG I + G VGI+SRSGTLTYEAV QT+  G GQST 
Sbjct: 116 GVRLIGPNCPGVITPGECKIGIMPGHIHKPGKVGIVSRSGTLTYEAVKQTTDYGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L+LF AD  TE+IVM+GEIGGSAEEEAA F+K        KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILKLFQADPQTEAIVMIGEIGGSAEEEAAAFIKAN----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            ++AG TAP G+ MGHAGA+ISGGKG A +K  A+++AG+    S A IG++L E+ G
Sbjct: 232 SYIAGVTAPAGKRMGHAGAIISGGKGTAAEKFAALEDAGVKTVKSLADIGKALKEITG 289


>gi|309751160|gb|ADO81144.1| Succinyl-CoA synthetase, alpha subunit [Haemophilus influenzae
           R2866]
          Length = 293

 Score =  347 bits (890), Expect = 1e-93,   Method: Composition-based stats.
 Identities = 183/299 (61%), Positives = 222/299 (74%), Gaps = 9/299 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           M+IL+DKNTKV+ QG TG  GTFH+EQA+ Y  TQ+VGG+ P KG T   G    +PVF 
Sbjct: 1   MAILIDKNTKVICQGFTGGQGTFHSEQALAY-GTQLVGGVSPNKGGTTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T A A+VIYVP S   DAIIE+I+A I LIVCITEGIP LDM++VK +L ++
Sbjct: 56  TVREAVENTGATATVIYVPASFCKDAIIEAIDAGIQLIVCITEGIPTLDMLKVKQKLNET 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
              +IGPNCPG++TPD CKIGIMP  I +KG VGI+SRSGTLTYEAV QT+ EG GQST 
Sbjct: 116 GVVMIGPNCPGVITPDECKIGIMPAHIHKKGKVGIVSRSGTLTYEAVKQTTDEGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+LE F  D  TE+IVM+GEIGGSAEEE A F+KD       KP+V
Sbjct: 176 VGIGGDPILGSSFIDILERFQQDPETEAIVMIGEIGGSAEEEVAIFIKDH----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
            ++AG TAP G+ MGHAGA+ISGGKG A +KI A++ AG+    S A IG +L +LL S
Sbjct: 232 AYIAGITAPKGKRMGHAGAIISGGKGTAVEKIAALEAAGVTCVKSLAEIGEALRKLLKS 290


>gi|218671347|ref|ZP_03521017.1| succinyl-CoA synthetase subunit alpha [Rhizobium etli GR56]
          Length = 300

 Score =  347 bits (890), Expect = 1e-93,   Method: Composition-based stats.
 Identities = 232/299 (77%), Positives = 271/299 (90%), Gaps = 1/299 (0%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTG-GNVNVPVF 59
           MSILV+K+TK+LVQGLTGK GTFHTEQA+ Y  TQ+VGGIHPKKG   WTG    ++P+F
Sbjct: 1   MSILVNKDTKILVQGLTGKTGTFHTEQALAYYGTQMVGGIHPKKGGETWTGAKGESLPIF 60

Query: 60  TTVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEK 119
            TVAE KE+T A+A+VIYVPP+GA DAIIE+I+AEIP I CITEGIPV+DMVRVKARL++
Sbjct: 61  ATVAEGKEKTGADATVIYVPPAGAADAIIEAIDAEIPFITCITEGIPVMDMVRVKARLDR 120

Query: 120 SSSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQST 179
           S SRL+GPNCPGI+TP+ CKIGIMPGSIFRKGSVGI+SRSGTLTYEAVFQTS EGLGQ+T
Sbjct: 121 SKSRLLGPNCPGIMTPEECKIGIMPGSIFRKGSVGIVSRSGTLTYEAVFQTSNEGLGQTT 180

Query: 180 AVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPI 239
           AVGIGGDPVKGTEFIDVLE+FLADEAT+SI+M+GEIGGSAEE+AAQFLKDEAK+GRKKP+
Sbjct: 181 AVGIGGDPVKGTEFIDVLEMFLADEATQSIIMIGEIGGSAEEDAAQFLKDEAKKGRKKPM 240

Query: 240 VGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            GF+AG+TAP GRTMGHAGAV+SGGKG AE KI AM+ AGI ++PSPAR+G++LVE+L 
Sbjct: 241 AGFIAGRTAPKGRTMGHAGAVVSGGKGDAESKIAAMESAGIRVSPSPARLGKTLVEVLK 299


>gi|254447449|ref|ZP_05060915.1| succinyl-CoA synthetase alpha chain [gamma proteobacterium
           HTCC5015]
 gi|198262792|gb|EDY87071.1| succinyl-CoA synthetase alpha chain [gamma proteobacterium
           HTCC5015]
          Length = 290

 Score =  347 bits (890), Expect = 1e-93,   Method: Composition-based stats.
 Identities = 180/298 (60%), Positives = 219/298 (73%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+LV+KNTKVL QG TGK GTFH+EQA+ Y  TQ+VGG+ P KG T   G    +PVF 
Sbjct: 1   MSVLVNKNTKVLCQGFTGKQGTFHSEQALEY-GTQMVGGVTPGKGGTEHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA  +T A ASVIYVP     D+IIE+ EA I L+VCITEGIP LDM+  K  +++ 
Sbjct: 56  TVKEAVAQTGATASVIYVPAPFCKDSIIEAAEAGIELVVCITEGIPTLDMLEAKMVVDQL 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             RLIGPNCPGI+TP  CKIGIMPG I + G VGI+SRSGTLTYEAV QTS  G GQST 
Sbjct: 116 GVRLIGPNCPGIITPGECKIGIMPGHIHKPGKVGIVSRSGTLTYEAVKQTSDLGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           +GIGGDP+ GT FID L+LF  D  TE+IVMVGEIGG+AEEEAA+F+K+       KP+V
Sbjct: 176 IGIGGDPIPGTGFIDALQLFQDDPQTEAIVMVGEIGGTAEEEAAEFIKEH----VDKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            ++AG TAP G+ MGHAGA+I+GGKG A DK  A++ AG+    SPA +G++L  L+G
Sbjct: 232 SYIAGVTAPKGKRMGHAGAIIAGGKGTAADKFAALQAAGVATVDSPADMGKALETLIG 289


>gi|16124593|ref|NP_419157.1| succinyl-CoA synthetase subunit alpha [Caulobacter crescentus CB15]
 gi|221233280|ref|YP_002515716.1| succinyl-CoA synthetase subunit alpha [Caulobacter crescentus
           NA1000]
 gi|13421487|gb|AAK22325.1| succinyl-CoA synthetase, alpha subunit [Caulobacter crescentus
           CB15]
 gi|220962452|gb|ACL93808.1| succinyl-CoA synthetase alpha chain [Caulobacter crescentus NA1000]
          Length = 294

 Score =  347 bits (890), Expect = 1e-93,   Method: Composition-based stats.
 Identities = 222/298 (74%), Positives = 260/298 (87%), Gaps = 5/298 (1%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L+  +TKV+ QG+TG  GTFHTEQAI Y  TQ+VGG+ P KG     G    +PVF 
Sbjct: 1   MSVLIGSHTKVICQGITGAQGTFHTEQAIAY-GTQMVGGVTPGKGGQTHIG----LPVFD 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TVAEAK+RT A+ASVIYVPP  A D+I+E+IEAEIPLIVCITEGIPVLDMV+VK  L+ S
Sbjct: 56  TVAEAKDRTGADASVIYVPPPFAADSILEAIEAEIPLIVCITEGIPVLDMVKVKKALQGS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            SRLIGPNCPG+LTP  CKIGIMPGSIF +GSVG++SRSGTLTYEAVFQT+  GLGQ+TA
Sbjct: 116 KSRLIGPNCPGVLTPKQCKIGIMPGSIFSEGSVGVVSRSGTLTYEAVFQTTNAGLGQTTA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPVKGTEFIDVLE+FLADEAT+SIVM+GEIGGSAEEEAAQFLKDEAKRGRKKP+V
Sbjct: 176 VGIGGDPVKGTEFIDVLEMFLADEATKSIVMIGEIGGSAEEEAAQFLKDEAKRGRKKPMV 235

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           GF+AG+TAPPGR MGHAGA++SGGKGGAEDKI AM++AGI ++PSPA++G +L+E+L 
Sbjct: 236 GFIAGRTAPPGRHMGHAGAIVSGGKGGAEDKIAAMEDAGIRVSPSPAKLGETLLEVLK 293


>gi|323947007|gb|EGB43021.1| succinate-CoA ligase [Escherichia coli H120]
          Length = 289

 Score =  347 bits (890), Expect = 1e-93,   Method: Composition-based stats.
 Identities = 172/298 (57%), Positives = 219/298 (73%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL+DKNTKV+ QG TG  GTFH+EQAI Y  T++VGG+ P KG T      +++PVF 
Sbjct: 1   MSILIDKNTKVICQGFTGSQGTFHSEQAIAY-GTKMVGGVTPGKGGTTH----LSLPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA   T A ASVIYVP     D+I+E+I+A I LI+ ITEGIP LDM+ VK +L+++
Sbjct: 56  TVREAVAATGATASVIYVPAPFCKDSILEAIDAGIKLIITITEGIPTLDMLTVKVKLDEA 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TP  CKIGI PG I + G VGI+SRSGTLTYEAV QT+  G GQST 
Sbjct: 116 GVRMIGPNCPGVITPGECKIGIQPGHIHKPGKVGIVSRSGTLTYEAVKQTTDYGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+LE+F  D  TE+IVM+GEIGGSAEEEAA ++K+       KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILEMFEKDPQTEAIVMIGEIGGSAEEEAAAYIKEH----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           G++AG TAP G+ MGHAGA+I+GGKG A++K  A++ AG+    S A IG +L  +L 
Sbjct: 232 GYIAGVTAPKGKRMGHAGAIIAGGKGTADEKFAALEAAGVKTVRSLADIGEALKTVLK 289


>gi|92399543|gb|ABE76513.1| mitochondrial putative GDP-forming succinate-CoA ligase alpha
           subunit [Toxoplasma gondii]
          Length = 333

 Score =  347 bits (890), Expect = 1e-93,   Method: Composition-based stats.
 Identities = 178/300 (59%), Positives = 226/300 (75%), Gaps = 6/300 (2%)

Query: 3   ILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGN--VNVPVFT 60
           + VDKNTKV+ QGLTGK G+FHTEQ + Y  TQ VGG++P K  + W   +   ++PVF 
Sbjct: 33  VFVDKNTKVICQGLTGKQGSFHTEQCLAY-GTQFVGGVNPSKKGSTWQSSDGKFSLPVFG 91

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRV-KARLEK 119
           TV EAKE T  +AS+I+VPP  A  AI++ I  EIPL VCITEGIP  DMVRV +A L +
Sbjct: 92  TVKEAKEATGCDASMIFVPPPFAAQAIMDCIAEEIPLAVCITEGIPQQDMVRVKQALLSQ 151

Query: 120 SSSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQST 179
           + +RLIGPNCPGI+ P  CKIGIMPG I  KG +G++SRSGTLTYEAV QT+Q GLGQST
Sbjct: 152 NKTRLIGPNCPGIIKPGECKIGIMPGYIHAKGKIGVVSRSGTLTYEAVNQTTQTGLGQST 211

Query: 180 AVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPI 239
            VGIGGDP  GT FID LE F+ D  T+ IV++GEIGGSAEEEAA +LK+  K   +KP+
Sbjct: 212 CVGIGGDPFNGTNFIDCLERFVNDPETKGIVLIGEIGGSAEEEAAAWLKEHNKE--QKPV 269

Query: 240 VGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
           V F+AG TAPPGR MGHAGA++SGGKG AE KI A+++AG+ +  +PA +G+ ++E++ +
Sbjct: 270 VSFIAGLTAPPGRRMGHAGAIVSGGKGTAEGKIAALEDAGVHVVRNPAAMGQKMLEVMQA 329


>gi|315497283|ref|YP_004086087.1| succinyl-CoA synthetase, alpha subunit [Asticcacaulis excentricus
           CB 48]
 gi|315415295|gb|ADU11936.1| succinyl-CoA synthetase, alpha subunit [Asticcacaulis excentricus
           CB 48]
          Length = 294

 Score =  347 bits (890), Expect = 1e-93,   Method: Composition-based stats.
 Identities = 216/298 (72%), Positives = 253/298 (84%), Gaps = 5/298 (1%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++  TKV+ QG TG  GTFH+EQAI Y  T+VVGG+ P KG T   G    +PVF 
Sbjct: 1   MSVLINSQTKVITQGFTGAQGTFHSEQAIAY-GTKVVGGVTPGKGGTTHIG----LPVFD 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           +VAEAKERT A+AS IYVPP  A DAI+E+IEAEIPLIVCITEGIPVLDMV+VK  L  S
Sbjct: 56  SVAEAKERTGADASAIYVPPPFAADAILEAIEAEIPLIVCITEGIPVLDMVKVKRALSGS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            SRLIGPNCPG+LTP+ CKIGIMPG+IF KGSVG++SRSGTLTYEAVFQT+  GLGQ+TA
Sbjct: 116 KSRLIGPNCPGVLTPNECKIGIMPGNIFSKGSVGVVSRSGTLTYEAVFQTTNAGLGQTTA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPVKGTEFIDVLE+FLAD+ T+SI+M+GEIGGSAEE+AAQFL DEAKRGRKKP+ 
Sbjct: 176 VGIGGDPVKGTEFIDVLEMFLADDETKSIIMIGEIGGSAEEDAAQFLIDEAKRGRKKPMA 235

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           GF+AG+TAPPGR MGHAGA+ISGGKGGAEDKI AM+ AGI ++PSPA +G +L+ +L 
Sbjct: 236 GFIAGRTAPPGRRMGHAGAIISGGKGGAEDKIAAMEAAGIKVSPSPAALGETLLSVLK 293


>gi|167624408|ref|YP_001674702.1| succinyl-CoA synthetase subunit alpha [Shewanella halifaxensis
           HAW-EB4]
 gi|167354430|gb|ABZ77043.1| succinyl-CoA synthetase, alpha subunit [Shewanella halifaxensis
           HAW-EB4]
          Length = 290

 Score =  347 bits (889), Expect = 1e-93,   Method: Composition-based stats.
 Identities = 177/294 (60%), Positives = 220/294 (74%), Gaps = 9/294 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+TKV+ QG TG  GTFH+EQAI Y  TQ+VGG+ P KG     G    +PVF 
Sbjct: 1   MSVLINKDTKVICQGFTGGQGTFHSEQAIAY-GTQMVGGVSPGKGGQTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV +A E T A ASVIYVP     DAI+E+I+  I LIVCITEGIP LDM++VK +LE++
Sbjct: 56  TVKDAVEVTGATASVIYVPAPFCKDAILEAIDGGIELIVCITEGIPTLDMLQVKVKLEET 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TP  CKIGIMPG I + G VGI+SRSGTLTYEAV QT+ EG GQST 
Sbjct: 116 GVRMIGPNCPGVITPGECKIGIMPGHIHKPGKVGIVSRSGTLTYEAVKQTTDEGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ GT FIDVLE+F  D  TE+IVM+GEIGG+AEEEAA+++K        KP+V
Sbjct: 176 VGIGGDPIPGTNFIDVLEMFQNDPLTEAIVMIGEIGGTAEEEAAEYIKAN----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLV 294
            ++AG TAP G+ MGHAGA+I+GGKG AEDK  A++EAG+    S A IG++L 
Sbjct: 232 SYIAGVTAPEGKRMGHAGAIIAGGKGTAEDKFAALEEAGVTTVRSLADIGKALR 285


>gi|90580057|ref|ZP_01235865.1| succinyl-CoA synthetase alpha subunit [Vibrio angustum S14]
 gi|90438942|gb|EAS64125.1| succinyl-CoA synthetase alpha subunit [Vibrio angustum S14]
          Length = 290

 Score =  347 bits (889), Expect = 1e-93,   Method: Composition-based stats.
 Identities = 181/296 (61%), Positives = 225/296 (76%), Gaps = 9/296 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+TKV+ QG TG  GTFH+EQAI Y  TQ+VGG+ P KG T   G    +PVF 
Sbjct: 1   MSVLINKDTKVICQGFTGGQGTFHSEQAIEY-GTQMVGGVSPGKGGTTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T A A+VIYVP     DAI+E+I+A I LIV ITEGIP LDM+ VK RL+++
Sbjct: 56  TVREAVEVTGATATVIYVPAPFCKDAILEAIDAGIELIVTITEGIPTLDMLDVKVRLDEA 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TPD CKIGIMPG I + G VGI+SRSGTLTYEAV QT+ EG GQST 
Sbjct: 116 GVRMIGPNCPGVITPDECKIGIMPGHIHKAGKVGIVSRSGTLTYEAVKQTTDEGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+LE+F  D ATE+IVM+GEIGG+AEEEAA ++K+       KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILEMFEKDPATEAIVMIGEIGGTAEEEAAAYIKEN----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVEL 296
            ++AG TAPPG+ MGHAGA+ISGGKG AEDK  A++EAG+    S A IG++L E+
Sbjct: 232 SYIAGVTAPPGKRMGHAGAIISGGKGTAEDKFAALEEAGVKTVKSLADIGKALREV 287


>gi|239833052|ref|ZP_04681381.1| succinyl-CoA synthetase, alpha subunit [Ochrobactrum intermedium
           LMG 3301]
 gi|239825319|gb|EEQ96887.1| succinyl-CoA synthetase, alpha subunit [Ochrobactrum intermedium
           LMG 3301]
          Length = 300

 Score =  347 bits (889), Expect = 1e-93,   Method: Composition-based stats.
 Identities = 238/299 (79%), Positives = 272/299 (90%), Gaps = 1/299 (0%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTG-GNVNVPVF 59
           MSILV+K+TKVLVQGLTGK GTFHTEQA+ Y  TQ+VGGIHPKKG   W G     +P+F
Sbjct: 1   MSILVNKDTKVLVQGLTGKTGTFHTEQALAYYGTQMVGGIHPKKGGETWEGAKGEKLPIF 60

Query: 60  TTVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEK 119
            TVAEAKERT A+ASVIYVPP+GA DAIIE+IEAEIP IVCITEGIPV+DMVRVK RLE+
Sbjct: 61  ATVAEAKERTGADASVIYVPPAGAADAIIEAIEAEIPFIVCITEGIPVMDMVRVKERLER 120

Query: 120 SSSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQST 179
           S SRL+GPNCPGILTP+ CKIGIMPG+IF+KGSVG++SRSGTLTYEAVFQTS EGLGQ+T
Sbjct: 121 SKSRLLGPNCPGILTPEECKIGIMPGNIFKKGSVGVVSRSGTLTYEAVFQTSNEGLGQTT 180

Query: 180 AVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPI 239
           AVGIGGDPVKGTEFIDVLE+FLAD+ T+SIVM+GEIGGSAEE+AAQFLKDEAKRGRKKP+
Sbjct: 181 AVGIGGDPVKGTEFIDVLEMFLADDETKSIVMIGEIGGSAEEDAAQFLKDEAKRGRKKPM 240

Query: 240 VGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           VGF+AG+TAP GRTMGHAGAVISGGKGGAEDKI AM+ AGI ++PSPA++G++LVE+L 
Sbjct: 241 VGFIAGRTAPAGRTMGHAGAVISGGKGGAEDKIAAMESAGIRVSPSPAQLGKTLVEVLK 299


>gi|119503181|ref|ZP_01625265.1| Succinyl-CoA synthetase, alpha subunit [marine gamma
           proteobacterium HTCC2080]
 gi|119460827|gb|EAW41918.1| Succinyl-CoA synthetase, alpha subunit [marine gamma
           proteobacterium HTCC2080]
          Length = 290

 Score =  347 bits (889), Expect = 1e-93,   Method: Composition-based stats.
 Identities = 174/298 (58%), Positives = 221/298 (74%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL+D+NTKV+ QG TG  GTFH+EQAI Y  TQ+VGG+ P KG        +++PVF 
Sbjct: 1   MSILIDQNTKVICQGFTGSQGTFHSEQAIAY-GTQMVGGVTPGKGGQTH----LDLPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA ++T A+ASVIYVP +   D+I+E+  A I LIVCITEGIP LDM+  K + ++ 
Sbjct: 56  TVDEAVDQTGADASVIYVPAAFCKDSILEAANAGIQLIVCITEGIPTLDMLECKVKCDEL 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             RLIGPNCPG++TP +CKIGIMPG I   G VGI+SRSGTLTYEAV QT+  G GQST 
Sbjct: 116 GVRLIGPNCPGVITPGACKIGIMPGHIHLPGRVGIVSRSGTLTYEAVKQTTDAGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L LF AD +TE+IVM+GEIGG+AEEEAA F+KD       KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILTLFEADPSTEAIVMIGEIGGTAEEEAAAFIKDN----VSKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            ++AG TAP G+ MGHAGA+ISGGKG A++K  A+++AG+    S A IG ++ +L G
Sbjct: 232 SYIAGVTAPKGKRMGHAGAIISGGKGTADEKFAALEDAGVRTVRSLADIGAAMADLTG 289


>gi|294676278|ref|YP_003576893.1| succinyl-CoA synthetase (ADP-forming) subunit alpha [Rhodobacter
           capsulatus SB 1003]
 gi|294475098|gb|ADE84486.1| succinyl-CoA synthetase (ADP-forming), alpha subunit [Rhodobacter
           capsulatus SB 1003]
          Length = 294

 Score =  347 bits (889), Expect = 2e-93,   Method: Composition-based stats.
 Identities = 195/298 (65%), Positives = 242/298 (81%), Gaps = 5/298 (1%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           M++LV+++TKV+ QG TG  GTFH+EQAI Y  T++VGG+ P KG +   G    +PVF 
Sbjct: 1   MAVLVNEHTKVICQGFTGSQGTFHSEQAIAY-GTKMVGGVTPGKGGSEHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           +V EAK  T A+A+ IYVPP  A D+I+E+I+AE+ LIVCITEGIPVLDM+RVK  L  S
Sbjct: 56  SVHEAKHVTGAHATAIYVPPPFAADSILEAIDAEMELIVCITEGIPVLDMMRVKRALIDS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            SRLIGPNCPG++TPD+CKIGIMPGSIF++GSVG++SRSGTLTYEAV QT+  GLGQS+A
Sbjct: 116 KSRLIGPNCPGVMTPDACKIGIMPGSIFKRGSVGVVSRSGTLTYEAVKQTTDVGLGQSSA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+KGTE IDVLE+FLAD  T SI+M+GEIGGSAEEEAA+FL  E K+GR KP  
Sbjct: 176 VGIGGDPIKGTEHIDVLEMFLADPETTSIIMIGEIGGSAEEEAAEFLMAEKKKGRWKPTA 235

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           GF+AG+TAPPGR MGHAGA++SGGKG AE KI AMK AGI +A SPA +G ++++ + 
Sbjct: 236 GFIAGRTAPPGRRMGHAGAIVSGGKGDAESKIEAMKRAGIVVADSPAHLGEAVLKAIK 293


>gi|307293436|ref|ZP_07573282.1| succinyl-CoA synthetase, alpha subunit [Sphingobium
           chlorophenolicum L-1]
 gi|306881502|gb|EFN12718.1| succinyl-CoA synthetase, alpha subunit [Sphingobium
           chlorophenolicum L-1]
          Length = 294

 Score =  347 bits (889), Expect = 2e-93,   Method: Composition-based stats.
 Identities = 212/298 (71%), Positives = 250/298 (83%), Gaps = 5/298 (1%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSILV+KNTKV+ QG+TG  GTFHTE A+ Y  TQ+VGG+ P KG T   G    +P+F 
Sbjct: 1   MSILVNKNTKVITQGMTGATGTFHTETALAY-GTQMVGGVTPGKGGTSHIG----LPMFD 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TVAEAK +T A+ASVIYVPP  A D+I+E+I+AEIPLIVCITEGIPVLDMV+VK  L  S
Sbjct: 56  TVAEAKSKTGADASVIYVPPPFAADSILEAIDAEIPLIVCITEGIPVLDMVKVKRSLSGS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            SRLIGPNCPG+LTP  CKIGIMPG+IF KGSVG++SRSGTLTYEAVFQT+  GLGQ+TA
Sbjct: 116 KSRLIGPNCPGLLTPGECKIGIMPGNIFSKGSVGVVSRSGTLTYEAVFQTTNAGLGQTTA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPV GT FIDVLELFLAD+ATESI+M+GEIGG AEE+AAQFL DEAK+GRKKP+ 
Sbjct: 176 VGIGGDPVNGTNFIDVLELFLADDATESIIMIGEIGGDAEEQAAQFLIDEAKKGRKKPMA 235

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           GF+AG+TAPPGR MGHAGA++SGGKG AE KI AM+ AGI +A SP+ +G +L+E+L 
Sbjct: 236 GFIAGRTAPPGRRMGHAGAIVSGGKGDAESKIAAMEAAGIKVAASPSELGTTLLEVLK 293


>gi|295691152|ref|YP_003594845.1| succinyl-CoA synthetase subunit alpha [Caulobacter segnis ATCC
           21756]
 gi|295433055|gb|ADG12227.1| succinyl-CoA synthetase, alpha subunit [Caulobacter segnis ATCC
           21756]
          Length = 294

 Score =  347 bits (889), Expect = 2e-93,   Method: Composition-based stats.
 Identities = 220/298 (73%), Positives = 258/298 (86%), Gaps = 5/298 (1%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L+  +TKV+ QG+TG  GTFH+EQAI Y  T++VGG+ P KG     G    +PVF 
Sbjct: 1   MSVLIGSHTKVICQGITGAQGTFHSEQAIAY-GTKMVGGVTPGKGGQTHIG----LPVFD 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EAKE T A+ASVIYVPP  A D+I+E+IEAEIPLIVCITEGIPVLDMV+VK  L+ S
Sbjct: 56  TVIEAKEATGADASVIYVPPPFAADSILEAIEAEIPLIVCITEGIPVLDMVKVKKALQGS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            SRLIGPNCPG+LTP  CKIGIMPGSIF KGSVG++SRSGTLTYEAVFQT+  GLGQ+TA
Sbjct: 116 RSRLIGPNCPGVLTPGECKIGIMPGSIFSKGSVGVVSRSGTLTYEAVFQTTNAGLGQTTA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPVKGTEFIDVLE+FLADEAT+SIVM+GEIGGSAEEEAAQFLKDEAKRGRKKP+V
Sbjct: 176 VGIGGDPVKGTEFIDVLEMFLADEATKSIVMIGEIGGSAEEEAAQFLKDEAKRGRKKPMV 235

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           GF+AG+TAPPGR MGHAGA++SGGKGGAEDKI AM++AGI ++PSPA++G +L+E+L 
Sbjct: 236 GFIAGRTAPPGRHMGHAGAIVSGGKGGAEDKIAAMEDAGIRVSPSPAKLGETLLEVLK 293


>gi|229586710|ref|YP_002845211.1| succinyl-CoA synthetase subunit alpha [Rickettsia africae ESF-5]
 gi|228021760|gb|ACP53468.1| Succinyl-CoA synthetase alpha chain [Rickettsia africae ESF-5]
          Length = 291

 Score =  347 bits (889), Expect = 2e-93,   Method: Composition-based stats.
 Identities = 178/298 (59%), Positives = 232/298 (77%), Gaps = 8/298 (2%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           M+IL++K T+V+ QG TG  GTFH+EQAI Y  T +VGG+ P KG        +++PV+ 
Sbjct: 1   MAILINKKTQVICQGFTGLQGTFHSEQAIAY-GTNMVGGVTPGKGGHTH----LDLPVYN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EAK +T ANASVIYVPP  A D+I+E+I+AEI ++VCITEGIPVLDM++VK  L  S
Sbjct: 56  TVHEAKAKTGANASVIYVPPGFAADSILEAIDAEIEVVVCITEGIPVLDMLKVKRALVGS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            +RLIGPNCPG++TP  CKIGIMPG I ++G++GI+SRSGTLTYEAV QT+  GLGQST 
Sbjct: 116 KTRLIGPNCPGVITPGECKIGIMPGHIHKRGTIGIVSRSGTLTYEAVAQTTAVGLGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPV GT F+D +E+FL D+ T++I+M+GEIGG+AEE+AA+F+K       KKPIV
Sbjct: 176 VGIGGDPVNGTNFVDCIEMFLKDDETKAIIMIGEIGGNAEEDAAEFIKQ---SKIKKPIV 232

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            F+AG TAPPG+ MGHAGA+I G  G AEDK+ A++ AG+ I  SPA IG+++++LL 
Sbjct: 233 SFIAGITAPPGKRMGHAGAIIVGRTGSAEDKLEALQSAGVIITRSPADIGKTMLDLLN 290


>gi|261343501|ref|ZP_05971146.1| succinyl-CoA synthetase subunit alpha [Providencia rustigianii DSM
           4541]
 gi|282568647|gb|EFB74182.1| succinyl-CoA synthetase subunit alpha [Providencia rustigianii DSM
           4541]
          Length = 290

 Score =  347 bits (889), Expect = 2e-93,   Method: Composition-based stats.
 Identities = 173/299 (57%), Positives = 219/299 (73%), Gaps = 9/299 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL+DKNTKV+ QG TG  GTFH+EQAI Y  T++VGG+ P KG T   G    +PVF 
Sbjct: 1   MSILIDKNTKVICQGFTGGQGTFHSEQAIAY-GTKMVGGVTPGKGGTTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T A ASVIYVP     D+I+E+I+A I LI+ ITEGIP LDM+ VK +L+++
Sbjct: 56  TVREAVEATGATASVIYVPAPFCKDSILEAIDAGIKLIITITEGIPTLDMLTVKVKLDEA 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TP  CKIGI PG I   G VGI+SRSGTLTYEAV QT+  GLGQST 
Sbjct: 116 GVRMIGPNCPGVITPGQCKIGIQPGHIHMPGKVGIVSRSGTLTYEAVKQTTDAGLGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L+LF  D  TE+IVM+GEIGG+AEE+AA ++K+       KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILKLFQEDPQTEAIVMIGEIGGNAEEDAAAYIKEH----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
           G++AG TAP G+ MGHAGA+I+GGKG A++K  A++ AG+    S A IG ++  LL  
Sbjct: 232 GYIAGVTAPKGKRMGHAGAIIAGGKGTADEKFAALEAAGVKTVRSLADIGDAVKSLLNK 290


>gi|220933989|ref|YP_002512888.1| succinyl-CoA synthetase, alpha subunit [Thioalkalivibrio sp.
           HL-EbGR7]
 gi|219995299|gb|ACL71901.1| succinyl-CoA synthetase, alpha subunit [Thioalkalivibrio sp.
           HL-EbGR7]
          Length = 288

 Score =  347 bits (889), Expect = 2e-93,   Method: Composition-based stats.
 Identities = 176/297 (59%), Positives = 221/297 (74%), Gaps = 9/297 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL+DK+T+V+ QG TGK GTFH+EQAI Y  T++VGG+ P KG        +++PVF 
Sbjct: 1   MSILIDKDTRVICQGFTGKQGTFHSEQAIAY-GTRMVGGVTPGKGGQKH----LDLPVFD 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV +A   T A A++IYVP   A DAI+E+++A I +IVCITEGIPVLDM+RVKA L  S
Sbjct: 56  TVHDAVRDTGAEATMIYVPAPFAADAILEAMDAGIQVIVCITEGIPVLDMLRVKAALAHS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            +RLIGPNCPG++TP  CKIGIMPG I + G VGI+SRSGTLTYEAV QT+  GLGQST 
Sbjct: 116 DARLIGPNCPGVITPGGCKIGIMPGHIHQPGRVGIVSRSGTLTYEAVKQTTDAGLGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP++G  F+D L LF AD  TE I++VGEIGG+AEEEAA ++K        KP+V
Sbjct: 176 VGIGGDPIQGMNFVDCLALFQADPQTEGIILVGEIGGTAEEEAAAYIKAH----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELL 297
            ++AG TAPPGR MGHAGA+ISGG+G AE K  A++ AG+ +  SPA +G  +  LL
Sbjct: 232 AYIAGVTAPPGRRMGHAGAIISGGQGTAEQKFAALEAAGVSVVRSPAEMGERMKTLL 288


>gi|116254168|ref|YP_770006.1| succinyl-CoA synthetase subunit alpha [Rhizobium leguminosarum bv.
           viciae 3841]
 gi|115258816|emb|CAK09922.1| putative succinyl-CoA synthetase alpha chain [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 300

 Score =  347 bits (889), Expect = 2e-93,   Method: Composition-based stats.
 Identities = 234/299 (78%), Positives = 271/299 (90%), Gaps = 1/299 (0%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTG-GNVNVPVF 59
           MSILV+K+TKVLVQGLTGK GTFHTEQA+ Y  TQ+VGGIHPKKG   WTG    ++P+F
Sbjct: 1   MSILVNKDTKVLVQGLTGKTGTFHTEQALAYYGTQMVGGIHPKKGGETWTGAKGESLPIF 60

Query: 60  TTVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEK 119
            TVAE KE+T ANA+VIYVPP+GA DAIIE+I+AEIP I CITEGIPV+DMVRVKARL++
Sbjct: 61  ATVAEGKEKTGANATVIYVPPAGAADAIIEAIDAEIPFITCITEGIPVMDMVRVKARLDR 120

Query: 120 SSSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQST 179
           S SRL+GPNCPGILTP+ CKIGIMPGSIFRKGSVGI+SRSGTLTYEAVFQTS EGLGQ+T
Sbjct: 121 SKSRLLGPNCPGILTPEECKIGIMPGSIFRKGSVGIVSRSGTLTYEAVFQTSNEGLGQTT 180

Query: 180 AVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPI 239
           AVGIGGDPVKGTEFIDVLE+FLADEAT+SI+M+GEIGG+AEE+AAQFLKDEAK+GRKKP+
Sbjct: 181 AVGIGGDPVKGTEFIDVLEMFLADEATQSIIMIGEIGGAAEEDAAQFLKDEAKKGRKKPM 240

Query: 240 VGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            GF+AG+TAP GRTMGHAGAV+SGGKG AE KI AM+ AGI ++PSPAR+G++LVE+L 
Sbjct: 241 AGFIAGRTAPKGRTMGHAGAVVSGGKGDAESKIAAMESAGIKVSPSPARLGKTLVEVLK 299


>gi|294012419|ref|YP_003545879.1| succinyl-CoA synthetase alpha chain [Sphingobium japonicum UT26S]
 gi|292675749|dbj|BAI97267.1| succinyl-CoA synthetase alpha chain [Sphingobium japonicum UT26S]
          Length = 294

 Score =  347 bits (889), Expect = 2e-93,   Method: Composition-based stats.
 Identities = 213/298 (71%), Positives = 250/298 (83%), Gaps = 5/298 (1%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSILV+KNTKV+ QG+TG  GTFHTE A+ Y  TQ+VGG+ P KG T   G    +P+F 
Sbjct: 1   MSILVNKNTKVITQGMTGATGTFHTETALAY-GTQMVGGVTPGKGGTTHIG----LPMFD 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TVAEAK +T A+ASVIYVPP  A D+I+E+I+AEIPLIVCITEGIPVLDMV+VK  L  S
Sbjct: 56  TVAEAKAKTGADASVIYVPPPFAADSILEAIDAEIPLIVCITEGIPVLDMVKVKRALSGS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            SRLIGPNCPG+LTP  CKIGIMPG+IF KGSVG++SRSGTLTYEAVFQTS  GLGQ+TA
Sbjct: 116 KSRLIGPNCPGLLTPGECKIGIMPGNIFSKGSVGVVSRSGTLTYEAVFQTSNAGLGQTTA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPV GT FIDVLELFLAD+ATESI+M+GEIGG AEE+AAQFL DEAK+GRKKP+ 
Sbjct: 176 VGIGGDPVNGTNFIDVLELFLADDATESIIMIGEIGGDAEEQAAQFLIDEAKKGRKKPMA 235

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           GF+AG+TAPPGR MGHAGA++SGGKG AE KI AM+ AGI +A SP+ +G +L+E+L 
Sbjct: 236 GFIAGRTAPPGRRMGHAGAIVSGGKGDAESKIAAMEAAGIKVAASPSELGTTLLEVLK 293


>gi|319776561|ref|YP_004139049.1| succinyl-CoA synthetase subunit alpha [Haemophilus influenzae
           F3047]
 gi|317451152|emb|CBY87385.1| succinyl-CoA synthetase alpha chain [Haemophilus influenzae F3047]
          Length = 293

 Score =  347 bits (889), Expect = 2e-93,   Method: Composition-based stats.
 Identities = 183/299 (61%), Positives = 222/299 (74%), Gaps = 9/299 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           M+IL+DKNTKV+ QG TG  GTFH+EQA+ Y  TQ+VGG+ P KG T   G    +PVF 
Sbjct: 1   MAILIDKNTKVICQGFTGGQGTFHSEQALAY-GTQLVGGVSPNKGGTTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T A A+VIYVP S   DAIIE+I+A   LIVCITEGIP LDM++VK +L ++
Sbjct: 56  TVREAVENTGATATVIYVPASFCKDAIIEAIDAGTQLIVCITEGIPTLDMLKVKQKLNET 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
              +IGPNCPG++TPD CKIGIMP  I +KG VGI+SRSGTLTYEAV QT+ EG GQST 
Sbjct: 116 GVVMIGPNCPGVITPDECKIGIMPAHIHKKGKVGIVSRSGTLTYEAVKQTTDEGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+LE F  D  TE+IVM+GEIGGSAEEEAA F+KD       KP+V
Sbjct: 176 VGIGGDPILGSSFIDILERFQQDPETEAIVMIGEIGGSAEEEAAIFIKDH----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
            ++AG TAP G+ MGHAGA+ISGGKG A +KI A++ AG+    S A IG +L +LL S
Sbjct: 232 AYIAGITAPKGKRMGHAGAIISGGKGTAVEKIAALEAAGVTCVKSLAEIGEALRKLLKS 290


>gi|170740404|ref|YP_001769059.1| succinyl-CoA synthetase subunit alpha [Methylobacterium sp. 4-46]
 gi|168194678|gb|ACA16625.1| succinyl-CoA synthetase, alpha subunit [Methylobacterium sp. 4-46]
          Length = 294

 Score =  347 bits (889), Expect = 2e-93,   Method: Composition-based stats.
 Identities = 224/298 (75%), Positives = 258/298 (86%), Gaps = 5/298 (1%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL+DKNTKV+ QG TGK GTFH+EQAI Y  T++VGG  P KG +   G    +PVF 
Sbjct: 1   MSILIDKNTKVICQGFTGKNGTFHSEQAIAY-GTKMVGGTSPGKGGSTHLG----LPVFD 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA+E T A+ASV+YVPP GA DAI E+I+AEIPLIVCITEGIPVLDMVRVK  LE S
Sbjct: 56  TVQEAREATGADASVVYVPPPGAADAICEAIQAEIPLIVCITEGIPVLDMVRVKRALEGS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            SRL+GPNCPGI+T    KIGIMP +IF+ GSVGI+SRSGTLTYEAVFQTS EGLGQ+TA
Sbjct: 116 KSRLVGPNCPGIVTAGESKIGIMPANIFKPGSVGIVSRSGTLTYEAVFQTSNEGLGQTTA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPVKGTEFID+LELFLADE TESIVM+GEIGGSAEEEAAQF++DEAKRGRKKP+V
Sbjct: 176 VGIGGDPVKGTEFIDMLELFLADEKTESIVMIGEIGGSAEEEAAQFIRDEAKRGRKKPMV 235

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           GF+AG+TAPPGR MGHAGA+ISGGKGGAEDKI AM+EAGI ++PSPAR+G++LV++L 
Sbjct: 236 GFIAGRTAPPGRRMGHAGAIISGGKGGAEDKIAAMEEAGIRVSPSPARLGKTLVDVLK 293


>gi|49476304|ref|YP_034345.1| succinyl-CoA synthetase subunit alpha [Bartonella henselae str.
           Houston-1]
 gi|49239112|emb|CAF28416.1| Succinyl-CoA synthetase alpha chain [Bartonella henselae str.
           Houston-1]
          Length = 300

 Score =  347 bits (889), Expect = 2e-93,   Method: Composition-based stats.
 Identities = 231/299 (77%), Positives = 271/299 (90%), Gaps = 1/299 (0%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTG-GNVNVPVF 59
           MSILV+K+TKVLVQGLTGK GTFHTEQA+ Y  TQ+VGG++PKKG   W G     +P+F
Sbjct: 1   MSILVNKDTKVLVQGLTGKTGTFHTEQALAYHGTQMVGGVNPKKGGETWEGSKGETLPIF 60

Query: 60  TTVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEK 119
            +VAE KE+T A+ASVIYVPP+GA  AIIE++EAEI LI+CITEGIPV+DMV+VKARLEK
Sbjct: 61  ASVAEGKEKTGADASVIYVPPAGAAAAIIEAVEAEIRLIICITEGIPVMDMVKVKARLEK 120

Query: 120 SSSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQST 179
           S SRLIGPNCPGILTP+ CKIGIMPGSIFRKGSVG++SRSGTLTYEAVFQTS EGLGQ+T
Sbjct: 121 SKSRLIGPNCPGILTPNECKIGIMPGSIFRKGSVGVVSRSGTLTYEAVFQTSHEGLGQTT 180

Query: 180 AVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPI 239
           A+GIGGDPVKGTEFIDVLE+FLAD+ T+SIVM+GEIGGSAEEEAAQFL+DEAK+GRKKP+
Sbjct: 181 AIGIGGDPVKGTEFIDVLEMFLADDETQSIVMIGEIGGSAEEEAAQFLQDEAKKGRKKPV 240

Query: 240 VGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           VGF+AG+TAPPGRTMGHAGAVISGGKGGAEDKI AM+ AGI ++PSP++IG++L+ +L 
Sbjct: 241 VGFIAGRTAPPGRTMGHAGAVISGGKGGAEDKIAAMESAGIKVSPSPSQIGKTLMSVLK 299


>gi|260776536|ref|ZP_05885431.1| succinyl-CoA ligase [ADP-forming] alpha chain [Vibrio
           coralliilyticus ATCC BAA-450]
 gi|323495097|ref|ZP_08100184.1| succinyl-CoA synthetase subunit alpha [Vibrio brasiliensis LMG
           20546]
 gi|260607759|gb|EEX34024.1| succinyl-CoA ligase [ADP-forming] alpha chain [Vibrio
           coralliilyticus ATCC BAA-450]
 gi|323310648|gb|EGA63825.1| succinyl-CoA synthetase subunit alpha [Vibrio brasiliensis LMG
           20546]
          Length = 290

 Score =  347 bits (889), Expect = 2e-93,   Method: Composition-based stats.
 Identities = 180/298 (60%), Positives = 222/298 (74%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+TKV+ QG TG  GTFH+EQAI Y  TQ+VGG+ P KG     G    +PVF 
Sbjct: 1   MSVLINKDTKVICQGFTGGQGTFHSEQAIAY-GTQMVGGVSPGKGGQTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T A A+VIYVP     DAI+E+I+A I LIV ITEGIP  DM+ VK +LE++
Sbjct: 56  TVREAVEATGATATVIYVPAPFCKDAILEAIDAGIELIVTITEGIPTTDMIDVKVKLEET 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TPD CKIGIMPG I +KG VGI+SRSGTLTYEAV QT+ EG GQST 
Sbjct: 116 GVRMIGPNCPGLITPDECKIGIMPGHIHKKGKVGIVSRSGTLTYEAVKQTTDEGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L+LF  D  TE+IVM+GEIGG+AEEEAA F+K+       KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILKLFQEDPETEAIVMIGEIGGTAEEEAAAFIKEN----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            ++AG TAPPG+ MGHAGA+ISGGKG AEDK  A++ AG+    S A IG+ L E+ G
Sbjct: 232 SYIAGVTAPPGKRMGHAGAIISGGKGTAEDKFAALEAAGVKTVKSLADIGKGLREVTG 289


>gi|212635733|ref|YP_002312258.1| succinyl-CoA ligase subunit alpha [Shewanella piezotolerans WP3]
 gi|212557217|gb|ACJ29671.1| Succinyl-CoA ligase, alpha subunit [Shewanella piezotolerans WP3]
          Length = 290

 Score =  347 bits (889), Expect = 2e-93,   Method: Composition-based stats.
 Identities = 174/294 (59%), Positives = 219/294 (74%), Gaps = 9/294 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+TKV+ QG TG  GTFH+EQAI Y  TQ+VGG+ P KG     G    +PVF 
Sbjct: 1   MSVLINKDTKVICQGFTGGQGTFHSEQAIAY-GTQMVGGVSPGKGGQVHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV +A   T A A+VIYVP     DAI+E+I+  I LIVCITEGIP LDM++VK +LE++
Sbjct: 56  TVKDAVAETGATATVIYVPAPFCKDAILEAIDGGIELIVCITEGIPTLDMLQVKVKLEET 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
           + R+IGPNCPG++TP  CKIGIMPG I + G VGI+SRSGTLTYEAV QT+ EG GQST 
Sbjct: 116 NVRMIGPNCPGVITPGECKIGIMPGHIHKPGKVGIVSRSGTLTYEAVKQTTDEGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ GT FIDVLE+F  D  TE+IVM+GEIGG+AEEEAA+++K        KP+V
Sbjct: 176 VGIGGDPIPGTNFIDVLEMFQNDPQTEAIVMIGEIGGTAEEEAAEYIKAN----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLV 294
            ++AG TAP G+ MGHAGA+I+GGKG AEDK  A++ AG+    S A IG++L 
Sbjct: 232 SYIAGVTAPEGKRMGHAGAIIAGGKGTAEDKFAALEAAGVTTVRSLADIGKALR 285


>gi|104782657|ref|YP_609155.1| succinyl-CoA synthetase subunit alpha [Pseudomonas entomophila L48]
 gi|95111644|emb|CAK16365.1| succinyl-CoA synthetase alpha chain [Pseudomonas entomophila L48]
          Length = 294

 Score =  347 bits (889), Expect = 2e-93,   Method: Composition-based stats.
 Identities = 172/298 (57%), Positives = 215/298 (72%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+TKV+ QG TG  GTFH+EQAI Y  T++VGG+ P KG T   G    +PVF 
Sbjct: 1   MSVLINKDTKVICQGFTGSQGTFHSEQAIAY-GTKMVGGVTPGKGGTTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T A+ASVIYVP     D+I+E+    I LIVCITEGIP LDM+  K + ++ 
Sbjct: 56  TVKEAVEATGADASVIYVPAPFCKDSILEAAFGGIKLIVCITEGIPTLDMLDAKVKCDEL 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
              LIGPNCPG++TP  CKIGIMPG I   G VGI+SRSGTLTYEAV QT+  G GQST 
Sbjct: 116 GVTLIGPNCPGVITPGECKIGIMPGHIHLPGKVGIVSRSGTLTYEAVKQTTDAGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L+LF  D  TE+IVM+GEIGGSAEEEAA ++K        KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILKLFQEDPKTEAIVMIGEIGGSAEEEAAAYIKAN----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            ++AG TAP G+ MGHAGA+ISGGKG A++K  A+++AG+    S A IG++L EL G
Sbjct: 232 SYIAGVTAPAGKRMGHAGAIISGGKGTADEKFAALQDAGVKTVRSLADIGKALAELTG 289


>gi|13473638|ref|NP_105206.1| succinyl-CoA synthetase subunit alpha [Mesorhizobium loti
           MAFF303099]
 gi|14024388|dbj|BAB50992.1| succinyl-CoA synthetase alpha-subunit [Mesorhizobium loti
           MAFF303099]
          Length = 300

 Score =  347 bits (889), Expect = 2e-93,   Method: Composition-based stats.
 Identities = 232/299 (77%), Positives = 271/299 (90%), Gaps = 1/299 (0%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTG-GNVNVPVF 59
           MSILVDKNTKVLVQGLTGK GTFHTEQA+ Y  T++VGGIHPKKG   WTG    ++P+F
Sbjct: 1   MSILVDKNTKVLVQGLTGKTGTFHTEQALAYHGTKMVGGIHPKKGGETWTGSKGESLPIF 60

Query: 60  TTVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEK 119
            TVAE K +T ANASV+YVPP+GA +AI+E+IEAEIPLI+CITEGIPV+DMV+VKARL++
Sbjct: 61  ATVAEGKAKTGANASVVYVPPAGAAEAILEAIEAEIPLIICITEGIPVMDMVKVKARLDR 120

Query: 120 SSSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQST 179
           S+SRLIGPNCPG+LTPD CKIGIMPG+IFRKGSVG++SRSGTLTYEAVFQT+  GLGQ+T
Sbjct: 121 STSRLIGPNCPGVLTPDECKIGIMPGNIFRKGSVGVVSRSGTLTYEAVFQTTNVGLGQTT 180

Query: 180 AVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPI 239
           AVGIGGDPVKGTEFIDVLE+FLAD+ T+SI+M+GEIGGSAEE+AAQFLKDEAKRGRKKP+
Sbjct: 181 AVGIGGDPVKGTEFIDVLEMFLADDETKSIIMIGEIGGSAEEDAAQFLKDEAKRGRKKPM 240

Query: 240 VGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            GF+AG+TAP GRTMGHAGAVISGGKGGAEDKI AM+ AGI ++PSPAR+G +LVE + 
Sbjct: 241 AGFIAGRTAPAGRTMGHAGAVISGGKGGAEDKIAAMESAGIKVSPSPARLGTTLVEAIK 299


>gi|150398139|ref|YP_001328606.1| succinyl-CoA synthetase subunit alpha [Sinorhizobium medicae
           WSM419]
 gi|150029654|gb|ABR61771.1| succinyl-CoA synthetase, alpha subunit [Sinorhizobium medicae
           WSM419]
          Length = 300

 Score =  347 bits (889), Expect = 2e-93,   Method: Composition-based stats.
 Identities = 237/299 (79%), Positives = 273/299 (91%), Gaps = 1/299 (0%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTG-GNVNVPVF 59
           MSIL++K+TKVLVQGLTGK GTFHTEQA+ Y  T++VGGIHPKKG   WTG     +P+F
Sbjct: 1   MSILINKDTKVLVQGLTGKTGTFHTEQALAYNGTKMVGGIHPKKGGETWTGAKGEQLPIF 60

Query: 60  TTVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEK 119
            TVAE ++ T A+ASVIYVPP+GA  AIIE+I+AEIPLIVCITEGIPV DMV+VKARL+K
Sbjct: 61  ATVAEGRDATGADASVIYVPPAGAAAAIIEAIDAEIPLIVCITEGIPVADMVKVKARLDK 120

Query: 120 SSSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQST 179
           SSSRLIGPNCPG+LTPD CKIGIMPG+IFRKGSVG+LSRSGTLTYEAVFQT+ EGLGQ+T
Sbjct: 121 SSSRLIGPNCPGVLTPDECKIGIMPGNIFRKGSVGVLSRSGTLTYEAVFQTTNEGLGQTT 180

Query: 180 AVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPI 239
           AVGIGGDPVKGTEFIDVLE+FLAD+ T+SI+M+GEIGGSAEEEAAQFLKDEAKRGRKKP+
Sbjct: 181 AVGIGGDPVKGTEFIDVLEMFLADDETKSIIMIGEIGGSAEEEAAQFLKDEAKRGRKKPM 240

Query: 240 VGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           VGF+AG+TAPPGRTMGHAGAVISGGKGGAEDKI AM+ AGI ++PSPAR+G++LVE+L 
Sbjct: 241 VGFIAGRTAPPGRTMGHAGAVISGGKGGAEDKIAAMESAGIRVSPSPARLGKTLVEVLK 299


>gi|319897337|ref|YP_004135533.1| succinyl-CoA synthetase alpha chain [Haemophilus influenzae F3031]
 gi|317432842|emb|CBY81207.1| succinyl-CoA synthetase alpha chain [Haemophilus influenzae F3031]
          Length = 293

 Score =  347 bits (889), Expect = 2e-93,   Method: Composition-based stats.
 Identities = 183/299 (61%), Positives = 221/299 (73%), Gaps = 9/299 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           M+IL+DKNTKV+ QG TG  GTFH+EQA+ Y  TQ+VGG+ P KG T   G    +PVF 
Sbjct: 1   MAILIDKNTKVICQGFTGGQGTFHSEQALAY-GTQLVGGVSPNKGGTTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T A A+VIYVP     DAIIE+I+A I LIVCITEGIP LDM++VK +L ++
Sbjct: 56  TVREAIENTGATATVIYVPAPFCKDAIIEAIDAGIQLIVCITEGIPTLDMLKVKQKLNET 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
              +IGPNCPG++TPD CKIGIMP  I +KG VGI+SRSGTLTYEAV QT+ EG GQST 
Sbjct: 116 GVVMIGPNCPGVITPDECKIGIMPAHIHKKGKVGIVSRSGTLTYEAVKQTTDEGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+LE F  D  TE+IVM+GEIGGSAEEEAA F+KD       KP+V
Sbjct: 176 VGIGGDPILGSSFIDILERFQQDPETEAIVMIGEIGGSAEEEAAIFIKDH----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
            ++AG TAP G+ MGHAGA+ISGGKG A  KI A++ AG+    S A IG +L +LL S
Sbjct: 232 AYIAGITAPKGKRMGHAGAIISGGKGTAVGKIAALEAAGVTCVKSLAEIGEALRKLLKS 290


>gi|227823643|ref|YP_002827616.1| succinyl-CoA synthetase subunit alpha [Sinorhizobium fredii NGR234]
 gi|227342645|gb|ACP26863.1| succinyl-CoA synthetase, alpha subunit [Sinorhizobium fredii
           NGR234]
          Length = 300

 Score =  346 bits (888), Expect = 2e-93,   Method: Composition-based stats.
 Identities = 233/299 (77%), Positives = 268/299 (89%), Gaps = 1/299 (0%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTG-GNVNVPVF 59
           MSILV+KNTKVLVQGLTGK GTFHTEQA+ Y  TQ+VGGIHPKKG   WTG     +P+F
Sbjct: 1   MSILVNKNTKVLVQGLTGKTGTFHTEQALAYYGTQMVGGIHPKKGGESWTGSKGETLPIF 60

Query: 60  TTVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEK 119
            +VAE +E+T A+ASVIYVPP+GA DAIIE+I+AEIP I CITEGIPV DMVRVKARL++
Sbjct: 61  ASVAEGREKTGADASVIYVPPAGAADAIIEAIDAEIPFITCITEGIPVADMVRVKARLDR 120

Query: 120 SSSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQST 179
           S SRL+GPNCPGILTP+ CKIGIMPGSIFRKGSVGI+SRSGTLTYEAVFQTS EGLGQ+T
Sbjct: 121 SKSRLLGPNCPGILTPEECKIGIMPGSIFRKGSVGIVSRSGTLTYEAVFQTSNEGLGQTT 180

Query: 180 AVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPI 239
           AVGIGGDPVKGTEFIDVLE+FLADEAT SI+M+GEIGGSAEE+AAQFL DEAK+GRKKP+
Sbjct: 181 AVGIGGDPVKGTEFIDVLEMFLADEATTSIIMIGEIGGSAEEDAAQFLIDEAKKGRKKPM 240

Query: 240 VGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            GF+AG+TAP GRTMGHAGAV+SGGKG AE KI AM++AGI ++PSPAR+G++LVE+L 
Sbjct: 241 AGFIAGRTAPKGRTMGHAGAVVSGGKGDAESKIAAMEQAGIRVSPSPARLGKTLVEVLK 299


>gi|26990877|ref|NP_746302.1| succinyl-CoA synthetase subunit alpha [Pseudomonas putida KT2440]
 gi|148546907|ref|YP_001267009.1| succinyl-CoA synthetase subunit alpha [Pseudomonas putida F1]
 gi|167034751|ref|YP_001669982.1| succinyl-CoA synthetase subunit alpha [Pseudomonas putida GB-1]
 gi|170722672|ref|YP_001750360.1| succinyl-CoA synthetase subunit alpha [Pseudomonas putida W619]
 gi|325275364|ref|ZP_08141312.1| succinyl-CoA synthetase subunit alpha [Pseudomonas sp. TJI-51]
 gi|24985890|gb|AAN69766.1|AE016613_1 succinyl-CoA synthetase, alpha subunit [Pseudomonas putida KT2440]
 gi|148510965|gb|ABQ77825.1| succinyl-CoA synthetase (ADP-forming) alpha subunit [Pseudomonas
           putida F1]
 gi|166861239|gb|ABY99646.1| succinyl-CoA synthetase, alpha subunit [Pseudomonas putida GB-1]
 gi|169760675|gb|ACA73991.1| succinyl-CoA synthetase, alpha subunit [Pseudomonas putida W619]
 gi|313497969|gb|ADR59335.1| SucD [Pseudomonas putida BIRD-1]
 gi|324099508|gb|EGB97406.1| succinyl-CoA synthetase subunit alpha [Pseudomonas sp. TJI-51]
          Length = 294

 Score =  346 bits (888), Expect = 2e-93,   Method: Composition-based stats.
 Identities = 172/298 (57%), Positives = 215/298 (72%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+TKV+ QG TG  GTFH+EQAI Y  T++VGG+ P KG T   G    +PVF 
Sbjct: 1   MSVLINKDTKVICQGFTGSQGTFHSEQAIAY-GTKMVGGVTPGKGGTTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T A+ASVIYVP     D+I+E+    I LIVCITEGIP LDM+  K + ++ 
Sbjct: 56  TVKEAVEATGADASVIYVPAPFCKDSILEAAFGGIKLIVCITEGIPTLDMLDAKVKCDEL 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
              LIGPNCPG++TP  CKIGIMPG I   G VGI+SRSGTLTYEAV QT+  G GQST 
Sbjct: 116 GVTLIGPNCPGVITPGECKIGIMPGHIHLPGKVGIVSRSGTLTYEAVKQTTDAGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L+LF  D  TE+IVM+GEIGGSAEEEAA ++K        KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILKLFQEDPKTEAIVMIGEIGGSAEEEAAAYIKAH----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            ++AG TAP G+ MGHAGA+ISGGKG A++K  A+++AG+    S A IG++L EL G
Sbjct: 232 SYIAGVTAPAGKRMGHAGAIISGGKGTADEKFAALQDAGVKTVRSLADIGKALAELTG 289


>gi|315126692|ref|YP_004068695.1| succinyl-CoA synthetase, alpha subunit, NAD(P)-binding protein
           [Pseudoalteromonas sp. SM9913]
 gi|315015206|gb|ADT68544.1| succinyl-CoA synthetase, alpha subunit, NAD(P)-binding protein
           [Pseudoalteromonas sp. SM9913]
          Length = 290

 Score =  346 bits (888), Expect = 2e-93,   Method: Composition-based stats.
 Identities = 174/298 (58%), Positives = 221/298 (74%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+TKV+ QG TG  GTFH+EQA+ Y  TQ+VGG+ P KG     G    +PVF 
Sbjct: 1   MSVLINKDTKVICQGFTGGQGTFHSEQALEY-GTQMVGGVSPGKGGQTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV +A E T A ASVIYVP     DAI+E+I+A I LIVCITEGIP LDMV VK +L+++
Sbjct: 56  TVRDAVEATGATASVIYVPAPFCKDAILEAIDAGIDLIVCITEGIPTLDMVDVKVKLDQT 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            +R+IGPNCPG++TP   KIGIMPG I + G VGI+SRSGTLTYEAV QT+  G GQST 
Sbjct: 116 GTRMIGPNCPGVITPGETKIGIMPGHIHKPGKVGIVSRSGTLTYEAVKQTTDAGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ GT FIDVLE+F  D+ TE+IVM+GEIGG+AEEEAA+++K        KP+V
Sbjct: 176 VGIGGDPIPGTNFIDVLEMFEKDDQTEAIVMIGEIGGTAEEEAAEYIKAN----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            ++AG TAP G+ MGHAGA+I+GGKG A++K  A++ AG+    S A IG++L E  G
Sbjct: 232 SYIAGVTAPEGKRMGHAGAIIAGGKGTADEKFAALEAAGVKTVRSLADIGKALKEKTG 289


>gi|145631247|ref|ZP_01787020.1| succinyl-CoA synthetase alpha subunit [Haemophilus influenzae
           R3021]
 gi|144983174|gb|EDJ90669.1| succinyl-CoA synthetase alpha subunit [Haemophilus influenzae
           R3021]
          Length = 293

 Score =  346 bits (888), Expect = 2e-93,   Method: Composition-based stats.
 Identities = 183/299 (61%), Positives = 222/299 (74%), Gaps = 9/299 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           M+IL+DKNTKV+ QG TG  GTFH+EQA+ Y  TQ+VGG+ P KG T   G    +PVF 
Sbjct: 1   MAILIDKNTKVICQGFTGGQGTFHSEQALAY-GTQLVGGVSPNKGGTTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E   A A+VIYVP S   DAIIE+I+A I LIVCITEGIP LDM++VK +L ++
Sbjct: 56  TVREAVENMGATATVIYVPASFCKDAIIEAIDAGIQLIVCITEGIPTLDMLKVKQKLNET 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
              +IGPNCPG++TPD CKIGIMP  I +KG VGI+SRSGTLTYEAV QT+ EG GQST 
Sbjct: 116 GVVMIGPNCPGVITPDECKIGIMPAHIHKKGKVGIVSRSGTLTYEAVKQTTDEGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+LE F  D  TE+IVM+GEIGGSAEEEAA F+KD       KP+V
Sbjct: 176 VGIGGDPIPGSSFIDILERFQQDPETEAIVMIGEIGGSAEEEAAIFIKDN----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
            ++AG TAP G+ MGHAGA+ISGGKG A +KI A++ AG+    S A IG +L +LL S
Sbjct: 232 AYIAGITAPKGKRMGHAGAIISGGKGTAVEKIAALEAAGVTCVKSLAEIGEALRKLLKS 290


>gi|209776464|gb|ACI86544.1| succinyl-CoA synthetase alpha subunit [Escherichia coli]
          Length = 289

 Score =  346 bits (888), Expect = 2e-93,   Method: Composition-based stats.
 Identities = 173/298 (58%), Positives = 218/298 (73%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL+DKNTKV+ QG TG  GTFH+EQAI Y  T++VGG+ P KG T   G    +PVF 
Sbjct: 1   MSILIDKNTKVICQGFTGSQGTFHSEQAIAY-GTKMVGGVTPGKGGTTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA   T A ASVIYVP     D+I+E+I+A I LI+ ITEGIP LDM+ VK +L+++
Sbjct: 56  TVREAVAATGATASVIYVPALFCKDSILEAIDAGIKLIITITEGIPTLDMLTVKVKLDEA 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TP  CKIGI PG I + G VGI+SRSGTLTYEAV QT+  G GQST 
Sbjct: 116 GVRMIGPNCPGVITPGECKIGIQPGHIHKPGKVGIVSRSGTLTYEAVKQTTDYGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+LE+F  D  TE+IVM+GEIGGSAEEEAA ++K+       KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILEMFEKDPQTEAIVMIGEIGGSAEEEAAAYIKEH----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           G++AG TAP G+ MGHAGA+I+GGKG A++K  A++ AG+    S A IG +L  +L 
Sbjct: 232 GYIAGVTAPKGKRMGHAGAIIAGGKGTADEKFAALEAAGVKTVRSLADIGEALKTVLK 289


>gi|315633949|ref|ZP_07889238.1| succinyl-CoA synthetase subunit alpha [Aggregatibacter segnis ATCC
           33393]
 gi|315477199|gb|EFU67942.1| succinyl-CoA synthetase subunit alpha [Aggregatibacter segnis ATCC
           33393]
          Length = 290

 Score =  346 bits (888), Expect = 2e-93,   Method: Composition-based stats.
 Identities = 176/299 (58%), Positives = 225/299 (75%), Gaps = 9/299 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL++K+TKV+ QG TG  GTFH+EQA+ Y  T++VGG+ P KG T   G    +PVF 
Sbjct: 1   MSILINKDTKVICQGFTGGQGTFHSEQALAY-GTKLVGGVSPNKGGTTHLG----LPVFD 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV +A E T A A+VIYVP  G  DAI+E+I+A I LI+CITEGIP LDM+ VK RL ++
Sbjct: 56  TVRDAVEATGATATVIYVPAPGCKDAILEAIDAGIKLIICITEGIPTLDMLVVKQRLNQT 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TP+ CKIGIMPG+I +KG +GI+SRSGTLTYEAV QT+ EGLGQST 
Sbjct: 116 GVRMIGPNCPGVITPEECKIGIMPGNIHKKGKIGIVSRSGTLTYEAVKQTTDEGLGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ F+D+L+LF  D  TE+IVM+GEIGGSAEEEAA F+K+       KP+V
Sbjct: 176 VGIGGDPIPGSNFVDILKLFQEDPQTEAIVMIGEIGGSAEEEAAAFIKEH----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
            ++AG TAP G+ MGHAGA+ISGGKG A++K  A++ AG+    S A IG +L  +L  
Sbjct: 232 SYIAGVTAPKGKRMGHAGAIISGGKGTADEKFAALEAAGVKTVRSLAEIGSALRAMLNK 290


>gi|323498618|ref|ZP_08103610.1| succinyl-CoA synthetase subunit alpha [Vibrio sinaloensis DSM
           21326]
 gi|323316316|gb|EGA69335.1| succinyl-CoA synthetase subunit alpha [Vibrio sinaloensis DSM
           21326]
          Length = 290

 Score =  346 bits (888), Expect = 2e-93,   Method: Composition-based stats.
 Identities = 179/298 (60%), Positives = 222/298 (74%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+TKV+ QG TG  GTFH+EQA+ Y  TQ+VGG+ P KG     G    +PVF 
Sbjct: 1   MSVLINKDTKVICQGFTGGQGTFHSEQALAY-GTQMVGGVSPGKGGQTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T A A+VIYVP     DAI+E+I+A I LIV ITEGIP  DM+ VK +LE++
Sbjct: 56  TVREAVEATGATATVIYVPAPFCKDAILEAIDAGIELIVTITEGIPTTDMIDVKVKLEET 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TPD CKIGIMPG I +KG VGI+SRSGTLTYEAV QT+ EG GQST 
Sbjct: 116 GVRMIGPNCPGLITPDECKIGIMPGHIHKKGKVGIVSRSGTLTYEAVKQTTDEGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L+LF  D  TE+IVM+GEIGG+AEEEAA F+K+       KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILKLFQEDPETEAIVMIGEIGGTAEEEAAAFIKEN----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            ++AG TAPPG+ MGHAGA+ISGGKG AEDK  A++ AG+    S A IG+ L E+ G
Sbjct: 232 SYIAGVTAPPGKRMGHAGAIISGGKGTAEDKFAALEAAGVKTVKSLADIGKGLREITG 289


>gi|322514064|ref|ZP_08067135.1| succinyl-CoA synthetase subunit alpha [Actinobacillus ureae ATCC
           25976]
 gi|322120081|gb|EFX92052.1| succinyl-CoA synthetase subunit alpha [Actinobacillus ureae ATCC
           25976]
          Length = 290

 Score =  346 bits (888), Expect = 2e-93,   Method: Composition-based stats.
 Identities = 183/299 (61%), Positives = 226/299 (75%), Gaps = 9/299 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           M+IL+DKNTKV+ QG TG  GTFH+EQA+ Y  TQ+VGGI P KG T   G    +PVF 
Sbjct: 1   MAILIDKNTKVICQGFTGGQGTFHSEQALAY-GTQLVGGISPNKGGTTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E+T A  SVIYVP  G  DAI+E+I+A I LIVCITEGIP LDM+ VK +L++S
Sbjct: 56  TVREAVEKTGATTSVIYVPAPGCKDAILEAIDAGIQLIVCITEGIPTLDMLIVKQKLKES 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPGI+TPD CKIGIMP  I +KG +GI+SRSGTLTYEAV QT+ EG GQST 
Sbjct: 116 GVRMIGPNCPGIITPDECKIGIMPAHIHKKGKIGIVSRSGTLTYEAVKQTTDEGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L+LF +D  TE+IVM+GEIGG+AEEEAA+F+K        KP+V
Sbjct: 176 VGIGGDPIPGSSFIDILKLFQSDPETEAIVMIGEIGGTAEEEAAEFIKMH----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
            ++AG TAP G+ MGHAGA+ISGGKG A++K  A+++AG+    S A IG +L ELL  
Sbjct: 232 SYIAGVTAPKGKRMGHAGAIISGGKGTADEKFKALEQAGVKTVRSLAEIGAALNELLNK 290


>gi|331656746|ref|ZP_08357708.1| succinyl-CoA synthetase subunit alpha [Escherichia coli TA206]
 gi|331054994|gb|EGI27003.1| succinyl-CoA synthetase subunit alpha [Escherichia coli TA206]
          Length = 289

 Score =  346 bits (888), Expect = 2e-93,   Method: Composition-based stats.
 Identities = 173/298 (58%), Positives = 218/298 (73%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL+DKNTKV+ QG TG  GTFH+EQAI Y  T++VGG+ P KG T   G    +PVF 
Sbjct: 1   MSILIDKNTKVICQGFTGSQGTFHSEQAIAY-GTKMVGGVTPGKGGTTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA   T A ASVIYVP     D+I+E+I+A I LI+ ITEGIP LDM+ VK +L+++
Sbjct: 56  TVREAVAATGAIASVIYVPAPFCKDSILEAIDAGIKLIITITEGIPTLDMLTVKVKLDEA 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TP  CKIGI PG I + G VGI+SRSGTLTYEAV QT+  G GQST 
Sbjct: 116 GVRMIGPNCPGVITPGECKIGIQPGHIHKPGKVGIVSRSGTLTYEAVKQTTDYGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+LE+F  D  TE+IVM+GEIGGSAEEEAA ++K+       KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILEMFEKDPQTEAIVMIGEIGGSAEEEAAAYIKEH----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           G++AG TAP G+ MGHAGA+I+GGKG A++K  A++ AG+    S A IG +L  +L 
Sbjct: 232 GYIAGVTAPKGKRMGHAGAIIAGGKGTADEKFAALEAAGVKTVRSLADIGEALKTVLK 289


>gi|209551254|ref|YP_002283171.1| succinyl-CoA synthetase subunit alpha [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209537010|gb|ACI56945.1| succinyl-CoA synthetase, alpha subunit [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 300

 Score =  346 bits (888), Expect = 2e-93,   Method: Composition-based stats.
 Identities = 232/299 (77%), Positives = 270/299 (90%), Gaps = 1/299 (0%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTG-GNVNVPVF 59
           MSILV+K+TK+LVQGLTGK GTFHTEQA+ Y  TQ+VGGIHPKKG   W+G    ++P+F
Sbjct: 1   MSILVNKDTKILVQGLTGKTGTFHTEQALAYYGTQMVGGIHPKKGGETWSGAKGESLPIF 60

Query: 60  TTVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEK 119
            TVAE KE+T A+A+VIYVPP+GA DAIIE+I+AEIP I CITEGIPV+DMVRVKARL++
Sbjct: 61  ATVAEGKEKTGADATVIYVPPAGAADAIIEAIDAEIPFITCITEGIPVMDMVRVKARLDR 120

Query: 120 SSSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQST 179
           S SRL+GPNCPGILTP+ CKIGIMPGSIFRKGSVGI+SRSGTLTYEAVFQTS EGLGQ+T
Sbjct: 121 SKSRLLGPNCPGILTPEECKIGIMPGSIFRKGSVGIVSRSGTLTYEAVFQTSNEGLGQTT 180

Query: 180 AVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPI 239
           AVGIGGDPVKGTEFIDVLE+FLADEAT SI+M+GEIGGSAEE+AAQFLKDEAK+GRKKP+
Sbjct: 181 AVGIGGDPVKGTEFIDVLEMFLADEATTSIIMIGEIGGSAEEDAAQFLKDEAKKGRKKPM 240

Query: 240 VGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            GF+AG+TAP GRTMGHAGAV+SGGKG AE KI AM+ AGI ++PSPAR+G++LVE+L 
Sbjct: 241 AGFIAGRTAPKGRTMGHAGAVVSGGKGDAESKIAAMESAGIKVSPSPARLGKTLVEVLK 299


>gi|300926131|ref|ZP_07141944.1| succinyl-CoA synthetase subunit alpha [Escherichia coli MS 182-1]
 gi|300417830|gb|EFK01141.1| succinyl-CoA synthetase subunit alpha [Escherichia coli MS 182-1]
          Length = 289

 Score =  346 bits (888), Expect = 2e-93,   Method: Composition-based stats.
 Identities = 172/298 (57%), Positives = 217/298 (72%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL+DKNTKV+ QG TG  GTFH+EQAI Y  T++VGG+ P KG T   G    +PVF 
Sbjct: 1   MSILIDKNTKVICQGFTGSQGTFHSEQAIAY-GTKMVGGVTPGKGGTTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA   T   ASVIYVP     D+I+E+I+A I LI+ ITEGIP LDM+ VK +L+++
Sbjct: 56  TVREAVAATGTTASVIYVPAPFCKDSILEAIDAGIKLIITITEGIPTLDMLTVKVKLDEA 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TP  CKIGI PG I + G VGI+SRSGTLTYEAV QT+  G GQST 
Sbjct: 116 GVRMIGPNCPGVITPGECKIGIQPGHIHKPGKVGIVSRSGTLTYEAVKQTTDYGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+LE+F  D  TE+IVM+GEIGGSAEEEAA ++K+       KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILEMFEKDPQTEAIVMIGEIGGSAEEEAAAYIKEH----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           G++AG TAP G+ MGHAGA+I+GGKG A++K  A++ AG+    S A IG +L  +L 
Sbjct: 232 GYIAGVTAPKGKRMGHAGAIIAGGKGTADEKFAALEAAGVKTVRSLADIGEALKTVLK 289


>gi|270263775|ref|ZP_06192044.1| hypothetical protein SOD_e04050 [Serratia odorifera 4Rx13]
 gi|270042659|gb|EFA15754.1| hypothetical protein SOD_e04050 [Serratia odorifera 4Rx13]
          Length = 290

 Score =  346 bits (888), Expect = 2e-93,   Method: Composition-based stats.
 Identities = 174/298 (58%), Positives = 220/298 (73%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL+DKNTKV+ QG TG  GTFH+EQAI Y  T++VGG+ P KG T   G    +PVF 
Sbjct: 1   MSILIDKNTKVICQGFTGSQGTFHSEQAIAY-GTKMVGGVTPGKGGTQHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T A ASVIYVP     D+I+E+I+A I LI+ ITEGIP LDM+ VK +L+++
Sbjct: 56  TVREAVEATGATASVIYVPAPFCKDSILEAIDAGIKLIITITEGIPTLDMLTVKVKLDEA 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TP  CKIGIMPG I   G VGI+SRSGTLTYEAV QT+  GLGQST 
Sbjct: 116 GVRMIGPNCPGVITPGECKIGIMPGHIHLPGKVGIVSRSGTLTYEAVKQTTDTGLGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L++F  D  TE+IVM+GEIGGSAEEEAA ++K+       KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILKMFQEDPQTEAIVMIGEIGGSAEEEAAAYIKEH----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           G++AG TAP G+ MGHAGA+I+GGKG A++K  A++ AG+    S A IG ++  +L 
Sbjct: 232 GYIAGVTAPKGKRMGHAGAIIAGGKGTADEKFAALEAAGVKTVRSLADIGEAVKAVLN 289


>gi|329124072|ref|ZP_08252619.1| succinyl-CoA synthetase subunit alpha [Haemophilus aegyptius ATCC
           11116]
 gi|327467497|gb|EGF12995.1| succinyl-CoA synthetase subunit alpha [Haemophilus aegyptius ATCC
           11116]
          Length = 293

 Score =  346 bits (888), Expect = 2e-93,   Method: Composition-based stats.
 Identities = 183/299 (61%), Positives = 222/299 (74%), Gaps = 9/299 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           M+IL+DKNTKV+ QG TG  GTFH+EQA+ Y  TQ+VGG+ P KG T   G    +PVF 
Sbjct: 1   MAILIDKNTKVICQGFTGGQGTFHSEQALAY-GTQLVGGVSPNKGGTTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T A A+VIYVP S   DAIIE+I+A   LIVCITEGIP LDM++VK +L ++
Sbjct: 56  TVREAVENTGATATVIYVPASFCKDAIIEAIDAGTQLIVCITEGIPTLDMLKVKQKLNET 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
              +IGPNCPG++TPD CKIGIMP  I +KG VGI+SRSGTLTYEAV QT+ EG GQST 
Sbjct: 116 GVVMIGPNCPGVITPDECKIGIMPAHIHKKGKVGIVSRSGTLTYEAVKQTTDEGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+LE F  D  TE+IVM+GEIGGSAEEEAA F+KD       KP+V
Sbjct: 176 VGIGGDPILGSSFIDILERFQQDPETEAIVMIGEIGGSAEEEAAIFIKDN----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
            ++AG TAP G+ MGHAGA+ISGGKG A +KI A++ AG+    S A IG +L +LL S
Sbjct: 232 AYIAGITAPKGKRMGHAGAIISGGKGTAVEKIAALEAAGVTCVKSLAEIGEALRKLLKS 290


>gi|320539329|ref|ZP_08038998.1| putative succinyl-CoA synthetase, NAD(P)-binding, alpha subunit
           [Serratia symbiotica str. Tucson]
 gi|320030454|gb|EFW12464.1| putative succinyl-CoA synthetase, NAD(P)-binding, alpha subunit
           [Serratia symbiotica str. Tucson]
          Length = 290

 Score =  346 bits (888), Expect = 2e-93,   Method: Composition-based stats.
 Identities = 177/298 (59%), Positives = 223/298 (74%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL+DKNTKV+ QG TG  GTFH+EQAI Y  T++VGG+ P KG T   G    +PVF 
Sbjct: 1   MSILIDKNTKVICQGFTGSQGTFHSEQAIAY-GTKMVGGVTPGKGGTQHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T ANASVIYVP     D+I+E+I+A I LI+ ITEGIP LDM+ VK +L+++
Sbjct: 56  TVREAVEATGANASVIYVPALFCKDSILEAIDAGIKLIITITEGIPTLDMLTVKVKLDEA 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TPD CKIGIMPG I + G VGI+SRSGTLTYEAV QT+  GLGQST 
Sbjct: 116 GVRMIGPNCPGVITPDECKIGIMPGHIHQPGKVGIVSRSGTLTYEAVKQTTDAGLGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L+LF  D  TE+IVM+GEIGGSAEEEAA ++K+       KP+V
Sbjct: 176 VGIGGDPILGSNFIDILKLFQQDPQTEAIVMIGEIGGSAEEEAAAYIKEY----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           G++AG TAP G+ MGHAGA+I+GGKG A++K  A++ AG+    S A IG ++  +L 
Sbjct: 232 GYIAGVTAPKGKRMGHAGAIIAGGKGTADEKFAALEAAGVKTVRSLADIGDAVKAVLN 289


>gi|148978241|ref|ZP_01814759.1| succinyl-CoA synthetase subunit alpha [Vibrionales bacterium
           SWAT-3]
 gi|145962542|gb|EDK27819.1| succinyl-CoA synthetase subunit alpha [Vibrionales bacterium
           SWAT-3]
          Length = 290

 Score =  346 bits (888), Expect = 2e-93,   Method: Composition-based stats.
 Identities = 180/298 (60%), Positives = 222/298 (74%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+TKV+ QG TG  GTFH+EQAI Y  TQ+VGG+ P KG     G    +PVF 
Sbjct: 1   MSVLINKDTKVICQGFTGGQGTFHSEQAIAY-GTQMVGGVSPGKGGQTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T A A+VIYVP     DAI+E+I+A I LIV ITEGIP  DM+ VK +LE++
Sbjct: 56  TVREAVEVTGATATVIYVPAPFCKDAILEAIDAGIELIVTITEGIPTTDMIDVKVKLEET 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TPD CKIGIMPG I +KG VGI+SRSGTLTYEAV QT+ EG GQST 
Sbjct: 116 GVRMIGPNCPGLITPDECKIGIMPGHIHKKGKVGIVSRSGTLTYEAVKQTTDEGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L+LF  D  TE+IVM+GEIGG+AEEEAA F+K+       KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILKLFQEDPETEAIVMIGEIGGTAEEEAAAFIKEN----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            ++AG TAPPG+ MGHAGA+ISGGKG AEDK  A++ AG+    S A IG+ L E+ G
Sbjct: 232 SYIAGVTAPPGKRMGHAGAIISGGKGTAEDKFAALEAAGVKTVKSLADIGKGLREITG 289


>gi|145635046|ref|ZP_01790752.1| succinyl-CoA synthetase alpha subunit [Haemophilus influenzae
           PittAA]
 gi|145267654|gb|EDK07652.1| succinyl-CoA synthetase alpha subunit [Haemophilus influenzae
           PittAA]
          Length = 289

 Score =  346 bits (888), Expect = 2e-93,   Method: Composition-based stats.
 Identities = 180/298 (60%), Positives = 221/298 (74%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           M+IL+DKNTKV+ QG TG  GTFH+EQA+ Y  TQ+VGG+ P KG T   G    +PVF 
Sbjct: 1   MAILIDKNTKVICQGFTGGQGTFHSEQALAY-GTQLVGGVSPNKGGTTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T A A+VIYVP     DAIIE+I+A I LIVCITEGIP LDM++VK +L ++
Sbjct: 56  TVREAVENTGATATVIYVPAPFCKDAIIEAIDAGIKLIVCITEGIPTLDMLKVKQKLNET 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
              +IGPNCPG++TPD CKIGIMP  I +KG VGI+SRSGTLTYEAV QT+ EG GQST 
Sbjct: 116 GVVMIGPNCPGVITPDECKIGIMPAHIHKKGKVGIVSRSGTLTYEAVKQTTDEGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+LE F  D  TE+IVM+GEIGGSAEE+AA F+KD       KP+V
Sbjct: 176 VGIGGDPIPGSSFIDILERFQQDPETEAIVMIGEIGGSAEEDAAIFIKDN----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            ++AG TAP G+ MGHAGA+ISGGKG A +KI A++ AG+    S A IG +L ++L 
Sbjct: 232 AYIAGITAPKGKRMGHAGAIISGGKGTAAEKIAALEAAGVTCVKSLAEIGAALRKILK 289


>gi|260464176|ref|ZP_05812369.1| succinyl-CoA synthetase, alpha subunit [Mesorhizobium opportunistum
           WSM2075]
 gi|259029979|gb|EEW31262.1| succinyl-CoA synthetase, alpha subunit [Mesorhizobium opportunistum
           WSM2075]
          Length = 300

 Score =  346 bits (888), Expect = 2e-93,   Method: Composition-based stats.
 Identities = 230/299 (76%), Positives = 271/299 (90%), Gaps = 1/299 (0%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTG-GNVNVPVF 59
           MSILVDKNTKVLVQGLTGK GTFHTEQA+ Y  T++VGGIHPKKG   WTG    ++P+F
Sbjct: 1   MSILVDKNTKVLVQGLTGKTGTFHTEQALAYHGTKMVGGIHPKKGGETWTGSKGESLPIF 60

Query: 60  TTVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEK 119
            TVAE K +T ANASV+YVPP+GA +AI+E+IEAEIPLI+CITEGIPV+DM++VKARL++
Sbjct: 61  ATVAEGKAKTGANASVVYVPPAGAAEAILEAIEAEIPLIICITEGIPVMDMIKVKARLDR 120

Query: 120 SSSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQST 179
           S+SRLIGPNCPG+LTP+ CKIGIMPG+IFRKGSVG++SRSGTLTYEAVFQT+  GLGQ+T
Sbjct: 121 SASRLIGPNCPGVLTPNECKIGIMPGNIFRKGSVGVVSRSGTLTYEAVFQTTNVGLGQTT 180

Query: 180 AVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPI 239
           AVGIGGDPVKGTEFIDVLE+FLAD+ T+SI+M+GEIGGSAEE+AAQFLKDEAKRGRKKP+
Sbjct: 181 AVGIGGDPVKGTEFIDVLEMFLADDETKSIIMIGEIGGSAEEDAAQFLKDEAKRGRKKPM 240

Query: 240 VGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            GF+AG+TAP GRTMGHAGAVISGGKGGAEDKI AM+ AGI ++PSPAR+G +LVE + 
Sbjct: 241 AGFIAGRTAPAGRTMGHAGAVISGGKGGAEDKIAAMESAGIKVSPSPARLGTTLVEAIK 299


>gi|319780728|ref|YP_004140204.1| succinyl-CoA synthetase subunit alpha [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317166616|gb|ADV10154.1| succinyl-CoA synthetase, alpha subunit [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 300

 Score =  346 bits (888), Expect = 2e-93,   Method: Composition-based stats.
 Identities = 232/299 (77%), Positives = 272/299 (90%), Gaps = 1/299 (0%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTG-GNVNVPVF 59
           MSILVDKNTKVLVQGLTGK GTFHTEQA+ Y  T++VGGIHPKKG   WTG    ++P+F
Sbjct: 1   MSILVDKNTKVLVQGLTGKTGTFHTEQALAYHGTKMVGGIHPKKGGETWTGAKGESLPIF 60

Query: 60  TTVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEK 119
            TVAE KE+T ANASV+YVPP+GA +AI+E+IEAEIPLI+CITEGIPV+DM+RVKARL++
Sbjct: 61  ATVAEGKEKTGANASVVYVPPAGAAEAILEAIEAEIPLIICITEGIPVMDMIRVKARLDR 120

Query: 120 SSSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQST 179
           S+SRLIGPNCPG+LTP+ CKIGIMPG+IFRKGSVG++SRSGTLTYEAVFQT+  GLGQ+T
Sbjct: 121 STSRLIGPNCPGVLTPNECKIGIMPGNIFRKGSVGVVSRSGTLTYEAVFQTTNVGLGQTT 180

Query: 180 AVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPI 239
           AVGIGGDPVKGTEFID+LE+FLADE T+SI+M+GEIGGSAEE+AAQFLKDEAKRGRKKP+
Sbjct: 181 AVGIGGDPVKGTEFIDMLEMFLADEETKSIIMIGEIGGSAEEDAAQFLKDEAKRGRKKPM 240

Query: 240 VGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            GF+AG+TAP GRTMGHAGAVISGGKGGAEDKI AM+ AGI ++PSPAR+G +LVE + 
Sbjct: 241 AGFIAGRTAPAGRTMGHAGAVISGGKGGAEDKIAAMESAGIKVSPSPARLGTTLVEAIK 299


>gi|119472924|ref|ZP_01614797.1| succinyl-CoA synthetase, alpha subunit, NAD(P)-binding protein
           [Alteromonadales bacterium TW-7]
 gi|119444642|gb|EAW25951.1| succinyl-CoA synthetase, alpha subunit, NAD(P)-binding protein
           [Alteromonadales bacterium TW-7]
          Length = 290

 Score =  346 bits (888), Expect = 2e-93,   Method: Composition-based stats.
 Identities = 173/298 (58%), Positives = 220/298 (73%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+TKV+ QG TG  GTFH+EQA+ Y  TQ+VGG+ P KG     G    +PVF 
Sbjct: 1   MSVLINKDTKVICQGFTGGQGTFHSEQALEY-GTQMVGGVSPGKGGQTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV +A + T A ASVIYVP     DAI+E+I+A I LIVCITEGIP LDMV VK +L+++
Sbjct: 56  TVRDAVQETGATASVIYVPAPFCKDAILEAIDAGIELIVCITEGIPTLDMVDVKVKLDQT 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            +R+IGPNCPG++TP   KIGIMPG I + G VGI+SRSGTLTYEAV QT+  G GQST 
Sbjct: 116 GTRMIGPNCPGVITPGETKIGIMPGHIHKLGKVGIVSRSGTLTYEAVKQTTDAGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ GT FIDVLE+F  D  TE+IVM+GEIGG+AEEEAA+++K        KP+V
Sbjct: 176 VGIGGDPIPGTNFIDVLEMFEKDPQTEAIVMIGEIGGTAEEEAAEYIKAN----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            ++AG TAP G+ MGHAGA+I+GGKG A++K  A++ AG+    S A IG++L E  G
Sbjct: 232 SYIAGVTAPEGKRMGHAGAIIAGGKGTADEKFAALEAAGVQTVRSLADIGKALKEKTG 289


>gi|89073523|ref|ZP_01160046.1| succinyl-CoA synthetase alpha subunit [Photobacterium sp. SKA34]
 gi|89050787|gb|EAR56268.1| succinyl-CoA synthetase alpha subunit [Photobacterium sp. SKA34]
          Length = 290

 Score =  346 bits (888), Expect = 2e-93,   Method: Composition-based stats.
 Identities = 181/296 (61%), Positives = 225/296 (76%), Gaps = 9/296 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+TKV+ QG TG  GTFH+EQAI Y  TQ+VGG+ P KG T   G    +PVF 
Sbjct: 1   MSVLINKDTKVICQGFTGGQGTFHSEQAIDY-GTQMVGGVSPGKGGTTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T A A+VIYVP     DAI+E+I+A I LIV ITEGIP LDM+ VK RL+++
Sbjct: 56  TVREAVEVTGATATVIYVPAPFCKDAILEAIDAGIELIVTITEGIPTLDMLDVKVRLDEA 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TPD CKIGIMPG I + G VGI+SRSGTLTYEAV QT+ EG GQST 
Sbjct: 116 GVRMIGPNCPGVITPDECKIGIMPGHIHKAGKVGIVSRSGTLTYEAVKQTTDEGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+LE+F  D ATE+IVM+GEIGG+AEEEAA ++K+       KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILEMFEKDPATEAIVMIGEIGGTAEEEAASYIKE----SVTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVEL 296
            ++AG TAPPG+ MGHAGA+ISGGKG AEDK  A++EAG+    S A IG++L E+
Sbjct: 232 SYIAGVTAPPGKRMGHAGAIISGGKGTAEDKFAALEEAGVKTVKSLADIGKALREV 287


>gi|311694416|gb|ADP97289.1| succinyl-CoA synthetase, alpha subunit [marine bacterium HP15]
          Length = 290

 Score =  346 bits (887), Expect = 2e-93,   Method: Composition-based stats.
 Identities = 173/298 (58%), Positives = 219/298 (73%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL++K+TKV+ QG TG  GTFH+EQAI Y  T++VGG+ P KG T   G    +PVF 
Sbjct: 1   MSILINKDTKVICQGFTGAQGTFHSEQAIAY-GTKMVGGVSPGKGGTEHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV +A E T A A+VIYVP     DAIIE+ +A I LIVCITEGIP +DM+  K  +++ 
Sbjct: 56  TVRDAVEATGAEATVIYVPAPFCKDAIIEAADAGIQLIVCITEGIPTIDMLYAKEYVDRK 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TPD CKIGIMPG I +KG VGI+SRSGTLTYEAV QT+  G GQST 
Sbjct: 116 GVRMIGPNCPGVITPDECKIGIMPGHIHKKGKVGIVSRSGTLTYEAVKQTTDFGYGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           +GIGGDP+ G+ FID+L L   D  TE+IVM+GEIGG+AEEEAA ++K        KP+V
Sbjct: 176 IGIGGDPIPGSNFIDILALLEKDPETEAIVMIGEIGGTAEEEAAAYIKQN----VSKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            ++AG TAPPG+ MGHAGA+ISGGKG A+DK  A+++AG+    S A IG++L E+ G
Sbjct: 232 SYIAGVTAPPGKRMGHAGAIISGGKGTADDKFAALEDAGVRTVRSLAEIGQALKEVTG 289


>gi|294141503|ref|YP_003557481.1| succinyl-CoA synthase subunit alpha [Shewanella violacea DSS12]
 gi|293327972|dbj|BAJ02703.1| succinyl-CoA synthase, alpha subunit [Shewanella violacea DSS12]
          Length = 290

 Score =  346 bits (887), Expect = 2e-93,   Method: Composition-based stats.
 Identities = 177/294 (60%), Positives = 219/294 (74%), Gaps = 9/294 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+TKV+ QG TG  GTFH+EQAI Y  TQ+VGG+ P KG     G    +PVF 
Sbjct: 1   MSVLINKDTKVICQGFTGGQGTFHSEQAIDY-GTQMVGGVSPGKGGKVHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA  +T A ASVIYVP     DAI+E+I+  I LIVCITEGIP LDM++VK +LE++
Sbjct: 56  TVKEAVAQTGATASVIYVPAPFCKDAILEAIDGGIELIVCITEGIPTLDMLQVKVKLEET 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TP  CKIGIMPG I + G VGI+SRSGTLTYEAV QT+ EG GQST 
Sbjct: 116 GVRMIGPNCPGVITPGECKIGIMPGHIHKPGKVGIVSRSGTLTYEAVKQTTDEGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ GT FIDVLELF  D  TE+IVM+GEIGG+AEEEAA+++K        KP+V
Sbjct: 176 VGIGGDPIPGTNFIDVLELFQNDPQTEAIVMIGEIGGTAEEEAAEYIKAH----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLV 294
            ++AG TAP G+ MGHAGA+I+GGKG AEDK  A++ AG+    S A IG++L 
Sbjct: 232 SYIAGVTAPEGKRMGHAGAIIAGGKGTAEDKFAALEAAGVTTVRSLADIGKALR 285


>gi|237838313|ref|XP_002368454.1| succinyl-CoA ligase alpha subunit, putative [Toxoplasma gondii
           ME49]
 gi|211966118|gb|EEB01314.1| succinyl-CoA ligase alpha subunit, putative [Toxoplasma gondii
           ME49]
 gi|221484277|gb|EEE22573.1| succinyl-CoA ligase alpha subunit, putative [Toxoplasma gondii GT1]
 gi|221505743|gb|EEE31388.1| succinyl-CoA ligase alpha subunit, putative [Toxoplasma gondii VEG]
          Length = 333

 Score =  346 bits (887), Expect = 2e-93,   Method: Composition-based stats.
 Identities = 178/300 (59%), Positives = 226/300 (75%), Gaps = 6/300 (2%)

Query: 3   ILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGN--VNVPVFT 60
           + VDKNTKV+ QGLTGK G+FHTEQ + Y  TQ VGG++P K  + W   +   ++PVF 
Sbjct: 33  VFVDKNTKVICQGLTGKQGSFHTEQCLAY-GTQFVGGVNPSKKGSTWQSSDGKFSLPVFG 91

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRV-KARLEK 119
           TV EAKE T  +AS+I+VPP  A  AI++ I  EIPL VCITEGIP  DMVRV +A L +
Sbjct: 92  TVKEAKEATGCDASMIFVPPPFAAQAIMDCIAEEIPLAVCITEGIPQQDMVRVKQALLSQ 151

Query: 120 SSSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQST 179
           + +RLIGPNCPGI+ P  CKIGIMPG I  KG +G++SRSGTLTYEAV QT+Q GLGQST
Sbjct: 152 NKTRLIGPNCPGIIKPGECKIGIMPGYIHAKGKIGVVSRSGTLTYEAVNQTTQTGLGQST 211

Query: 180 AVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPI 239
            VGIGGDP  GT FID LE F+ D  T+ IV++GEIGGSAEEEAA +LK+  K   +KP+
Sbjct: 212 CVGIGGDPFNGTNFIDCLERFVNDPETKGIVLIGEIGGSAEEEAAAWLKEHNKE--QKPV 269

Query: 240 VGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
           V F+AG TAPPGR MGHAGA++SGGKG AE KI A+++AG+ +  +PA +G+ ++E++ +
Sbjct: 270 VSFIAGLTAPPGRRMGHAGAIVSGGKGTAEGKIAALEDAGVHVVRNPAAMGQKMLEVMQA 329


>gi|23502775|ref|NP_698902.1| succinyl-CoA synthetase subunit alpha [Brucella suis 1330]
 gi|161619843|ref|YP_001593730.1| succinyl-CoA synthetase subunit alpha [Brucella canis ATCC 23365]
 gi|163843948|ref|YP_001628352.1| succinyl-CoA synthetase subunit alpha [Brucella suis ATCC 23445]
 gi|254700568|ref|ZP_05162396.1| succinyl-CoA synthetase subunit alpha [Brucella suis bv. 5 str.
           513]
 gi|254704938|ref|ZP_05166766.1| succinyl-CoA synthetase subunit alpha [Brucella suis bv. 3 str.
           686]
 gi|254707548|ref|ZP_05169376.1| succinyl-CoA synthetase subunit alpha [Brucella pinnipedialis
           M163/99/10]
 gi|254708915|ref|ZP_05170726.1| succinyl-CoA synthetase subunit alpha [Brucella pinnipedialis
           B2/94]
 gi|254717986|ref|ZP_05179797.1| succinyl-CoA synthetase subunit alpha [Brucella sp. 83/13]
 gi|256030441|ref|ZP_05444055.1| succinyl-CoA synthetase subunit alpha [Brucella pinnipedialis
           M292/94/1]
 gi|256059901|ref|ZP_05450087.1| succinyl-CoA synthetase subunit alpha [Brucella neotomae 5K33]
 gi|256158425|ref|ZP_05456323.1| succinyl-CoA synthetase subunit alpha [Brucella ceti M490/95/1]
 gi|256253845|ref|ZP_05459381.1| succinyl-CoA synthetase subunit alpha [Brucella ceti B1/94]
 gi|256370327|ref|YP_003107838.1| succinyl-CoA synthetase alpha subunit [Brucella microti CCM 4915]
 gi|260567586|ref|ZP_05838056.1| succinyl-CoA ligase [Brucella suis bv. 4 str. 40]
 gi|261220981|ref|ZP_05935262.1| succinyl-CoA synthetase subunit alpha [Brucella ceti B1/94]
 gi|261315031|ref|ZP_05954228.1| succinyl-CoA synthetase subunit alpha [Brucella pinnipedialis
           M163/99/10]
 gi|261316412|ref|ZP_05955609.1| succinyl-CoA synthetase subunit alpha [Brucella pinnipedialis
           B2/94]
 gi|261323871|ref|ZP_05963068.1| succinyl-CoA synthetase subunit alpha [Brucella neotomae 5K33]
 gi|261751074|ref|ZP_05994783.1| succinyl-CoA synthetase subunit alpha [Brucella suis bv. 5 str.
           513]
 gi|261755636|ref|ZP_05999345.1| succinyl-CoA synthetase subunit alpha [Brucella suis bv. 3 str.
           686]
 gi|265982930|ref|ZP_06095665.1| succinyl-CoA synthetase subunit alpha [Brucella sp. 83/13]
 gi|265987483|ref|ZP_06100040.1| succinyl-CoA synthetase subunit alpha [Brucella pinnipedialis
           M292/94/1]
 gi|265996940|ref|ZP_06109497.1| succinyl-CoA synthetase subunit alpha [Brucella ceti M490/95/1]
 gi|294851168|ref|ZP_06791841.1| succinyl-CoA ligase subunit alpha [Brucella sp. NVSL 07-0026]
 gi|306839764|ref|ZP_07472565.1| succinyl-CoA synthetase, alpha subunit [Brucella sp. NF 2653]
 gi|306842925|ref|ZP_07475561.1| succinyl-CoA synthetase, alpha subunit [Brucella sp. BO2]
 gi|23348795|gb|AAN30817.1| succinyl-CoA synthetase, alpha subunit [Brucella suis 1330]
 gi|161336654|gb|ABX62959.1| succinyl-CoA synthetase, alpha subunit [Brucella canis ATCC 23365]
 gi|163674671|gb|ABY38782.1| succinyl-CoA synthetase, alpha subunit [Brucella suis ATCC 23445]
 gi|256000490|gb|ACU48889.1| succinyl-CoA synthetase alpha subunit [Brucella microti CCM 4915]
 gi|260157104|gb|EEW92184.1| succinyl-CoA ligase [Brucella suis bv. 4 str. 40]
 gi|260919565|gb|EEX86218.1| succinyl-CoA synthetase subunit alpha [Brucella ceti B1/94]
 gi|261295635|gb|EEX99131.1| succinyl-CoA synthetase subunit alpha [Brucella pinnipedialis
           B2/94]
 gi|261299851|gb|EEY03348.1| succinyl-CoA synthetase subunit alpha [Brucella neotomae 5K33]
 gi|261304057|gb|EEY07554.1| succinyl-CoA synthetase subunit alpha [Brucella pinnipedialis
           M163/99/10]
 gi|261740827|gb|EEY28753.1| succinyl-CoA synthetase subunit alpha [Brucella suis bv. 5 str.
           513]
 gi|261745389|gb|EEY33315.1| succinyl-CoA synthetase subunit alpha [Brucella suis bv. 3 str.
           686]
 gi|262551408|gb|EEZ07398.1| succinyl-CoA synthetase subunit alpha [Brucella ceti M490/95/1]
 gi|264659680|gb|EEZ29941.1| succinyl-CoA synthetase subunit alpha [Brucella pinnipedialis
           M292/94/1]
 gi|264661522|gb|EEZ31783.1| succinyl-CoA synthetase subunit alpha [Brucella sp. 83/13]
 gi|294819757|gb|EFG36756.1| succinyl-CoA ligase subunit alpha [Brucella sp. NVSL 07-0026]
 gi|306286948|gb|EFM58468.1| succinyl-CoA synthetase, alpha subunit [Brucella sp. BO2]
 gi|306405119|gb|EFM61397.1| succinyl-CoA synthetase, alpha subunit [Brucella sp. NF 2653]
          Length = 300

 Score =  346 bits (887), Expect = 2e-93,   Method: Composition-based stats.
 Identities = 236/299 (78%), Positives = 270/299 (90%), Gaps = 1/299 (0%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTG-GNVNVPVF 59
           MSILV+K+TKVLVQGLTGK GTFHTEQA+ Y  TQ+VGGIHPKKG   W G     +P+F
Sbjct: 1   MSILVNKDTKVLVQGLTGKTGTFHTEQALAYYGTQMVGGIHPKKGGETWEGSKGEKLPIF 60

Query: 60  TTVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEK 119
            TVAE KERT A+ASVIYVPP+GA DAIIE+IEAEI  IVCITEGIPV+DMVRVK RLE+
Sbjct: 61  ATVAEGKERTGADASVIYVPPAGAADAIIEAIEAEIGFIVCITEGIPVMDMVRVKERLER 120

Query: 120 SSSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQST 179
           S SRL+GPNCPGILTP+ CKIGIMPG+IF+KGSVG++SRSGTLTYEAVFQTS EGLGQ+T
Sbjct: 121 SKSRLLGPNCPGILTPEECKIGIMPGNIFKKGSVGVVSRSGTLTYEAVFQTSNEGLGQTT 180

Query: 180 AVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPI 239
           AVGIGGDPVKGTEFIDVLE+FLAD+ T+SIVM+GEIGGSAEE+AAQFLKDEAKRGRKKP+
Sbjct: 181 AVGIGGDPVKGTEFIDVLEMFLADDETKSIVMIGEIGGSAEEDAAQFLKDEAKRGRKKPM 240

Query: 240 VGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           VGF+AG+TAP GRTMGHAGAVISGGKGGAEDKI AM+ AGI ++PSPA++G++LVE+L 
Sbjct: 241 VGFIAGRTAPAGRTMGHAGAVISGGKGGAEDKIAAMESAGIRVSPSPAQLGKTLVEVLK 299


>gi|15604297|ref|NP_220813.1| succinyl-CoA synthetase subunit alpha [Rickettsia prowazekii str.
           Madrid E]
 gi|3915042|sp|O08371|SUCD_RICPR RecName: Full=Succinyl-CoA ligase [ADP-forming] subunit alpha;
           AltName: Full=Succinyl-CoA synthetase subunit alpha;
           Short=SCS-alpha
 gi|2073501|emb|CAA72446.1| succinyl-CoA synthetase alpha-subunit [Rickettsia prowazekii]
 gi|3860989|emb|CAA14889.1| SUCCINYL-COA LIGASE (sucD) [Rickettsia prowazekii]
          Length = 292

 Score =  346 bits (887), Expect = 3e-93,   Method: Composition-based stats.
 Identities = 180/300 (60%), Positives = 230/300 (76%), Gaps = 8/300 (2%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           M+IL++K TKV+ QG TG  GTFH+EQAI Y  T +VGG+ P KG        +N+PV+ 
Sbjct: 1   MAILINKKTKVICQGFTGSQGTFHSEQAIAY-GTNMVGGVTPGKGGHTH----LNLPVYN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EAK +T ANASVIYVPP  A D+I+E+I+A+I ++VCITEGIPVLDM++VK  L  S
Sbjct: 56  TVHEAKAKTGANASVIYVPPGFAADSILEAIDAKIEVVVCITEGIPVLDMIKVKRALIGS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            +RLIGPNCPG++TP  CKIGIMPG I + G +GI+SRSGTLTYEAV QT+  GLGQST 
Sbjct: 116 KTRLIGPNCPGVITPGECKIGIMPGHIHKIGDIGIVSRSGTLTYEAVAQTTAAGLGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPV GT F+D +E+FL D+ T++I+M+GEIGGSAEE+AA F+K       KKPIV
Sbjct: 176 VGIGGDPVNGTSFVDCIEMFLQDDETKAIIMIGEIGGSAEEDAADFIKQ---SKIKKPIV 232

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGSL 300
            F+AG TAP  + MGHAGA+ISGGKG AEDK+  ++ AG+ I  SPA IG+++++LL  +
Sbjct: 233 SFIAGITAPADKRMGHAGAIISGGKGSAEDKVEVLQSAGVIITRSPADIGKTMLDLLNKI 292


>gi|59711433|ref|YP_204209.1| succinyl-CoA synthetase subunit alpha [Vibrio fischeri ES114]
 gi|197336007|ref|YP_002155588.1| succinyl-CoA ligase (ADP-forming) subunit alpha [Vibrio fischeri
           MJ11]
 gi|59479534|gb|AAW85321.1| succinyl-CoA synthetase, NAD(P)-binding, alpha subunit [Vibrio
           fischeri ES114]
 gi|197317497|gb|ACH66944.1| succinyl-CoA ligase (ADP-forming) subunit alpha [Vibrio fischeri
           MJ11]
          Length = 290

 Score =  346 bits (887), Expect = 3e-93,   Method: Composition-based stats.
 Identities = 179/298 (60%), Positives = 221/298 (74%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+TKV+ QG TG  GTFH+EQAI Y  TQ+VGG+ P KG     G    +PVF 
Sbjct: 1   MSVLINKDTKVICQGFTGGQGTFHSEQAIDY-GTQMVGGVSPGKGGQVHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV +A E T A ASVIYVP     DAI+E+I+A I LIV ITEGIP LD++ VK RL+  
Sbjct: 56  TVRDAVEATGATASVIYVPAPFCKDAILEAIDAGIKLIVTITEGIPTLDLLDVKVRLDAE 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
              +IGPNCPG++TPD CKIGIMPG I +KG VGI+SRSGTLTYEAV QT+ EG GQST 
Sbjct: 116 GVVMIGPNCPGVITPDECKIGIMPGHIHKKGKVGIVSRSGTLTYEAVKQTTDEGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L+LF  D  TE+IVM+GEIGG+AEEEAA ++K        KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILKLFQEDPETEAIVMIGEIGGTAEEEAAAYIKAN----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            ++AG TAPPG+ MGHAGA+ISGGKG AEDK  A++EAG+    S A IG++L E+ G
Sbjct: 232 SYIAGVTAPPGKRMGHAGAIISGGKGTAEDKFAALEEAGVKTVKSLADIGKALREVTG 289


>gi|254509020|ref|ZP_05121125.1| succinyl-CoA ligase, alpha subunit [Vibrio parahaemolyticus 16]
 gi|312884953|ref|ZP_07744643.1| succinyl-CoA synthetase subunit alpha [Vibrio caribbenthicus ATCC
           BAA-2122]
 gi|219548055|gb|EED25075.1| succinyl-CoA ligase, alpha subunit [Vibrio parahaemolyticus 16]
 gi|309367430|gb|EFP94992.1| succinyl-CoA synthetase subunit alpha [Vibrio caribbenthicus ATCC
           BAA-2122]
          Length = 290

 Score =  346 bits (887), Expect = 3e-93,   Method: Composition-based stats.
 Identities = 180/298 (60%), Positives = 222/298 (74%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+TKV+ QG TG  GTFH+EQAI Y  TQ+VGG+ P KG     G    +PVF 
Sbjct: 1   MSVLINKDTKVICQGFTGGQGTFHSEQAIAY-GTQMVGGVSPGKGGQTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T A A+VIYVP     DAI+E+I+A I LIV ITEGIP  DM+ VK +LE++
Sbjct: 56  TVREAVEATGATATVIYVPAPFCKDAILEAIDAGIELIVTITEGIPTTDMIDVKVKLEET 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TPD CKIGIMPG I +KG VGI+SRSGTLTYEAV QT+ EG GQST 
Sbjct: 116 GVRMIGPNCPGLITPDECKIGIMPGHIHKKGKVGIVSRSGTLTYEAVKQTTDEGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L+LF  D  TE+IVM+GEIGG+AEEEAA F+K+       KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILKLFQEDPETEAIVMIGEIGGTAEEEAAAFIKEN----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            ++AG TAPPG+ MGHAGA+ISGGKG AEDK  A++ AG+    S A IG+ L E+ G
Sbjct: 232 SYIAGVTAPPGKRMGHAGAIISGGKGTAEDKFAALEAAGVKTVKSLADIGKGLREITG 289


>gi|330445472|ref|ZP_08309124.1| succinyl-CoA synthetase, alpha subunit [Photobacterium leiognathi
           subsp. mandapamensis svers.1.1.]
 gi|328489663|dbj|GAA03621.1| succinyl-CoA synthetase, alpha subunit [Photobacterium leiognathi
           subsp. mandapamensis svers.1.1.]
          Length = 290

 Score =  346 bits (887), Expect = 3e-93,   Method: Composition-based stats.
 Identities = 182/296 (61%), Positives = 225/296 (76%), Gaps = 9/296 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+TKV+ QG TG  GTFH+EQAI Y  TQ+VGG+ P KG T   G    +PVF 
Sbjct: 1   MSVLINKDTKVICQGFTGGQGTFHSEQAIAY-GTQMVGGVSPGKGGTTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T A A+VIYVP     DAI+E+I+A I LIV ITEGIP LDM+ VK RL+++
Sbjct: 56  TVREAVEVTGATATVIYVPAPFCKDAILEAIDAGIELIVTITEGIPTLDMLDVKVRLDEA 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TPD CKIGIMPG I + G VGI+SRSGTLTYEAV QT+ EG GQST 
Sbjct: 116 GVRMIGPNCPGVITPDECKIGIMPGHIHKAGKVGIVSRSGTLTYEAVKQTTDEGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+LE+F  D ATE+IVM+GEIGG+AEEEAA ++KD       KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILEMFEKDPATEAIVMIGEIGGTAEEEAAAYIKDN----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVEL 296
            ++AG TAPPG+ MGHAGA+ISGGKG AEDK  A++EAG+    S A IG++L E+
Sbjct: 232 SYIAGVTAPPGKRMGHAGAIISGGKGTAEDKFAALEEAGVKTVKSLADIGKALREV 287


>gi|226945041|ref|YP_002800114.1| Succinyl-CoA ligase subunit alpha [Azotobacter vinelandii DJ]
 gi|226719968|gb|ACO79139.1| Succinyl-CoA ligase, alpha subunit [Azotobacter vinelandii DJ]
          Length = 295

 Score =  346 bits (887), Expect = 3e-93,   Method: Composition-based stats.
 Identities = 172/298 (57%), Positives = 218/298 (73%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSILV+K+TKV+ QG TG  GTFH+EQAI Y  T++VGG+ P KG        +++PVF 
Sbjct: 1   MSILVNKDTKVICQGFTGSQGTFHSEQAIAY-GTRMVGGVTPGKGGLVH----LDLPVFD 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T A+ASVIYVP     D+I+E+  A + LIVCITEG+P LDM++VK + ++ 
Sbjct: 56  TVREAVEATGADASVIYVPAPFCKDSILEAAFAGVRLIVCITEGVPTLDMLQVKLKCDEL 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             RLIGPNCPG++TP  CKIGI PG+I   G VGI+SRSGTLTYEAV QT+  G GQST 
Sbjct: 116 GVRLIGPNCPGVITPGECKIGIQPGNIHMPGRVGIVSRSGTLTYEAVKQTTDAGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L LF  D  TE+IVM+GEIGGSAEEEAA ++K        KP+V
Sbjct: 176 VGIGGDPIPGSSFIDILGLFQDDPQTEAIVMIGEIGGSAEEEAAAYIKA----KVDKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            ++AG TAP G+ MGHAGA+ISGGKG A++K  A+++AG+    S A IG++L EL G
Sbjct: 232 SYIAGVTAPSGKRMGHAGAIISGGKGTADEKFAALQDAGVQTVRSLADIGKALAELTG 289


>gi|91793534|ref|YP_563185.1| succinyl-CoA synthetase, alpha subunit [Shewanella denitrificans
           OS217]
 gi|91715536|gb|ABE55462.1| succinyl-CoA synthetase (ADP-forming) alpha subunit [Shewanella
           denitrificans OS217]
          Length = 290

 Score =  346 bits (887), Expect = 3e-93,   Method: Composition-based stats.
 Identities = 174/294 (59%), Positives = 219/294 (74%), Gaps = 9/294 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+TKV+ QG TG  GTFH+EQAI Y  T++VGG+ P KG     G    +PVF 
Sbjct: 1   MSVLINKDTKVICQGFTGGQGTFHSEQAIAY-GTKMVGGVSPGKGGQVHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV +A   T A A+VIYVP     DAI+E+I+A I LIVCITEGIP LDM++VK +LE++
Sbjct: 56  TVKDAVAETGATATVIYVPAPFCKDAILEAIDAGIELIVCITEGIPTLDMLQVKVKLEET 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TP  CKIGIMPG I + G VGI+SRSGTLTYEAV QT+ EG GQST 
Sbjct: 116 GVRMIGPNCPGVITPGECKIGIMPGHIHKPGRVGIVSRSGTLTYEAVKQTTDEGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ GT FIDVLE+F  D  TE+IVM+GEIGG+AEEEAA+++K        KP+V
Sbjct: 176 VGIGGDPIPGTNFIDVLEMFQNDPKTEAIVMIGEIGGNAEEEAAEYIKAH----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLV 294
            ++AG TAP G+ MGHAGA+I+GGKG AEDK  A++ AG+    S A IG++L 
Sbjct: 232 SYIAGVTAPEGKRMGHAGAIIAGGKGTAEDKFAALEAAGVTTVRSLADIGKALR 285


>gi|156973655|ref|YP_001444562.1| succinyl-CoA synthetase subunit alpha [Vibrio harveyi ATCC
           BAA-1116]
 gi|163802533|ref|ZP_02196425.1| succinyl-CoA synthetase subunit alpha [Vibrio sp. AND4]
 gi|269960712|ref|ZP_06175084.1| succinyl-CoA synthetase alpha subunit [Vibrio harveyi 1DA3]
 gi|156525249|gb|ABU70335.1| hypothetical protein VIBHAR_01358 [Vibrio harveyi ATCC BAA-1116]
 gi|159173616|gb|EDP58435.1| succinyl-CoA synthetase subunit alpha [Vibrio sp. AND4]
 gi|269834789|gb|EEZ88876.1| succinyl-CoA synthetase alpha subunit [Vibrio harveyi 1DA3]
          Length = 290

 Score =  346 bits (887), Expect = 3e-93,   Method: Composition-based stats.
 Identities = 179/298 (60%), Positives = 222/298 (74%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+TKV+ QG TG  GTFH+EQAI Y  TQ+VGG+ P KG     G    +PVF 
Sbjct: 1   MSVLINKDTKVICQGFTGGQGTFHSEQAIAY-GTQMVGGVSPGKGGQTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T A A+VIYVP     DAI+E+I+A I LIV ITEGIP  DM+ VK +LE++
Sbjct: 56  TVREAVEVTGATATVIYVPAPFCKDAILEAIDAGIELIVTITEGIPTTDMIDVKVKLEET 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TPD CKIGIMPG I +KG VGI+SRSGTLTYEAV QT+ EG GQST 
Sbjct: 116 GVRMIGPNCPGVITPDECKIGIMPGHIHKKGKVGIVSRSGTLTYEAVKQTTDEGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L+LF  D  TE+IVM+GEIGG+AEEEAA ++K+       KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILKLFQEDPETEAIVMIGEIGGTAEEEAAAYIKEN----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            ++AG TAPPG+ MGHAGA+ISGGKG AEDK  A++ AG+    S A IG+ L E+ G
Sbjct: 232 SYIAGVTAPPGKRMGHAGAIISGGKGTAEDKFAALEAAGVKTVKSLAEIGKGLREVTG 289


>gi|149911918|ref|ZP_01900517.1| succinyl-CoA synthetase, alpha subunit, NAD(P)-binding [Moritella
           sp. PE36]
 gi|149805011|gb|EDM65039.1| succinyl-CoA synthetase, alpha subunit, NAD(P)-binding [Moritella
           sp. PE36]
          Length = 289

 Score =  346 bits (887), Expect = 3e-93,   Method: Composition-based stats.
 Identities = 174/298 (58%), Positives = 219/298 (73%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL++K+TKV+ QG TG  GTFH+EQA  Y  TQ+VGG+ P KG T   G    +PVF 
Sbjct: 1   MSILINKDTKVICQGFTGGQGTFHSEQAADY-GTQMVGGVSPGKGGTTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV +A E T A ASVIYVP     DAI+E+I+A I LIVCITEGIP +DM+ VK +L++ 
Sbjct: 56  TVRDAVETTGATASVIYVPAPFCKDAILEAIDAGIELIVCITEGIPTVDMIEVKVKLDQQ 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
           + R+IGPNCPG++TP   KIGIMPG I + G +GI+SRSGTLTYEAV QT+ EG GQST 
Sbjct: 116 NVRMIGPNCPGVITPGESKIGIMPGHIHKPGKIGIVSRSGTLTYEAVKQTTDEGYGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ GT FID+LELF  D  TE+IVM+GEIGG+AEEEAA ++K        KP+V
Sbjct: 176 VGIGGDPIPGTNFIDILELFENDPQTEAIVMIGEIGGTAEEEAAAYIKAN----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            ++AG TAP G+ MGHAGA+I+GGKG A++K  A+++AG+    S A IG +L   LG
Sbjct: 232 SYIAGVTAPAGKRMGHAGAIIAGGKGTADEKFAALEDAGVSTVRSLADIGSALRAKLG 289


>gi|70729112|ref|YP_258848.1| succinyl-CoA synthetase subunit alpha [Pseudomonas fluorescens
           Pf-5]
 gi|68343411|gb|AAY91017.1| succinyl-CoA synthetase, alpha subunit [Pseudomonas fluorescens
           Pf-5]
          Length = 293

 Score =  346 bits (887), Expect = 3e-93,   Method: Composition-based stats.
 Identities = 170/298 (57%), Positives = 215/298 (72%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+TKV+ QG+TG  G+FHT+QAI Y  T++VGG+ P KG T   G    +PVF 
Sbjct: 1   MSVLINKDTKVICQGITGSQGSFHTQQAIEY-GTKMVGGVTPGKGGTEHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV +A   T A ASVIYVP     D+I+E+    I LIVCITEGIP LDM+  K + ++ 
Sbjct: 56  TVKDAVAATGATASVIYVPAPFCKDSILEAAFGGIKLIVCITEGIPTLDMLDAKVKCDEL 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
              LIGPNCPG++TP  CKIGIMPG I   G VGI+SRSGTLTYEAV QT+  G GQST 
Sbjct: 116 GVTLIGPNCPGVITPGECKIGIMPGHIHLPGKVGIVSRSGTLTYEAVKQTTDAGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L+LF  D  TE+IVM+GEIGGSAEEEAA ++K        KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILKLFQEDPKTEAIVMIGEIGGSAEEEAAAYIKAH----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            ++AG TAPPG+ MGHAGA+ISGGKG A++K  A+++AG+    S A IG++L EL G
Sbjct: 232 SYIAGVTAPPGKRMGHAGAIISGGKGTADEKFAALQDAGVKTVRSLADIGKALAELTG 289


>gi|212712442|ref|ZP_03320570.1| hypothetical protein PROVALCAL_03536 [Providencia alcalifaciens DSM
           30120]
 gi|212684899|gb|EEB44427.1| hypothetical protein PROVALCAL_03536 [Providencia alcalifaciens DSM
           30120]
          Length = 290

 Score =  346 bits (887), Expect = 3e-93,   Method: Composition-based stats.
 Identities = 174/299 (58%), Positives = 219/299 (73%), Gaps = 9/299 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL+DKNTKV+ QG TG  GTFH+EQAI Y  T++VGG+ P KG T   G    +PVF 
Sbjct: 1   MSILIDKNTKVICQGFTGGQGTFHSEQAIAY-GTKMVGGVTPGKGGTIHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T A ASVIYVP     D+I+E+I+A I LI+ ITEGIP LDM+ VK +L+++
Sbjct: 56  TVREAVEATGATASVIYVPAPFCKDSILEAIDAGIKLIITITEGIPTLDMLTVKVKLDEA 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TP  CKIGI PG I   G VGI+SRSGTLTYEAV QT+  GLGQST 
Sbjct: 116 GVRMIGPNCPGVITPGECKIGIQPGHIHMPGKVGIVSRSGTLTYEAVKQTTDAGLGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L+LF  D  TE+IVM+GEIGG+AEEEAA ++K+       KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILKLFQEDPQTEAIVMIGEIGGNAEEEAAAYIKEH----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
           G++AG TAP G+ MGHAGA+I+GGKG A++K  A++ AG+    S A IG ++  LL  
Sbjct: 232 GYIAGVTAPKGKRMGHAGAIIAGGKGTADEKFAALEAAGVKTVRSLADIGDAVKSLLNK 290


>gi|254514205|ref|ZP_05126266.1| succinyl-CoA ligase, alpha subunit [gamma proteobacterium NOR5-3]
 gi|219676448|gb|EED32813.1| succinyl-CoA ligase, alpha subunit [gamma proteobacterium NOR5-3]
          Length = 290

 Score =  346 bits (887), Expect = 3e-93,   Method: Composition-based stats.
 Identities = 171/298 (57%), Positives = 215/298 (72%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL++K+TKV+ QG TG  GTFH+EQAI Y  T++VGG+ P KG     G    +PVF 
Sbjct: 1   MSILINKDTKVICQGFTGSQGTFHSEQAIEY-GTKMVGGVTPGKGGQEHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TVAEA E T A+ASVIYVP     D+I+E+    + L+VCITEGIP LDM+  K + ++ 
Sbjct: 56  TVAEAVEATGADASVIYVPAPFCKDSILEAANGGVKLVVCITEGIPTLDMLEAKVKCDEL 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             RL+GPNCPG++TP  CKIGIMPG I   G VGI+SRSGTLTYEAV QTS  G GQST 
Sbjct: 116 GVRLVGPNCPGVITPGECKIGIMPGHIHLPGKVGIVSRSGTLTYEAVKQTSDAGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L +F AD ATE+IVM+GEIGG+AEEEAA ++K        KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILAMFEADPATEAIVMIGEIGGTAEEEAAAYIKAN----VSKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            ++AG TAP G+ MGHAGA+ISGGKG A++K  A+++AG+    S A IG  L E+ G
Sbjct: 232 SYIAGVTAPKGKRMGHAGAIISGGKGTADEKFAALEDAGVKTVRSLADIGAGLKEITG 289


>gi|145299310|ref|YP_001142151.1| succinyl-CoA ligase, alpha subunit [Aeromonas salmonicida subsp.
           salmonicida A449]
 gi|142852082|gb|ABO90403.1| succinyl-CoA ligase, alpha subunit [Aeromonas salmonicida subsp.
           salmonicida A449]
          Length = 290

 Score =  346 bits (887), Expect = 3e-93,   Method: Composition-based stats.
 Identities = 175/298 (58%), Positives = 221/298 (74%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+TKV+ QG TG  GTFH+EQAI Y  TQ+VGG+ P KG T   G    +PVF 
Sbjct: 1   MSVLINKDTKVICQGFTGGQGTFHSEQAIAY-GTQMVGGVSPGKGGTTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV +A E T A ASVIYVP     DAI+E+I+A I LIV ITEGIP LDM+ VK +L+++
Sbjct: 56  TVRDAVETTGATASVIYVPAPFCKDAILEAIDAGIKLIVTITEGIPTLDMLEVKVKLQET 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TP  CKIGIMPG I + G VGI+SRSGTLTYEAV QT+ EG GQST 
Sbjct: 116 GVRMIGPNCPGVITPGECKIGIMPGHIHKPGKVGIVSRSGTLTYEAVKQTTDEGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+LE+F  D  TE+IVM+GEIGGSAEEEAA ++K        KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILEMFQNDPKTEAIVMIGEIGGSAEEEAAAYIKAH----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            ++AG TAP G+ MGHAGA+I+GGKG A +K  A+++AG+    S A IG++L E+ G
Sbjct: 232 SYIAGVTAPAGKRMGHAGAIIAGGKGTAAEKFAALEDAGVKTVRSLADIGKALREVTG 289


>gi|225024310|ref|ZP_03713502.1| hypothetical protein EIKCOROL_01185 [Eikenella corrodens ATCC
           23834]
 gi|224942895|gb|EEG24104.1| hypothetical protein EIKCOROL_01185 [Eikenella corrodens ATCC
           23834]
          Length = 296

 Score =  346 bits (887), Expect = 3e-93,   Method: Composition-based stats.
 Identities = 166/301 (55%), Positives = 223/301 (74%), Gaps = 11/301 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+TKVLVQG TGK GTFH+EQAI Y  T+VVGG+ P KG     G    +PVF 
Sbjct: 1   MSVLINKDTKVLVQGFTGKNGTFHSEQAIAY-GTKVVGGVTPGKGGQTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARL--E 118
           T+ EA   T A+ASVIYVP     D+I+E++++ + L+V ITEG+P LDM++ K  L   
Sbjct: 56  TMNEAVRETGADASVIYVPAPFVLDSIVEAVDSGVKLVVVITEGVPTLDMLKAKRYLETN 115

Query: 119 KSSSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQS 178
            + +RL+GPNCPG++TP  CKIGIMPG I + G +GI+SRSGTLTYEAV QT++ GLGQS
Sbjct: 116 GNGTRLVGPNCPGVITPGECKIGIMPGHIHQPGKIGIISRSGTLTYEAVAQTTKLGLGQS 175

Query: 179 TAVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKP 238
           T +GIGGDP+ G   ID L+LF AD  TE+I+++GEIGG+AEEEAA+F++        KP
Sbjct: 176 TCIGIGGDPIPGMNQIDALKLFEADPQTEAIILIGEIGGTAEEEAAEFIQSN----VSKP 231

Query: 239 IVGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           +VG++AG TAP G+ MGHAGA+ISGGKG AE+K  A ++AG+    SPA +G +++E+L 
Sbjct: 232 VVGYIAGVTAPKGKRMGHAGAIISGGKGTAEEKFRAFEKAGVAYTRSPAELGSTMLEVLK 291

Query: 299 S 299
           +
Sbjct: 292 A 292


>gi|148559537|ref|YP_001259749.1| succinyl-CoA synthetase subunit alpha [Brucella ovis ATCC 25840]
 gi|148370794|gb|ABQ60773.1| succinyl-CoA synthetase, alpha subunit [Brucella ovis ATCC 25840]
          Length = 300

 Score =  346 bits (887), Expect = 3e-93,   Method: Composition-based stats.
 Identities = 237/299 (79%), Positives = 271/299 (90%), Gaps = 1/299 (0%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTG-GNVNVPVF 59
           MSILV+K+TKVLVQGLTGK GTFHTEQA+ Y  TQ+VGGIHPKKG   W G     +P+F
Sbjct: 1   MSILVNKDTKVLVQGLTGKTGTFHTEQALAYYGTQMVGGIHPKKGGETWEGSKGEKLPIF 60

Query: 60  TTVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEK 119
           TTVAE KERT A+ASVIYVPP+GA DAIIE+IEAEI  IVCITEGIPV+DMVRVK RLE+
Sbjct: 61  TTVAEGKERTGADASVIYVPPAGAADAIIEAIEAEIGFIVCITEGIPVMDMVRVKERLER 120

Query: 120 SSSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQST 179
           S SRL+GPNCPGILTP+ CKIGIMPG+IF+KGSVG++SRSGTLTYEAVFQTS EGLGQ+T
Sbjct: 121 SKSRLLGPNCPGILTPEECKIGIMPGNIFKKGSVGVVSRSGTLTYEAVFQTSNEGLGQTT 180

Query: 180 AVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPI 239
           AVGIGGDPVKGTEFIDVLE+FLAD+ T+SIVM+GEIGGSAEE+AAQFLKDEAKRGRKKP+
Sbjct: 181 AVGIGGDPVKGTEFIDVLEMFLADDETKSIVMIGEIGGSAEEDAAQFLKDEAKRGRKKPM 240

Query: 240 VGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           VGF+AG+TAP GRTMGHAGAVISGGKGGAEDKI AM+ AGI ++PSPA++G++LVE+L 
Sbjct: 241 VGFIAGRTAPAGRTMGHAGAVISGGKGGAEDKIAAMESAGIRVSPSPAQLGKTLVEVLK 299


>gi|15966807|ref|NP_387160.1| succinyl-CoA synthetase subunit alpha [Sinorhizobium meliloti 1021]
 gi|307301635|ref|ZP_07581394.1| succinyl-CoA synthetase, alpha subunit [Sinorhizobium meliloti
           BL225C]
 gi|307316341|ref|ZP_07595785.1| succinyl-CoA synthetase, alpha subunit [Sinorhizobium meliloti
           AK83]
 gi|15076079|emb|CAC47633.1| Probable succinyl-CoA synthetase alpha chain [Sinorhizobium
           meliloti 1021]
 gi|306898181|gb|EFN28923.1| succinyl-CoA synthetase, alpha subunit [Sinorhizobium meliloti
           AK83]
 gi|306903333|gb|EFN33922.1| succinyl-CoA synthetase, alpha subunit [Sinorhizobium meliloti
           BL225C]
          Length = 300

 Score =  346 bits (887), Expect = 3e-93,   Method: Composition-based stats.
 Identities = 239/299 (79%), Positives = 273/299 (91%), Gaps = 1/299 (0%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTG-GNVNVPVF 59
           MSIL++K+TKVLVQGLTGK GTFHTEQA+ Y  T++VGGIHPKKG   WTG     +P+F
Sbjct: 1   MSILINKDTKVLVQGLTGKTGTFHTEQALAYNGTKMVGGIHPKKGGETWTGAKGEQLPIF 60

Query: 60  TTVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEK 119
            TVAE ++ T ANASVIYVPP+GA  AIIE+I+AEIPLIVCITEGIPV DMV+VKARLEK
Sbjct: 61  ATVAEGRDATGANASVIYVPPAGAAAAIIEAIDAEIPLIVCITEGIPVADMVKVKARLEK 120

Query: 120 SSSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQST 179
           SSSRLIGPNCPG+LTPD CKIGIMPG+IFRKGSVG+LSRSGTLTYEAVFQT+ EGLGQ+T
Sbjct: 121 SSSRLIGPNCPGVLTPDECKIGIMPGNIFRKGSVGVLSRSGTLTYEAVFQTTNEGLGQTT 180

Query: 180 AVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPI 239
           AVGIGGDPVKGTEFIDVLE+FLAD+ T+SI+M+GEIGGSAEEEAAQFLKDEAKRGRKKP+
Sbjct: 181 AVGIGGDPVKGTEFIDVLEMFLADDETKSIIMIGEIGGSAEEEAAQFLKDEAKRGRKKPM 240

Query: 240 VGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           VGF+AG+TAPPGRTMGHAGAVISGGKGGAEDKI AM+ AGI ++PSPAR+G++LVE+L 
Sbjct: 241 VGFIAGRTAPPGRTMGHAGAVISGGKGGAEDKIAAMESAGIRVSPSPARLGKTLVEVLK 299


>gi|323158778|gb|EFZ44791.1| succinyl-CoA ligase [ADP-forming] subunit alpha [Escherichia coli
           E128010]
          Length = 289

 Score =  346 bits (887), Expect = 3e-93,   Method: Composition-based stats.
 Identities = 172/298 (57%), Positives = 217/298 (72%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL+DKNTKV+ QG TG  GTFH+EQAI Y  T++VGG+ P KG T   G    +PVF 
Sbjct: 1   MSILIDKNTKVICQGFTGSQGTFHSEQAIAY-GTKMVGGVTPGKGGTTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA   T A ASVIYVP     D+I+E+I+A I LI+ ITEGIP LDM+ VK +L+++
Sbjct: 56  TVREAVAATGATASVIYVPAPFCKDSILEAIDAGIKLIITITEGIPTLDMLTVKVKLDEA 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TP  CKIGI PG I + G VGI+SRSGTLTYEAV QT+  G GQST 
Sbjct: 116 GVRMIGPNCPGVITPGECKIGIQPGHIHKPGKVGIVSRSGTLTYEAVKQTTDYGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+LE+F  D  TE+IVM+GEIGGSAEEEAA ++K+       KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILEMFEKDPQTEAIVMIGEIGGSAEEEAAAYIKEH----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           G++AG TAP G+ MGHAGA+I+GGKG A++K  A++ AG+    S   IG +L  +L 
Sbjct: 232 GYIAGVTAPKGKRMGHAGAIIAGGKGTADEKFAALEAAGVKTVRSLVDIGEALKTVLK 289


>gi|225628125|ref|ZP_03786160.1| succinyl-CoA synthetase, alpha subunit [Brucella ceti str. Cudo]
 gi|260169351|ref|ZP_05756162.1| succinyl-CoA synthetase subunit alpha [Brucella sp. F5/99]
 gi|261758867|ref|ZP_06002576.1| succinyl-CoA ligase [Brucella sp. F5/99]
 gi|225616950|gb|EEH13997.1| succinyl-CoA synthetase, alpha subunit [Brucella ceti str. Cudo]
 gi|261738851|gb|EEY26847.1| succinyl-CoA ligase [Brucella sp. F5/99]
          Length = 300

 Score =  345 bits (886), Expect = 3e-93,   Method: Composition-based stats.
 Identities = 235/299 (78%), Positives = 269/299 (89%), Gaps = 1/299 (0%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTG-GNVNVPVF 59
           MSILV+K+TKVLVQGLTGK GTFHTEQA+ Y  TQ+VGGIHPKKG   W G     +P+F
Sbjct: 1   MSILVNKDTKVLVQGLTGKTGTFHTEQALAYYGTQMVGGIHPKKGGETWEGSKGEKLPIF 60

Query: 60  TTVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEK 119
            TVAE KERT A+ASVIYVP +GA DAIIE+IEAEI  IVCITEGIPV+DMVRVK RLE+
Sbjct: 61  ATVAEGKERTGADASVIYVPLAGAADAIIEAIEAEIGFIVCITEGIPVMDMVRVKERLER 120

Query: 120 SSSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQST 179
           S SRL+GPNCPGILTP+ CKIGIMPG+IF+KGSVG++SRSGTLTYEAVFQTS EGLGQ+T
Sbjct: 121 SKSRLLGPNCPGILTPEECKIGIMPGNIFKKGSVGVVSRSGTLTYEAVFQTSNEGLGQTT 180

Query: 180 AVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPI 239
           AVGIGGDPVKGTEFIDVLE+FLAD+ T+SIVM+GEIGGSAEE+AAQFLKDEAKRGRKKP+
Sbjct: 181 AVGIGGDPVKGTEFIDVLEMFLADDETKSIVMIGEIGGSAEEDAAQFLKDEAKRGRKKPM 240

Query: 240 VGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           VGF+AG+TAP GRTMGHAGAVISGGKGGAEDKI AM+ AGI ++PSPA++G++LVE+L 
Sbjct: 241 VGFIAGRTAPAGRTMGHAGAVISGGKGGAEDKIAAMESAGIRVSPSPAQLGKTLVEVLK 299


>gi|262276211|ref|ZP_06054020.1| succinyl-CoA ligase [ADP-forming] alpha chain [Grimontia hollisae
           CIP 101886]
 gi|262220019|gb|EEY71335.1| succinyl-CoA ligase [ADP-forming] alpha chain [Grimontia hollisae
           CIP 101886]
          Length = 290

 Score =  345 bits (886), Expect = 3e-93,   Method: Composition-based stats.
 Identities = 177/294 (60%), Positives = 221/294 (75%), Gaps = 9/294 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+TKV+ QG TG  GTFH+EQAI Y  TQ+VGG+ P KG T   G    +PVF 
Sbjct: 1   MSVLINKDTKVICQGFTGGQGTFHSEQAIEY-GTQMVGGVSPGKGGTTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TVAEA E T A A+VIYVP     DAI+E+I+A I LIV ITEGIP LDM+ VK +L+++
Sbjct: 56  TVAEAVEATGATATVIYVPAPFCKDAILEAIDAGIELIVTITEGIPTLDMLEVKVKLDEA 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TP  CKIGIMPG I + G VGI+SRSGTLTYEAV QT+ EG GQST 
Sbjct: 116 GVRMIGPNCPGVITPGECKIGIMPGHIHKPGKVGIVSRSGTLTYEAVKQTTDEGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L++F  D  TE+IVM+GEIGG+AEEEAA F+K+       KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILKMFEEDPQTEAIVMIGEIGGTAEEEAAAFIKEN----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLV 294
            ++AG TAPPG+ MGHAGA+ISGGKG AEDK  A++ AG+    S A IG++L 
Sbjct: 232 SYIAGVTAPPGKRMGHAGAIISGGKGTAEDKFAALEAAGVTTVKSLADIGKALR 285


>gi|260901286|ref|ZP_05909681.1| succinyl-CoA ligase (ADP-forming) subunit alpha [Vibrio
           parahaemolyticus AQ4037]
 gi|308109842|gb|EFO47382.1| succinyl-CoA ligase (ADP-forming) subunit alpha [Vibrio
           parahaemolyticus AQ4037]
          Length = 290

 Score =  345 bits (886), Expect = 3e-93,   Method: Composition-based stats.
 Identities = 180/298 (60%), Positives = 222/298 (74%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+TKV+ QG TG  GTFH+EQAI Y  TQ+VGG+ P KG     G    +PVF 
Sbjct: 1   MSVLINKDTKVICQGFTGGQGTFHSEQAIAY-GTQMVGGVSPGKGGQTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T A A+VIYVP     DAI+E+I+A I LIV ITEGIP  DM+ VK +LE++
Sbjct: 56  TVREAVEATGATATVIYVPAPFCKDAILEAIDAGIELIVTITEGIPTTDMIDVKVKLEET 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TPD CKIGIMPG I +KG VGI+SRSGTLTYEAV QT+ EG GQST 
Sbjct: 116 GVRMIGPNCPGVITPDECKIGIMPGHIHKKGKVGIVSRSGTLTYEAVKQTTDEGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L+LF  D  TE+IVM+GEIGG+AEEEAA F+K+       KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILKLFQEDPETEAIVMIGEIGGTAEEEAAAFIKEN----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            ++AG TAPPG+ MGHAGA+ISGGKG AEDK  A++ AG+    S A IG+ L E+ G
Sbjct: 232 SYIAGVTAPPGKRMGHAGAIISGGKGTAEDKFAALEAAGVKTVKSLADIGQGLREVTG 289


>gi|51473621|ref|YP_067378.1| succinyl-CoA synthetase subunit alpha [Rickettsia typhi str.
           Wilmington]
 gi|81636362|sp|Q9AKE1|SUCD_RICTY RecName: Full=Succinyl-CoA ligase [ADP-forming] subunit alpha;
           AltName: Full=Succinyl-CoA synthetase subunit alpha;
           Short=SCS-alpha
 gi|13235359|emb|CAC33725.1| Succinyl-CoA synthetase alpha subunit [Rickettsia typhi]
 gi|51459933|gb|AAU03896.1| Succinate thiokinase [Rickettsia typhi str. Wilmington]
          Length = 292

 Score =  345 bits (886), Expect = 3e-93,   Method: Composition-based stats.
 Identities = 178/300 (59%), Positives = 231/300 (77%), Gaps = 8/300 (2%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           M+IL++K TKV+ QG TG  GTFH+EQAI Y  T +VGG+ P KG        +N+PV+ 
Sbjct: 1   MAILINKKTKVICQGFTGSQGTFHSEQAIAY-GTNMVGGVTPGKGGHTH----LNLPVYN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EAK +T ANASVIYVPP  A D+I+E+I+A+I ++VCITEGIPVLDMV+VK  L  S
Sbjct: 56  TVHEAKAKTDANASVIYVPPGFAADSILEAIDAKIEVVVCITEGIPVLDMVKVKRALIGS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            +RLIGPNCPG++TP  CKIGIMPG I + G +GI+SRSGTLTYEAV QT+  GLGQST 
Sbjct: 116 KTRLIGPNCPGVITPGECKIGIMPGHIHKTGIIGIVSRSGTLTYEAVAQTTAVGLGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           +GIGGDPV GT F++ +E+FL D+ T++I+M+GEIGG+AEE+AA F+K       KKPIV
Sbjct: 176 IGIGGDPVNGTSFVECIEMFLQDDETKAIIMIGEIGGNAEEDAADFIKQ---SKIKKPIV 232

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGSL 300
            F+AG TAP  + MGHAGA+ISGGKG A+DK+ A++ AG+ I  SPA IG+++++LL  +
Sbjct: 233 SFIAGITAPSDKRMGHAGAIISGGKGSAKDKLEALQSAGVTITKSPADIGKTMLDLLNKI 292


>gi|308050194|ref|YP_003913760.1| succinyl-CoA synthetase (ADP-forming) alpha subunit [Ferrimonas
           balearica DSM 9799]
 gi|307632384|gb|ADN76686.1| succinyl-CoA synthetase (ADP-forming) alpha subunit [Ferrimonas
           balearica DSM 9799]
          Length = 290

 Score =  345 bits (886), Expect = 3e-93,   Method: Composition-based stats.
 Identities = 176/298 (59%), Positives = 222/298 (74%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+TKV+ QG TG  GTFH+EQAI Y  TQ+VGG+ P KG +   G    +PVF 
Sbjct: 1   MSVLINKDTKVICQGFTGGQGTFHSEQAIAY-GTQMVGGVSPGKGGSTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T A ASVIYVP     DAI+E+I+A I LIV ITEGIP LDM+ VK +L+++
Sbjct: 56  TVREAVEATGATASVIYVPAPFCKDAILEAIDAGIELIVTITEGIPTLDMLDVKVKLDQA 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TP  CKIGIMPG I + G VGI+SRSGTLTYEAV QT+ EG GQST 
Sbjct: 116 GVRMIGPNCPGVITPGECKIGIMPGHIHQPGKVGIVSRSGTLTYEAVKQTTDEGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+LE+F  D  TE+IVM+GEIGG+AEEEAA ++K        KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILEMFEKDPQTEAIVMIGEIGGTAEEEAAAYIKQH----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            ++AG TAPPG+ MGHAGA+I+GGKG A DK  A+++AG+    S A IG++L E+ G
Sbjct: 232 SYIAGVTAPPGKRMGHAGAIIAGGKGTAADKFAALEDAGVKTVRSLADIGKALREVTG 289


>gi|229086388|ref|ZP_04218564.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Bacillus cereus
           Rock3-44]
 gi|228696904|gb|EEL49713.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Bacillus cereus
           Rock3-44]
          Length = 300

 Score =  345 bits (886), Expect = 3e-93,   Method: Composition-based stats.
 Identities = 180/299 (60%), Positives = 231/299 (77%), Gaps = 9/299 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+LV+K+TKV+VQG+TG  G FHT+Q I Y  T++VGG+ P KG T   G    VPVF 
Sbjct: 1   MSVLVNKDTKVIVQGITGSQGLFHTKQMIEY-GTKIVGGVTPGKGGTEIEG----VPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV +A + T ANASV+YVPP+ A DAI+E+++AEI L+VCITEGIPVLDMV+VK  +   
Sbjct: 56  TVEDAVKATGANASVVYVPPAFAADAIMEAVDAEIDLVVCITEGIPVLDMVKVKKYMTGK 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            +RL+GPNCPG++TPD CKIGIMPG I +KG VGI+SRSGTLTYEAV Q +QEG+GQSTA
Sbjct: 116 QTRLLGPNCPGVITPDECKIGIMPGYIHKKGHVGIVSRSGTLTYEAVHQLTQEGIGQSTA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPV GT+FID L+ F  DE T +++M+GEIGG+AEEEAA+++K        KP+V
Sbjct: 176 VGIGGDPVNGTDFIDALKAFNEDEETHAVIMIGEIGGTAEEEAAEWVKANM----TKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
           GF+ G+TAP G+ MGHAGA+ISGGKG A +KI  M+  GI +A +PA +G +L+ +L  
Sbjct: 232 GFIGGQTAPAGKRMGHAGAIISGGKGTAAEKIKTMEACGIKVAETPAVMGETLISVLKE 290


>gi|229524090|ref|ZP_04413495.1| succinyl-CoA ligase [ADP-forming] alpha chain [Vibrio cholerae bv.
           albensis VL426]
 gi|229337671|gb|EEO02688.1| succinyl-CoA ligase [ADP-forming] alpha chain [Vibrio cholerae bv.
           albensis VL426]
          Length = 290

 Score =  345 bits (886), Expect = 3e-93,   Method: Composition-based stats.
 Identities = 180/298 (60%), Positives = 224/298 (75%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL++K+TKV+ QG TG  GTFH+EQAI Y  TQ+VGG+ P KG T   G    +PVF 
Sbjct: 1   MSILINKDTKVICQGFTGGQGTFHSEQAIAY-GTQMVGGVSPGKGGTTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA + T A A+VIYVP     DAI+E+I+A I LIV ITEGIP  DM+ VK +LE++
Sbjct: 56  TVREAVDVTGATATVIYVPAPFCKDAILEAIDAGIKLIVTITEGIPTTDMIDVKVKLEQT 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TPD CKIGIMPG I +KG VGI+SRSGTLTYEAV QT+ EG GQST 
Sbjct: 116 GVRMIGPNCPGVITPDECKIGIMPGHIHKKGKVGIVSRSGTLTYEAVKQTTDEGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L++F  D ATE+IVM+GEIGG+AEEEAA F+K        KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILKMFQEDPATEAIVMIGEIGGTAEEEAAAFIKAN----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            ++AG TAPPG+ MGHAGA+ISGGKG AE+K  A++ AG+    S A IG++L E+ G
Sbjct: 232 SYIAGVTAPPGKRMGHAGAIISGGKGTAEEKFAALESAGVKTVKSLADIGKALREVTG 289


>gi|92113347|ref|YP_573275.1| succinyl-CoA synthetase (ADP-forming) alpha subunit
           [Chromohalobacter salexigens DSM 3043]
 gi|91796437|gb|ABE58576.1| succinyl-CoA synthetase (ADP-forming) alpha subunit
           [Chromohalobacter salexigens DSM 3043]
          Length = 290

 Score =  345 bits (886), Expect = 3e-93,   Method: Composition-based stats.
 Identities = 173/298 (58%), Positives = 214/298 (71%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL+DK+TKV+ QG TG  GTFH+EQAI Y  TQ+VGG+ P KG     G    +PVF 
Sbjct: 1   MSILIDKSTKVICQGFTGGQGTFHSEQAIAY-GTQMVGGVTPGKGGQTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T A ASVIYVP     D+I+E+  A I LIVCITEGIP LDM+ VK + ++ 
Sbjct: 56  TVKEAVETTGAEASVIYVPAPFCKDSILEAANAGIKLIVCITEGIPTLDMLDVKVKCDEL 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             RLIGPNCPG++TP   KIGIMPG I + G VGI+SRSGTLTYEAV QT+  G GQST 
Sbjct: 116 GVRLIGPNCPGVITPGETKIGIMPGHIHKPGKVGIVSRSGTLTYEAVKQTTDHGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+LE+F  D  TE+IVM+GEIGG+AEEEAA ++K+       KP+V
Sbjct: 176 VGIGGDPIPGSTFIDMLEMFEKDPQTEAIVMIGEIGGTAEEEAAAYIKEH----VSKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            ++AG TAPPG+ MGHAGA+I+GGKG A++K  A++ AG+    S A IG +L    G
Sbjct: 232 SYIAGVTAPPGKRMGHAGAIIAGGKGTADEKFAALESAGVKTVRSLAEIGDALKAATG 289


>gi|205373360|ref|ZP_03226164.1| succinyl-CoA synthetase subunit alpha [Bacillus coahuilensis m4-4]
          Length = 300

 Score =  345 bits (886), Expect = 3e-93,   Method: Composition-based stats.
 Identities = 169/299 (56%), Positives = 220/299 (73%), Gaps = 9/299 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+ ++K+TKV+VQG+TG    FHT+Q + Y  TQ+V G+ P K      G    VPVF 
Sbjct: 1   MSVFINKDTKVIVQGITGSTALFHTKQMLEY-GTQIVAGVTPGKAGQEVEG----VPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV++A   T A  SV+YVP   A DAI+E+++AE+ L++CITE IPVLDMV+VK  +   
Sbjct: 56  TVSDAVTETGATVSVVYVPAPFAADAILEAVDAELDLVICITEHIPVLDMVKVKRYMAGK 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            +RL+GPNCPGI+TPD CKIGIMPG I  KG VG++SRSGTLTYEAV Q SQ G+GQSTA
Sbjct: 116 KTRLVGPNCPGIITPDECKIGIMPGYIHTKGHVGVVSRSGTLTYEAVHQLSQAGVGQSTA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPV GT FIDVL+ F  D  T +++M+GEIGG+AEEEAA+++K        KP+V
Sbjct: 176 VGIGGDPVNGTNFIDVLQAFNEDPETYAVIMIGEIGGTAEEEAAEWVKANM----TKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
           GF+ G+TAPPG+ MGHAGA+ISGGKG A++KI  M E GI +A +P+ +G +L+ +L  
Sbjct: 232 GFIGGRTAPPGKRMGHAGAIISGGKGTADEKIRIMNECGIKVAETPSVMGETLISVLKE 290


>gi|298292945|ref|YP_003694884.1| succinyl-CoA synthetase, subunit alpha [Starkeya novella DSM 506]
 gi|296929456|gb|ADH90265.1| succinyl-CoA synthetase, alpha subunit [Starkeya novella DSM 506]
          Length = 298

 Score =  345 bits (886), Expect = 4e-93,   Method: Composition-based stats.
 Identities = 221/299 (73%), Positives = 262/299 (87%), Gaps = 5/299 (1%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+TK++ QG TGK GTFH+EQA+ Y  ++VVGG  P KG +   G    +PVF 
Sbjct: 1   MSVLINKDTKIITQGFTGKNGTFHSEQALAY-GSKVVGGTSPGKGGSTHLG----LPVFD 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TVAEA+E+T A+ASV+YVPP GA DAI E+I AEIPLIVCITEGIPVLDMV+V+  L+ S
Sbjct: 56  TVAEAREKTGADASVVYVPPPGAADAICEAIAAEIPLIVCITEGIPVLDMVKVRRALDGS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            SRL+GPNCPGI+T   CKIGIMP +IFRKG+VGI+SRSGTLTYEAVFQTSQEGLGQ+TA
Sbjct: 116 KSRLVGPNCPGIVTAGECKIGIMPANIFRKGNVGIVSRSGTLTYEAVFQTSQEGLGQTTA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPVKGTEFIDVLELFLAD+ATESIVM+GEIGGSAEE+AAQFLKDEAKRGRKKP+V
Sbjct: 176 VGIGGDPVKGTEFIDVLELFLADDATESIVMIGEIGGSAEEDAAQFLKDEAKRGRKKPMV 235

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
           GF+AG+TAPPGR MGHAGA+ISGGKGGAEDKI AM+ AGI ++PSPAR+G++L+E+L  
Sbjct: 236 GFIAGRTAPPGRRMGHAGAIISGGKGGAEDKIAAMEAAGIVVSPSPARLGKTLIEVLNK 294


>gi|76156042|gb|AAX27280.2| SJCHGC04909 protein [Schistosoma japonicum]
          Length = 320

 Score =  345 bits (886), Expect = 4e-93,   Method: Composition-based stats.
 Identities = 180/299 (60%), Positives = 232/299 (77%), Gaps = 6/299 (2%)

Query: 3   ILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFTTV 62
           IL+D+NTK++ QG TGK GTFH++Q + Y  T++VGG+ P KG +   G    +PVF +V
Sbjct: 24  ILLDENTKLICQGFTGKQGTFHSQQTLAY-GTKLVGGVSPGKGGSVHLG----LPVFNSV 78

Query: 63  AEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARL-EKSS 121
            EAK+ T A A+VIYVPP  A  AI E+I+AEIPLIVCITEGIP  DM+RV+ RL E+S 
Sbjct: 79  KEAKDATGATATVIYVPPPHAATAIYEAIDAEIPLIVCITEGIPQHDMIRVRKRLTEQSV 138

Query: 122 SRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTAV 181
           SRLIGPNCPGI+ PD CKIGIMP  I + G+VGI+SRSGTLTYEAVFQT+Q GLGQS  V
Sbjct: 139 SRLIGPNCPGIIKPDVCKIGIMPAHIHKPGTVGIVSRSGTLTYEAVFQTTQVGLGQSLCV 198

Query: 182 GIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIVG 241
           GIGGDP  GT+FID L++FL D  T+SI+++GEIGG +EE+AA+FLK      + KP+V 
Sbjct: 199 GIGGDPFNGTDFIDCLQVFLNDPNTKSIILLGEIGGESEEKAAEFLKQHNVGPKHKPVVS 258

Query: 242 FVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGSL 300
           F+AG TAPPGR MGHAGA+IS GKGGA++K+ A++ AG+ + PSPA++G +L++ +  L
Sbjct: 259 FIAGVTAPPGRRMGHAGAIISLGKGGAKEKMAALESAGVVVTPSPAKLGTTLLKAIADL 317


>gi|221134284|ref|ZP_03560589.1| succinyl-CoA synthetase, alpha subunit [Glaciecola sp. HTCC2999]
          Length = 290

 Score =  345 bits (886), Expect = 4e-93,   Method: Composition-based stats.
 Identities = 171/298 (57%), Positives = 219/298 (73%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+TKV+ QG TG  GTFH+EQAI Y  TQ+VGG+ P KG T   G    +PVF 
Sbjct: 1   MSVLINKDTKVICQGFTGGQGTFHSEQAIEY-GTQMVGGVTPGKGGTTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV +A   T A ASVIYVP +   D+IIE+ +A I +IVCITEGIP +DM+ VK  + + 
Sbjct: 56  TVKDAVAETGATASVIYVPAAFCKDSIIEAADAGIEIIVCITEGIPTVDMIYVKEYVSQK 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
              +IGPNCPG++TP  CKIGIMPG I + G VG++SRSGTLTYEAV QT+ EG GQST 
Sbjct: 116 GVTMIGPNCPGVITPGECKIGIMPGHIHKPGKVGVVSRSGTLTYEAVKQTTDEGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FIDVL+LF  D  TE+IVM+GEIGG+AEEEAA+F+K+       KP+V
Sbjct: 176 VGIGGDPIPGSNFIDVLKLFQNDPQTEAIVMIGEIGGTAEEEAAEFIKNN----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            ++AG TAP G+ MGHAGA+ISGGKG A++K  A++ AG+    S A IG++L E+ G
Sbjct: 232 SYIAGVTAPAGKRMGHAGAIISGGKGTADEKFAALEAAGVKTVRSLADIGKALREITG 289


>gi|260767660|ref|ZP_05876595.1| succinyl-CoA ligase [ADP-forming] alpha chain [Vibrio furnissii CIP
           102972]
 gi|260617169|gb|EEX42353.1| succinyl-CoA ligase [ADP-forming] alpha chain [Vibrio furnissii CIP
           102972]
 gi|315179508|gb|ADT86422.1| succinyl-CoA synthetase subunit alpha [Vibrio furnissii NCTC 11218]
          Length = 290

 Score =  345 bits (886), Expect = 4e-93,   Method: Composition-based stats.
 Identities = 178/298 (59%), Positives = 221/298 (74%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+TKV+ QG TG  GTFH+EQAI Y  TQ+VGG+ P KG     G    +PVF 
Sbjct: 1   MSVLINKDTKVICQGFTGGQGTFHSEQAIAY-GTQMVGGVSPGKGGQTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T A A+VIYVP     DAI+E+I+A I LIV ITEGIP  DM+ VK +LE++
Sbjct: 56  TVREAVEATGATATVIYVPAPFCKDAILEAIDAGIQLIVTITEGIPTTDMIDVKVKLEET 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TPD CKIGIMPG I +KG VGI+SRSGTLTYEAV QT+ EG GQST 
Sbjct: 116 GVRMIGPNCPGVITPDECKIGIMPGHIHKKGKVGIVSRSGTLTYEAVKQTTDEGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L+LF  D  TE+IVM+GEIGG+AEEEAA F+K        KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILKLFQEDPETEAIVMIGEIGGTAEEEAAAFIKAN----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            ++AG TAPPG+ MGHAGA+ISGGKG A++K  A++ AG+    S A IG +L E+ G
Sbjct: 232 SYIAGVTAPPGKRMGHAGAIISGGKGTADEKFAALESAGVKTVKSLAEIGSALREVTG 289


>gi|117618581|ref|YP_856461.1| succinyl-CoA synthetase alpha chain [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
 gi|117559988|gb|ABK36936.1| succinyl-CoA synthetase alpha chain [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
          Length = 290

 Score =  345 bits (886), Expect = 4e-93,   Method: Composition-based stats.
 Identities = 173/298 (58%), Positives = 221/298 (74%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+TKV+ QG TG  GTFH+EQAI Y  TQ+VGG+ P KG T   G    +PVF 
Sbjct: 1   MSVLINKDTKVICQGFTGGQGTFHSEQAIAY-GTQMVGGVSPGKGGTTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV +A E T A ASVIYVP     DAI+E+I+A I LIV ITEGIP LDM+ VK +L+++
Sbjct: 56  TVRDAVEATGATASVIYVPAPFCKDAILEAIDAGIKLIVTITEGIPTLDMLDVKVKLQET 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TP  CKIGIMPG I + G VGI+SRSGTLTYEAV QT+ EG GQST 
Sbjct: 116 GVRMIGPNCPGVITPGECKIGIMPGHIHKPGKVGIVSRSGTLTYEAVKQTTDEGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+LE+F  D  TE+IVM+GEIGG+AEE+AA ++K        KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILEMFQNDPQTEAIVMIGEIGGNAEEDAAAYIKAH----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            ++AG TAP G+ MGHAGA+I+GGKG A +K  A+++AG+    S A IG++L E+ G
Sbjct: 232 SYIAGVTAPAGKRMGHAGAIIAGGKGTAAEKFAALEDAGVKTVRSLADIGKALREVTG 289


>gi|16510|emb|CAA48891.1| succinate--CoA ligase (GDP-forming) [Arabidopsis thaliana]
          Length = 345

 Score =  345 bits (886), Expect = 4e-93,   Method: Composition-based stats.
 Identities = 182/298 (61%), Positives = 222/298 (74%), Gaps = 9/298 (3%)

Query: 3   ILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFTTV 62
           + VDKNT+V+ QG+TGK GTFHTEQAI Y  T++V G+ PKKG T   G    +PVF TV
Sbjct: 51  VFVDKNTRVICQGITGKNGTFHTEQAIEY-GTKMVAGVTPKKGGTEHLG----LPVFNTV 105

Query: 63  AEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLE-KSS 121
           AEAK  T ANASVIYVP   A  AI+E + AE+ LIVCITEGIP  DMVRVKA L  +S 
Sbjct: 106 AEAKAETKANASVIYVPAPFAAAAIMEGLAAELDLIVCITEGIPQHDMVRVKAALNSQSK 165

Query: 122 SRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTAV 181
           +RLIGPNCPGI+ P  CKIGIMPG I + G +GI+SRSGTLTYEAVFQT+  GLGQST V
Sbjct: 166 TRLIGPNCPGIIKPGECKIGIMPGYIHKPGKIGIVSRSGTLTYEAVFQTTAVGLGQSTCV 225

Query: 182 GIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIVG 241
           GIGGDP  GT F+D LE F  D  TE IV++GEIGG+AEE+AA  +K+    G  KP+V 
Sbjct: 226 GIGGDPFNGTNFVDCLEKFFVDPQTEGIVLIGEIGGTAEEDAAALIKEN---GTDKPVVA 282

Query: 242 FVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
           F+AG TAPPGR MGHAG ++SGGKG A+DKI ++++AG+ +  SPA++G ++ EL   
Sbjct: 283 FIAGLTAPPGRRMGHAGRIVSGGKGTAQDKIKSLRDAGVKVVESPAKLGAAMFELFQE 340


>gi|330811083|ref|YP_004355545.1| succinate--CoA ligase (GDP-forming) [Pseudomonas brassicacearum
           subsp. brassicacearum NFM421]
 gi|327379191|gb|AEA70541.1| Succinate--CoA ligase (GDP-forming) [Pseudomonas brassicacearum
           subsp. brassicacearum NFM421]
          Length = 294

 Score =  345 bits (886), Expect = 4e-93,   Method: Composition-based stats.
 Identities = 169/298 (56%), Positives = 215/298 (72%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+TKV+ QG+TG  G+FHT+QAI Y  T++VGG+ P KG T   G    +PVF 
Sbjct: 1   MSVLINKDTKVICQGITGSQGSFHTQQAIEY-GTKMVGGVTPGKGGTEHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV +A   T A ASVIYVP     D+I+E+    I LIVCITEGIP +DM+  K + ++ 
Sbjct: 56  TVKDAVAATGATASVIYVPAPFCKDSILEAAFGGIKLIVCITEGIPTIDMLEAKVKCDEL 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
              LIGPNCPG++TP  CKIGIMPG I   G VGI+SRSGTLTYEAV QT+  G GQST 
Sbjct: 116 GITLIGPNCPGVITPGECKIGIMPGHIHLPGKVGIVSRSGTLTYEAVKQTTDAGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L+LF  D  TE+IVM+GEIGGSAEEEAA ++K        KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILKLFQEDPKTEAIVMIGEIGGSAEEEAAAYIKAN----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            ++AG TAPPG+ MGHAGA+ISGGKG A++K  A+++AG+    S A IG++L EL G
Sbjct: 232 SYIAGVTAPPGKRMGHAGAIISGGKGTADEKFAALQDAGVKTVRSLADIGKALAELTG 289


>gi|15642084|ref|NP_231716.1| succinyl-CoA synthetase subunit alpha [Vibrio cholerae O1 biovar El
           Tor str. N16961]
 gi|121586942|ref|ZP_01676722.1| succinyl-CoA synthase, alpha subunit [Vibrio cholerae 2740-80]
 gi|121727400|ref|ZP_01680539.1| succinyl-CoA synthase, alpha subunit [Vibrio cholerae V52]
 gi|153213721|ref|ZP_01948973.1| succinyl-CoA synthase, alpha subunit [Vibrio cholerae 1587]
 gi|153818378|ref|ZP_01971045.1| succinyl-CoA synthase, alpha subunit [Vibrio cholerae NCTC 8457]
 gi|153821693|ref|ZP_01974360.1| succinyl-CoA synthase, alpha subunit [Vibrio cholerae B33]
 gi|153826097|ref|ZP_01978764.1| succinyl-CoA synthase, alpha subunit [Vibrio cholerae MZO-2]
 gi|153828884|ref|ZP_01981551.1| succinyl-CoA synthase, alpha subunit [Vibrio cholerae 623-39]
 gi|227082210|ref|YP_002810761.1| succinyl-CoA synthase, alpha subunit [Vibrio cholerae M66-2]
 gi|229507827|ref|ZP_04397332.1| succinyl-CoA ligase [ADP-forming] alpha chain [Vibrio cholerae BX
           330286]
 gi|229511936|ref|ZP_04401415.1| succinyl-CoA ligase [ADP-forming] alpha chain [Vibrio cholerae B33]
 gi|229513739|ref|ZP_04403201.1| succinyl-CoA ligase [ADP-forming] alpha chain [Vibrio cholerae TMA
           21]
 gi|229519072|ref|ZP_04408515.1| succinyl-CoA ligase [ADP-forming] alpha chain [Vibrio cholerae RC9]
 gi|229522041|ref|ZP_04411458.1| succinyl-CoA ligase [ADP-forming] alpha chain [Vibrio cholerae TM
           11079-80]
 gi|229528900|ref|ZP_04418290.1| succinyl-CoA ligase [ADP-forming] alpha chain [Vibrio cholerae
           12129(1)]
 gi|229607372|ref|YP_002878020.1| succinyl-CoA synthetase subunit alpha [Vibrio cholerae MJ-1236]
 gi|254226087|ref|ZP_04919685.1| succinyl-CoA synthase, alpha subunit [Vibrio cholerae V51]
 gi|254286799|ref|ZP_04961752.1| succinyl-CoA synthase, alpha subunit [Vibrio cholerae AM-19226]
 gi|254849170|ref|ZP_05238520.1| succinyl-CoA synthase [Vibrio cholerae MO10]
 gi|255745173|ref|ZP_05419122.1| succinyl-CoA ligase [ADP-forming] alpha chain [Vibrio cholera CIRS
           101]
 gi|258621149|ref|ZP_05716183.1| succinyl-CoA synthetase alpha subunit [Vibrio mimicus VM573]
 gi|261210013|ref|ZP_05924312.1| succinyl-CoA ligase [ADP-forming] alpha chain [Vibrio sp. RC341]
 gi|262155969|ref|ZP_06029090.1| succinyl-CoA ligase [ADP-forming] alpha chain [Vibrio cholerae
           INDRE 91/1]
 gi|262166194|ref|ZP_06033931.1| succinyl-CoA ligase [ADP-forming] alpha chain [Vibrio mimicus
           VM223]
 gi|262191356|ref|ZP_06049547.1| succinyl-CoA ligase [ADP-forming] alpha chain [Vibrio cholerae CT
           5369-93]
 gi|262404434|ref|ZP_06080989.1| succinyl-CoA ligase [ADP-forming] alpha chain [Vibrio sp. RC586]
 gi|297579588|ref|ZP_06941516.1| succinyl-CoA synthase, alpha subunit [Vibrio cholerae RC385]
 gi|298497890|ref|ZP_07007697.1| succinyl-CoA synthetase subunit alpha [Vibrio cholerae MAK 757]
 gi|9656632|gb|AAF95230.1| succinyl-CoA synthase, alpha subunit [Vibrio cholerae O1 biovar El
           Tor str. N16961]
 gi|121548878|gb|EAX58921.1| succinyl-CoA synthase, alpha subunit [Vibrio cholerae 2740-80]
 gi|121630292|gb|EAX62690.1| succinyl-CoA synthase, alpha subunit [Vibrio cholerae V52]
 gi|124115782|gb|EAY34602.1| succinyl-CoA synthase, alpha subunit [Vibrio cholerae 1587]
 gi|125621399|gb|EAZ49735.1| succinyl-CoA synthase, alpha subunit [Vibrio cholerae V51]
 gi|126511068|gb|EAZ73662.1| succinyl-CoA synthase, alpha subunit [Vibrio cholerae NCTC 8457]
 gi|126520791|gb|EAZ78014.1| succinyl-CoA synthase, alpha subunit [Vibrio cholerae B33]
 gi|148875590|gb|EDL73725.1| succinyl-CoA synthase, alpha subunit [Vibrio cholerae 623-39]
 gi|149740214|gb|EDM54367.1| succinyl-CoA synthase, alpha subunit [Vibrio cholerae MZO-2]
 gi|150423090|gb|EDN15038.1| succinyl-CoA synthase, alpha subunit [Vibrio cholerae AM-19226]
 gi|227010098|gb|ACP06310.1| succinyl-CoA synthase, alpha subunit [Vibrio cholerae M66-2]
 gi|229332674|gb|EEN98160.1| succinyl-CoA ligase [ADP-forming] alpha chain [Vibrio cholerae
           12129(1)]
 gi|229340966|gb|EEO05971.1| succinyl-CoA ligase [ADP-forming] alpha chain [Vibrio cholerae TM
           11079-80]
 gi|229343761|gb|EEO08736.1| succinyl-CoA ligase [ADP-forming] alpha chain [Vibrio cholerae RC9]
 gi|229348920|gb|EEO13877.1| succinyl-CoA ligase [ADP-forming] alpha chain [Vibrio cholerae TMA
           21]
 gi|229351901|gb|EEO16842.1| succinyl-CoA ligase [ADP-forming] alpha chain [Vibrio cholerae B33]
 gi|229355332|gb|EEO20253.1| succinyl-CoA ligase [ADP-forming] alpha chain [Vibrio cholerae BX
           330286]
 gi|229370027|gb|ACQ60450.1| succinyl-CoA ligase [ADP-forming] alpha chain [Vibrio cholerae
           MJ-1236]
 gi|254844875|gb|EET23289.1| succinyl-CoA synthase [Vibrio cholerae MO10]
 gi|255737003|gb|EET92399.1| succinyl-CoA ligase [ADP-forming] alpha chain [Vibrio cholera CIRS
           101]
 gi|258586537|gb|EEW11252.1| succinyl-CoA synthetase alpha subunit [Vibrio mimicus VM573]
 gi|260840959|gb|EEX67496.1| succinyl-CoA ligase [ADP-forming] alpha chain [Vibrio sp. RC341]
 gi|262025910|gb|EEY44578.1| succinyl-CoA ligase [ADP-forming] alpha chain [Vibrio mimicus
           VM223]
 gi|262030280|gb|EEY48923.1| succinyl-CoA ligase [ADP-forming] alpha chain [Vibrio cholerae
           INDRE 91/1]
 gi|262032775|gb|EEY51322.1| succinyl-CoA ligase [ADP-forming] alpha chain [Vibrio cholerae CT
           5369-93]
 gi|262349466|gb|EEY98604.1| succinyl-CoA ligase [ADP-forming] alpha chain [Vibrio sp. RC586]
 gi|297537182|gb|EFH76015.1| succinyl-CoA synthase, alpha subunit [Vibrio cholerae RC385]
 gi|297542223|gb|EFH78273.1| succinyl-CoA synthetase subunit alpha [Vibrio cholerae MAK 757]
 gi|327484616|gb|AEA79023.1| Succinyl-CoA ligase [ADP-forming] alpha chain [Vibrio cholerae
           LMA3894-4]
          Length = 290

 Score =  345 bits (886), Expect = 4e-93,   Method: Composition-based stats.
 Identities = 181/298 (60%), Positives = 224/298 (75%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL++K+TKV+ QG TG  GTFH+EQAI Y  TQ+VGG+ P KG T   G    +PVF 
Sbjct: 1   MSILINKDTKVICQGFTGGQGTFHSEQAIAY-GTQMVGGVSPGKGGTTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T A A+VIYVP     DAI+E+I+A I LIV ITEGIP  DM+ VK +LE++
Sbjct: 56  TVREAVEVTGATATVIYVPAPFCKDAILEAIDAGIKLIVTITEGIPTTDMIDVKVKLEQT 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TPD CKIGIMPG I +KG VGI+SRSGTLTYEAV QT+ EG GQST 
Sbjct: 116 GVRMIGPNCPGVITPDECKIGIMPGHIHKKGKVGIVSRSGTLTYEAVKQTTDEGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L++F  D ATE+IVM+GEIGG+AEEEAA F+K        KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILKMFQEDPATEAIVMIGEIGGTAEEEAAAFIKAN----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            ++AG TAPPG+ MGHAGA+ISGGKG AE+K  A++ AG+    S A IG++L E+ G
Sbjct: 232 SYIAGVTAPPGKRMGHAGAIISGGKGTAEEKFAALESAGVKTVKSLADIGKALREVTG 289


>gi|254374016|ref|ZP_04989498.1| hypothetical protein FTDG_00176 [Francisella novicida GA99-3548]
 gi|151571736|gb|EDN37390.1| hypothetical protein FTDG_00176 [Francisella novicida GA99-3548]
          Length = 290

 Score =  345 bits (886), Expect = 4e-93,   Method: Composition-based stats.
 Identities = 171/298 (57%), Positives = 217/298 (72%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+LVDKNTKVLVQG TGK GTFH+EQAI Y  T +VGG+ P KG T      ++ PVF 
Sbjct: 1   MSVLVDKNTKVLVQGFTGKNGTFHSEQAIAY-GTNIVGGVTPGKGGTTH----LDRPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           T+AEA   T A+ASVIYVP     D+ IE+I++ + L+V ITEG+P LDM+ VK  L+  
Sbjct: 56  TMAEAVAATGADASVIYVPAPFVKDSAIEAIDSGVKLVVIITEGVPTLDMLVVKEYLKDK 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TP  CKIGIMPG I + G VGI+SRSGTLTYEAV QT++ G GQST 
Sbjct: 116 DVRVIGPNCPGVITPGQCKIGIMPGHIHQPGKVGIISRSGTLTYEAVAQTTKLGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           +GIGGDP+ G   I+ L+L   D  TE+I+++GEIGG+AEEEAA+++K        KP++
Sbjct: 176 IGIGGDPIPGMNQIEALKLLENDPQTEAIILIGEIGGTAEEEAAEYIKHN----VTKPVI 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           G++AG TAPPG+ MGHAGA+ISGGKG AE+K  A + AGI    SPA IG+ L E+ G
Sbjct: 232 GYIAGVTAPPGKRMGHAGAIISGGKGTAEEKFAAFEAAGIAYTRSPAEIGKKLKEVTG 289


>gi|258626224|ref|ZP_05721072.1| succinyl-CoA synthetase alpha subunit [Vibrio mimicus VM603]
 gi|262170926|ref|ZP_06038604.1| succinyl-CoA ligase [ADP-forming] alpha chain [Vibrio mimicus
           MB-451]
 gi|258581579|gb|EEW06480.1| succinyl-CoA synthetase alpha subunit [Vibrio mimicus VM603]
 gi|261892002|gb|EEY37988.1| succinyl-CoA ligase [ADP-forming] alpha chain [Vibrio mimicus
           MB-451]
          Length = 290

 Score =  345 bits (886), Expect = 4e-93,   Method: Composition-based stats.
 Identities = 180/298 (60%), Positives = 224/298 (75%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL++K+TKV+ QG TG  GTFH+EQAI Y  TQ+VGG+ P KG T   G    +PVF 
Sbjct: 1   MSILINKDTKVICQGFTGGQGTFHSEQAIAY-GTQMVGGVSPGKGGTTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T A A+VIYVP     DAI+E+I+A I LIV ITEGIP  DM+ VK +LE++
Sbjct: 56  TVREAVEVTGATATVIYVPAPFCKDAILEAIDAGIKLIVTITEGIPTTDMIDVKVKLEQT 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TPD CKIGIMPG I +KG VGI+SRSGTLTYEAV QT+ EG GQST 
Sbjct: 116 GVRMIGPNCPGVITPDECKIGIMPGHIHKKGKVGIVSRSGTLTYEAVKQTTDEGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L++F  D ATE+IVM+GEIGG+AEEEAA F+K        KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILKMFQEDPATEAIVMIGEIGGTAEEEAAAFIKAN----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            ++AG TAPPG+ MGHAGA+ISGGKG A++K  A++ AG+    S A IG++L E+ G
Sbjct: 232 SYIAGVTAPPGKRMGHAGAIISGGKGTADEKFAALESAGVKTVKSLADIGKALREVTG 289


>gi|209694428|ref|YP_002262356.1| succinyl-CoA synthetase subunit alpha [Aliivibrio salmonicida
           LFI1238]
 gi|208008379|emb|CAQ78534.1| succinyl-CoA synthetase alpha chain [Aliivibrio salmonicida
           LFI1238]
          Length = 290

 Score =  345 bits (886), Expect = 4e-93,   Method: Composition-based stats.
 Identities = 177/298 (59%), Positives = 220/298 (73%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+TKV+ QG TG  GTFH+EQAI Y  T++VGG+ P KG     G    +PVF 
Sbjct: 1   MSVLINKDTKVICQGFTGGQGTFHSEQAIDY-GTKMVGGVSPGKGGQVHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV +A E T A ASVIYVP     DAI+E+I+A I LI+ ITEGIP LD++ VK RL+  
Sbjct: 56  TVRDAVEATGATASVIYVPAPFCKDAILEAIDAGIKLIITITEGIPTLDLLDVKVRLDAE 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
              +IGPNCPG++TPD CKIGIMPG I +KG VGI+SRSGTLTYEAV QT+ EG GQST 
Sbjct: 116 GVVMIGPNCPGVITPDECKIGIMPGHIHKKGKVGIVSRSGTLTYEAVKQTTDEGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L+LF  D  TE+IVM+GEIGG+AEEEAA+F+K        KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILKLFQEDPETEAIVMIGEIGGTAEEEAAEFIKHN----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            ++AG TAPPG+ MGHAGA+ISGGKG AEDK  A++ AG+    S A IG+ L E+ G
Sbjct: 232 SYIAGVTAPPGKRMGHAGAIISGGKGTAEDKFAALEAAGVKTVKSLADIGKGLREITG 289


>gi|283833986|ref|ZP_06353727.1| succinyl-CoA synthetase subunit alpha [Citrobacter youngae ATCC
           29220]
 gi|291070120|gb|EFE08229.1| succinyl-CoA synthetase subunit alpha [Citrobacter youngae ATCC
           29220]
          Length = 289

 Score =  345 bits (886), Expect = 4e-93,   Method: Composition-based stats.
 Identities = 173/298 (58%), Positives = 220/298 (73%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+TKV+ QG TG  GTFH+EQAI Y  TQ+VGG+ P KG T   G    +PVF 
Sbjct: 1   MSVLINKDTKVICQGFTGSQGTFHSEQAIAY-GTQMVGGVTPGKGGTTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T A ASVIYVP     D+I+E+I+A I LI+ ITEGIP LDM+ VK +L+++
Sbjct: 56  TVREAVEATGATASVIYVPAPFCKDSILEAIDAGIKLIITITEGIPTLDMLTVKVKLDEA 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TP  CKIGIMPG I + G VGI+SRSGTLTYEAV QT+  G GQST 
Sbjct: 116 GVRMIGPNCPGVITPGECKIGIMPGHIHKPGKVGIVSRSGTLTYEAVKQTTDYGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L+LF  D  TE+IVM+GEIGGSAEEEAA ++KD       KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILKLFQEDPQTEAIVMIGEIGGSAEEEAAAYIKDH----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           G++AG TAP G+ MGHAGA+I+GGKG A++K  A++ AG+    S A IG +L  ++ 
Sbjct: 232 GYIAGVTAPKGKRMGHAGAIIAGGKGTADEKFAALEAAGVKTVRSLADIGEALKTVIK 289


>gi|297620666|ref|YP_003708803.1| Succinyl-CoA synthetase, alpha subunit [Waddlia chondrophila WSU
           86-1044]
 gi|297375967|gb|ADI37797.1| Succinyl-CoA synthetase, alpha subunit [Waddlia chondrophila WSU
           86-1044]
          Length = 297

 Score =  345 bits (885), Expect = 4e-93,   Method: Composition-based stats.
 Identities = 170/300 (56%), Positives = 225/300 (75%), Gaps = 10/300 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           M+ILV+K TKV+ QG+TG AG+FHTEQ + Y  +Q VGG+ P KG     G    +PVF 
Sbjct: 1   MAILVNKKTKVMTQGITGNAGSFHTEQCLEY-GSQFVGGVTPWKGGQTCLG----LPVFD 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEK- 119
           TV EAK+ T  +A++I+VPP  A +AI+E+ +A IPLIVCITEGIPV DM+ V   +++ 
Sbjct: 56  TVKEAKKATGCDATMIFVPPPFAAEAILEAEDAGIPLIVCITEGIPVRDMLEVSQVMKRS 115

Query: 120 SSSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQST 179
             SRLIGPNCPG++TP  CKIGIMPG I ++G VGI+SRSGTLTYEAV+QT+Q  LGQS+
Sbjct: 116 KKSRLIGPNCPGVITPGECKIGIMPGYIHQRGRVGIVSRSGTLTYEAVWQTTQLELGQSS 175

Query: 180 AVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPI 239
            VGIGGDP+ GT FIDVLELF  D  TE I+++GEIGG AEE+AA+++++       KP+
Sbjct: 176 CVGIGGDPLNGTNFIDVLELFENDPETEGILLIGEIGGDAEEQAAEWIRERC----SKPV 231

Query: 240 VGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
             FVAG+TAPPGR MGHAGA+ISG +G A++KI A+K AG+ +A +PA +G++++     
Sbjct: 232 AAFVAGQTAPPGRRMGHAGAIISGNQGTAQNKIEALKHAGVTVAETPADLGKAMLSAFNE 291


>gi|32034771|ref|ZP_00134896.1| COG0074: Succinyl-CoA synthetase, alpha subunit [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
 gi|126207935|ref|YP_001053160.1| succinyl-CoA ligase [ADP-forming] subunit alpha [Actinobacillus
           pleuropneumoniae L20]
 gi|165975910|ref|YP_001651503.1| succinyl-CoA synthetase alpha chain [Actinobacillus
           pleuropneumoniae serovar 3 str. JL03]
 gi|303250243|ref|ZP_07336443.1| succinyl-CoA synthetase alpha chain [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|307245290|ref|ZP_07527378.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
 gi|307252008|ref|ZP_07533908.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|307254239|ref|ZP_07536080.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Actinobacillus
           pleuropneumoniae serovar 9 str. CVJ13261]
 gi|307256505|ref|ZP_07538286.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Actinobacillus
           pleuropneumoniae serovar 10 str. D13039]
 gi|307258701|ref|ZP_07540433.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Actinobacillus
           pleuropneumoniae serovar 11 str. 56153]
 gi|307260933|ref|ZP_07542617.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Actinobacillus
           pleuropneumoniae serovar 12 str. 1096]
 gi|126096727|gb|ABN73555.1| succinyl-CoA ligase [ADP-forming] subunit alpha [Actinobacillus
           pleuropneumoniae serovar 5b str. L20]
 gi|165876011|gb|ABY69059.1| succinyl-CoA synthetase alpha chain [Actinobacillus
           pleuropneumoniae serovar 3 str. JL03]
 gi|302650859|gb|EFL81015.1| succinyl-CoA synthetase alpha chain [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|306853631|gb|EFM85848.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
 gi|306860477|gb|EFM92490.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|306862786|gb|EFM94739.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Actinobacillus
           pleuropneumoniae serovar 9 str. CVJ13261]
 gi|306864915|gb|EFM96817.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Actinobacillus
           pleuropneumoniae serovar 10 str. D13039]
 gi|306867052|gb|EFM98908.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Actinobacillus
           pleuropneumoniae serovar 11 str. 56153]
 gi|306869372|gb|EFN01165.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Actinobacillus
           pleuropneumoniae serovar 12 str. 1096]
          Length = 290

 Score =  345 bits (885), Expect = 4e-93,   Method: Composition-based stats.
 Identities = 183/299 (61%), Positives = 225/299 (75%), Gaps = 9/299 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           M+IL+DKNTKV+ QG TG  GTFH+EQA+ Y  T++VGG+ P KG T   G    +PVF 
Sbjct: 1   MAILIDKNTKVICQGFTGGQGTFHSEQALAY-GTKLVGGVSPNKGGTTHLG----LPVFD 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E+T A ASVIYVP  G  DAI+E+I+A I LIVCITEGIP LDM+ VK +L++S
Sbjct: 56  TVREAVEKTGATASVIYVPAPGCKDAILEAIDAGIQLIVCITEGIPTLDMICVKQKLKES 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPGI+TPD CKIGIMP  I +KG +GI+SRSGTLTYEAV QT+ EG GQST 
Sbjct: 116 GVRMIGPNCPGIITPDECKIGIMPAHIHKKGKIGIVSRSGTLTYEAVKQTTDEGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L+LF AD  TE+IVM+GEIGGSAEEEAA+F+K        KP+V
Sbjct: 176 VGIGGDPIPGSSFIDILKLFQADPETEAIVMIGEIGGSAEEEAAEFIKMH----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
            ++AG TAP G+ MGHAGA+ISGGKG A++K   ++ AG+    S A IG +L ELL  
Sbjct: 232 SYIAGVTAPKGKRMGHAGAIISGGKGTADEKFKTLENAGVKTVRSLAEIGSALRELLHK 290


>gi|226486592|emb|CAX74373.1| succinate-CoA ligase [Schistosoma japonicum]
 gi|226486594|emb|CAX74374.1| succinate-CoA ligase [Schistosoma japonicum]
          Length = 324

 Score =  345 bits (885), Expect = 4e-93,   Method: Composition-based stats.
 Identities = 180/299 (60%), Positives = 232/299 (77%), Gaps = 6/299 (2%)

Query: 3   ILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFTTV 62
           IL+D+NTK++ QG TGK GTFH++Q + Y  T++VGG+ P KG +   G    +PVF +V
Sbjct: 28  ILLDENTKLICQGFTGKQGTFHSQQTLAY-GTKLVGGVSPGKGGSVHLG----LPVFNSV 82

Query: 63  AEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARL-EKSS 121
            EAK+ T A A+VIYVPP  A  AI E+I+AEIPLIVCITEGIP  DM+RV+ RL E+S 
Sbjct: 83  KEAKDATGATATVIYVPPPHAATAIYEAIDAEIPLIVCITEGIPQHDMIRVRKRLTEQSV 142

Query: 122 SRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTAV 181
           SRLIGPNCPGI+ PD CKIGIMP  I + G+VGI+SRSGTLTYEAVFQT+Q GLGQS  V
Sbjct: 143 SRLIGPNCPGIIKPDVCKIGIMPAHIHKPGTVGIVSRSGTLTYEAVFQTTQVGLGQSLCV 202

Query: 182 GIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIVG 241
           GIGGDP  GT+FID L++FL D  T+SI+++GEIGG +EE+AA+FLK      + KP+V 
Sbjct: 203 GIGGDPFNGTDFIDCLQVFLNDPNTKSIILLGEIGGESEEKAAEFLKQHNVGPKHKPVVS 262

Query: 242 FVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGSL 300
           F+AG TAPPGR MGHAGA+IS GKGGA++K+ A++ AG+ + PSPA++G +L++ +  L
Sbjct: 263 FIAGVTAPPGRRMGHAGAIISLGKGGAKEKMAALESAGVVVTPSPAKLGTTLLKAIADL 321


>gi|328473392|gb|EGF44240.1| succinyl-CoA synthetase subunit alpha [Vibrio parahaemolyticus
           10329]
          Length = 290

 Score =  345 bits (885), Expect = 5e-93,   Method: Composition-based stats.
 Identities = 180/298 (60%), Positives = 222/298 (74%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+TKV+ QG TG  GTFH+EQAI Y  TQ+VGG+ P KG     G    +PVF 
Sbjct: 1   MSVLINKDTKVICQGFTGGQGTFHSEQAIAY-GTQMVGGVSPGKGGQTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T A A+VIYVP     DAI+E+I+A I LIV ITEGIP  DM+ VK +LE++
Sbjct: 56  TVREAVEATGATATVIYVPAPFCKDAILEAIDAGIELIVTITEGIPTTDMIDVKVKLEET 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TPD CKIGIMPG I +KG VGI+SRSGTLTYEAV QT+ EG GQST 
Sbjct: 116 GVRMIGPNCPGVITPDECKIGIMPGHIHKKGKVGIVSRSGTLTYEAVKQTTDEGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L+LF  D  TE+IVM+GEIGG+AEEEAA F+K+       KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILKLFQKDPETEAIVMIGEIGGTAEEEAAAFIKEN----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            ++AG TAPPG+ MGHAGA+ISGGKG AEDK  A++ AG+    S A IG+ L E+ G
Sbjct: 232 SYIAGVTAPPGKRMGHAGAIISGGKGTAEDKFAALEAAGVKTVKSLADIGQGLREVTG 289


>gi|190149797|ref|YP_001968322.1| succinyl-CoA ligase [ADP-forming] subunit alpha [Actinobacillus
           pleuropneumoniae serovar 7 str. AP76]
 gi|303252121|ref|ZP_07338289.1| succinyl-CoA synthetase alpha chain [Actinobacillus
           pleuropneumoniae serovar 2 str. 4226]
 gi|307247457|ref|ZP_07529502.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Actinobacillus
           pleuropneumoniae serovar 2 str. S1536]
 gi|307263117|ref|ZP_07544738.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Actinobacillus
           pleuropneumoniae serovar 13 str. N273]
 gi|189914928|gb|ACE61180.1| succinyl-CoA ligase [ADP-forming] subunit alpha [Actinobacillus
           pleuropneumoniae serovar 7 str. AP76]
 gi|302648904|gb|EFL79092.1| succinyl-CoA synthetase alpha chain [Actinobacillus
           pleuropneumoniae serovar 2 str. 4226]
 gi|306855960|gb|EFM88118.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Actinobacillus
           pleuropneumoniae serovar 2 str. S1536]
 gi|306871479|gb|EFN03202.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Actinobacillus
           pleuropneumoniae serovar 13 str. N273]
          Length = 290

 Score =  345 bits (885), Expect = 5e-93,   Method: Composition-based stats.
 Identities = 184/299 (61%), Positives = 225/299 (75%), Gaps = 9/299 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           M+IL+DKNTKV+ QG TG  GTFH+EQA+ Y  T++VGG+ P KG T   G    +PVF 
Sbjct: 1   MAILIDKNTKVICQGFTGGQGTFHSEQALAY-GTKLVGGVSPNKGGTTHLG----LPVFD 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E+T A ASVIYVP  G  DAI+E+I+A I LIVCITEGIP LDMV VK +L++S
Sbjct: 56  TVREAVEKTGATASVIYVPAPGCKDAILEAIDAGIQLIVCITEGIPTLDMVCVKQKLKES 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPGI+TPD CKIGIMP  I +KG +GI+SRSGTLTYEAV QT+ EG GQST 
Sbjct: 116 GVRMIGPNCPGIITPDECKIGIMPAHIHKKGKIGIVSRSGTLTYEAVKQTTDEGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L+LF AD  TE+IVM+GEIGGSAEEEAA+F+K        KP+V
Sbjct: 176 VGIGGDPIPGSSFIDILKLFQADPETEAIVMIGEIGGSAEEEAAEFIKMH----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
            ++AG TAP G+ MGHAGA+ISGGKG A++K   ++ AG+    S A IG +L ELL  
Sbjct: 232 SYIAGVTAPKGKRMGHAGAIISGGKGTADEKFKTLENAGVKTVRSLAEIGSALRELLHK 290


>gi|77457845|ref|YP_347350.1| succinyl-CoA synthetase subunit alpha [Pseudomonas fluorescens
           Pf0-1]
 gi|77381848|gb|ABA73361.1| succinyl-CoA synthetase alpha chain [Pseudomonas fluorescens Pf0-1]
          Length = 294

 Score =  345 bits (885), Expect = 5e-93,   Method: Composition-based stats.
 Identities = 173/298 (58%), Positives = 216/298 (72%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+TKV+ QG TG  GTFH+EQAI Y  T++VGG+ P KG T      +N+PVF 
Sbjct: 1   MSVLINKDTKVICQGFTGAQGTFHSEQAIAY-GTKMVGGVTPGKGGTTH----LNLPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T A ASVIYVP     D+I+E+    I LIVCITEGIP LDM+  K + ++ 
Sbjct: 56  TVKEAVEATGATASVIYVPAPFCKDSILEAAFGGIKLIVCITEGIPTLDMLDAKVKCDEL 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
              LIGPNCPG++TP  CKIGIMPG I   G VGI+SRSGTLTYEAV QT+  G GQST 
Sbjct: 116 GVTLIGPNCPGVITPGECKIGIMPGHIHLPGKVGIVSRSGTLTYEAVKQTTDAGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L+LF  D  TE+IVM+GEIGGSAEEEAA ++K        KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILKLFQEDPKTEAIVMIGEIGGSAEEEAAAYIKAN----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            ++AG TAPPG+ MGHAGA+ISGGKG A++K  A+++AG+    S A IG++L EL G
Sbjct: 232 SYIAGVTAPPGKRMGHAGAIISGGKGTADEKFAALQDAGVKTVRSLADIGKALAELTG 289


>gi|91228431|ref|ZP_01262356.1| succinyl-CoA synthetase alpha subunit [Vibrio alginolyticus 12G01]
 gi|254229704|ref|ZP_04923113.1| succinyl-CoA synthetase alpha chain [Vibrio sp. Ex25]
 gi|262394880|ref|YP_003286734.1| succinyl-CoA ligase [ADP-forming] subunit alpha [Vibrio sp. Ex25]
 gi|269967958|ref|ZP_06181998.1| succinyl-CoA synthetase alpha subunit [Vibrio alginolyticus 40B]
 gi|91188015|gb|EAS74322.1| succinyl-CoA synthetase alpha subunit [Vibrio alginolyticus 12G01]
 gi|151937749|gb|EDN56598.1| succinyl-CoA synthetase alpha chain [Vibrio sp. Ex25]
 gi|262338474|gb|ACY52269.1| succinyl-CoA ligase [ADP-forming] alpha chain [Vibrio sp. Ex25]
 gi|269827481|gb|EEZ81775.1| succinyl-CoA synthetase alpha subunit [Vibrio alginolyticus 40B]
          Length = 290

 Score =  345 bits (885), Expect = 5e-93,   Method: Composition-based stats.
 Identities = 179/298 (60%), Positives = 222/298 (74%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+TKV+ QG TG  GTFH+EQAI Y  TQ+VGG+ P KG     G    +PVF 
Sbjct: 1   MSVLINKDTKVICQGFTGGQGTFHSEQAIAY-GTQMVGGVSPGKGGQTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T A A+VIYVP     DAI+E+I+A I LIV ITEGIP  DM+ VK +LE++
Sbjct: 56  TVREAVEATGATATVIYVPAPFCKDAILEAIDAGIELIVTITEGIPTTDMIDVKVKLEET 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TPD CKIGIMPG I +KG VGI+SRSGTLTYEAV QT+ EG GQST 
Sbjct: 116 GVRMIGPNCPGVITPDECKIGIMPGHIHKKGKVGIVSRSGTLTYEAVKQTTDEGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L+LF  D  TE+IVM+GEIGG+AEEEAA ++K+       KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILKLFQEDPETEAIVMIGEIGGTAEEEAAAYIKEN----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            ++AG TAPPG+ MGHAGA+ISGGKG AEDK  A++ AG+    S A IG+ L E+ G
Sbjct: 232 SYIAGVTAPPGKRMGHAGAIISGGKGTAEDKFAALEAAGVKTVKSLAEIGQGLREVTG 289


>gi|323135996|ref|ZP_08071079.1| succinyl-CoA synthetase, alpha subunit [Methylocystis sp. ATCC
           49242]
 gi|322399087|gb|EFY01606.1| succinyl-CoA synthetase, alpha subunit [Methylocystis sp. ATCC
           49242]
          Length = 294

 Score =  345 bits (885), Expect = 5e-93,   Method: Composition-based stats.
 Identities = 213/298 (71%), Positives = 258/298 (86%), Gaps = 5/298 (1%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L+DKNTKV+ QG TGK  TFH+ QA+ Y  T++VGG+ P KG +      +++PVF 
Sbjct: 1   MSVLIDKNTKVITQGFTGKTATFHSVQAMDY-GTKMVGGVSPGKGGSTH----LDLPVFD 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TVAEA+E+T A+ASV+YVPP GA DAI E+IEAEIPLIVCITEG+PV DM+RVK  L  S
Sbjct: 56  TVAEAREKTGADASVVYVPPPGAADAICEAIEAEIPLIVCITEGVPVQDMIRVKRALCGS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            SRLIGPNCPG++T    KIGIMPG+IF +GSVG++SRSGTLTYEAVFQT++EGLGQ++A
Sbjct: 116 KSRLIGPNCPGVVTAGESKIGIMPGNIFSRGSVGVVSRSGTLTYEAVFQTTREGLGQTSA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPVKGT+FI+VLELFLADEAT+SI+M+GEIGGSAEEEAAQFLKDEAKRGRKKP+V
Sbjct: 176 VGIGGDPVKGTDFIEVLELFLADEATKSIIMIGEIGGSAEEEAAQFLKDEAKRGRKKPMV 235

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           GF+AG+TAPPGR MGHAGA+ISGGKG AE KI AM+ AGI ++PSPAR+G++LVE+L 
Sbjct: 236 GFIAGRTAPPGRRMGHAGAIISGGKGDAESKIAAMESAGIRVSPSPARLGKTLVEVLK 293


>gi|301156159|emb|CBW15630.1| succinyl-CoA synthetase, NAD(P)-binding, alpha subunit [Haemophilus
           parainfluenzae T3T1]
          Length = 289

 Score =  345 bits (885), Expect = 5e-93,   Method: Composition-based stats.
 Identities = 178/298 (59%), Positives = 220/298 (73%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           M+IL++K TKV+ QG TG  GTFH EQA+ Y  T++VGGI P KG T   G    +PVF 
Sbjct: 1   MAILINKETKVICQGFTGAQGTFHCEQALAY-GTKLVGGISPNKGGTTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA + T A A++IYVP     DAI+E+I+A I L+VCITEGIP LDM+ VK +L ++
Sbjct: 56  TVREAVQATGATATMIYVPAPFCKDAILEAIDAGIQLVVCITEGIPTLDMLLVKQKLNET 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
              +IGPNCPG++TPD CKIGIMPG+I +KG VGI+SRSGTLTYEAV QT+ EG GQST 
Sbjct: 116 GVVMIGPNCPGVITPDECKIGIMPGNIHKKGRVGIVSRSGTLTYEAVKQTTDEGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L+ F  D  TE+IVM+GEIGGSAEEEAA F+K        KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILKRFQEDPETEAIVMIGEIGGSAEEEAAAFIKSH----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            ++AG TAP G+ MGHAGA+ISGGKG AEDKI A++ AG+    S A IG +L ELL 
Sbjct: 232 AYIAGVTAPKGKRMGHAGAIISGGKGTAEDKIAALEAAGVKTVRSLAEIGSALRELLK 289


>gi|118479057|ref|YP_896208.1| succinyl-CoA synthetase subunit alpha [Bacillus thuringiensis str.
           Al Hakam]
 gi|196047753|ref|ZP_03114949.1| succinate-CoA ligase (ADP-forming), alpha subunit [Bacillus cereus
           03BB108]
 gi|118418282|gb|ABK86701.1| succinyl-CoA synthetase (ADP-forming) alpha subunit [Bacillus
           thuringiensis str. Al Hakam]
 gi|196021412|gb|EDX60123.1| succinate-CoA ligase (ADP-forming), alpha subunit [Bacillus cereus
           03BB108]
          Length = 300

 Score =  345 bits (885), Expect = 5e-93,   Method: Composition-based stats.
 Identities = 180/299 (60%), Positives = 231/299 (77%), Gaps = 9/299 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+LV+K+TKV+VQG+TG  G FHT+Q I Y  T++VGG+ P KG T   G    VPVF 
Sbjct: 1   MSVLVNKDTKVIVQGITGSQGLFHTKQMIEY-GTKIVGGVTPGKGGTDIEG----VPVFD 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV +A + T ANASV+YVPP+ A DAI+E+++AEI L+VCITEGIPVLDMV VK  ++  
Sbjct: 56  TVEDAVKATGANASVVYVPPAFAADAIMEAVDAEIDLVVCITEGIPVLDMVNVKRYMDGK 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            +RL+GPNCPG++TPD CKIGIMPG I +KG VGI+SRSGTLTYEAV Q +QEG+GQSTA
Sbjct: 116 HTRLLGPNCPGVITPDECKIGIMPGYIHKKGHVGIVSRSGTLTYEAVHQLTQEGIGQSTA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPV GT+FID L+ F  DE T +++M+GEIGG+AEEEAA+++K        KP+V
Sbjct: 176 VGIGGDPVNGTDFIDALKAFNEDEETHAVIMIGEIGGTAEEEAAEWVKANM----TKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
           GF+ G+TAP G+ MGHAGA+ISGGKG A +KI  M+  GI +A +PA +G +L+ +L  
Sbjct: 232 GFIGGQTAPAGKRMGHAGAIISGGKGTAAEKIKTMEACGIKVAETPAVMGETLISVLKE 290


>gi|254713658|ref|ZP_05175469.1| succinyl-CoA synthetase subunit alpha [Brucella ceti M644/93/1]
 gi|254715988|ref|ZP_05177799.1| succinyl-CoA synthetase subunit alpha [Brucella ceti M13/05/1]
 gi|261217754|ref|ZP_05932035.1| succinyl-CoA synthetase subunit alpha [Brucella ceti M13/05/1]
 gi|261321398|ref|ZP_05960595.1| succinyl-CoA synthetase subunit alpha [Brucella ceti M644/93/1]
 gi|260922843|gb|EEX89411.1| succinyl-CoA synthetase subunit alpha [Brucella ceti M13/05/1]
 gi|261294088|gb|EEX97584.1| succinyl-CoA synthetase subunit alpha [Brucella ceti M644/93/1]
          Length = 300

 Score =  345 bits (885), Expect = 5e-93,   Method: Composition-based stats.
 Identities = 235/299 (78%), Positives = 269/299 (89%), Gaps = 1/299 (0%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTG-GNVNVPVF 59
           MSILV+K+TKVLVQGLTGK GTFHTEQA+ Y  TQ+VGGIHPKKG   W G     +P+F
Sbjct: 1   MSILVNKDTKVLVQGLTGKTGTFHTEQALAYYGTQMVGGIHPKKGGETWEGSKGEKLPIF 60

Query: 60  TTVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEK 119
            TVAE KERT A+ASVIYVPP+GA DAIIE+IEAEI  IVCITEGIPV+DMVRVK RLE+
Sbjct: 61  ATVAEGKERTGADASVIYVPPAGAADAIIEAIEAEIGFIVCITEGIPVMDMVRVKERLER 120

Query: 120 SSSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQST 179
           S SRL+GPNCPGILTP+ CKIGIMPG+IF+KGSVG++SRSGTLTYEAVFQTS EGLGQ+T
Sbjct: 121 SKSRLLGPNCPGILTPEECKIGIMPGNIFKKGSVGVVSRSGTLTYEAVFQTSNEGLGQTT 180

Query: 180 AVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPI 239
           AVGIGGD VKGTEFIDVLE+FLAD+ T+SIVM+GEIGGSAEE+AAQFLKDEAKRGRKKP+
Sbjct: 181 AVGIGGDSVKGTEFIDVLEMFLADDETKSIVMIGEIGGSAEEDAAQFLKDEAKRGRKKPM 240

Query: 240 VGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           VGF+AG+TAP GRTMGHAGAVISGGKGGAEDKI AM+ AGI ++PSPA++G++LVE+L 
Sbjct: 241 VGFIAGRTAPAGRTMGHAGAVISGGKGGAEDKIAAMESAGIRVSPSPAQLGKTLVEVLK 299


>gi|326513084|dbj|BAK03449.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 329

 Score =  345 bits (884), Expect = 5e-93,   Method: Composition-based stats.
 Identities = 181/297 (60%), Positives = 227/297 (76%), Gaps = 9/297 (3%)

Query: 3   ILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFTTV 62
           + VDK+T+V+ QG+TGK GTFHTEQAI Y  T +VGG+ PKKG T   G    +PVF +V
Sbjct: 35  VFVDKSTRVICQGITGKNGTFHTEQAIEY-GTNMVGGVTPKKGGTEHLG----LPVFNSV 89

Query: 63  AEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEK-SS 121
           AEAK  T ANASVIYVPP  A   I+E++EAE+ L+VCITEGIP  DMV+VKA L + S 
Sbjct: 90  AEAKAETKANASVIYVPPPFAAATIMEALEAELDLVVCITEGIPQHDMVKVKAALNRQSK 149

Query: 122 SRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTAV 181
           +RLIGPNCPGI+ P  CKIGIMPG I + G +GI+SRSGTLTYEAVFQT+  GLGQST V
Sbjct: 150 TRLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCV 209

Query: 182 GIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIVG 241
           G+GGDP  GT F+D LE F+ D  TE IV++GEIGG+AEE+AA F+++      +KP+V 
Sbjct: 210 GMGGDPFNGTNFVDCLEKFVDDPQTEGIVLIGEIGGTAEEDAAAFIRE---SKTEKPVVA 266

Query: 242 FVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           F+AG TAPPGR MGHAGA++SGGKG A+DKI A++EAG+ +  SPA+IG ++ E+  
Sbjct: 267 FIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKALREAGVTVVESPAKIGSTMFEIFK 323


>gi|161504111|ref|YP_001571223.1| succinyl-CoA synthetase subunit alpha [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:-- str. RSK2980]
 gi|160865458|gb|ABX22081.1| hypothetical protein SARI_02209 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 289

 Score =  345 bits (884), Expect = 6e-93,   Method: Composition-based stats.
 Identities = 172/298 (57%), Positives = 220/298 (73%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+TKV+ QG TG  GTFH+EQAI Y  TQ+VGG+ P KG T   G    +PVF 
Sbjct: 1   MSVLINKDTKVICQGFTGSQGTFHSEQAIAY-GTQMVGGVTPGKGGTTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA + T A ASVIYVP     D+I+E+I+A I LI+ ITEGIP LDM+ VK +L+++
Sbjct: 56  TVREAVDATGATASVIYVPAPFCKDSILEAIDAGIKLIITITEGIPTLDMLTVKVKLDEA 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TP  CKIGIMPG I + G VGI+SRSGTLTYEAV QT+  G GQST 
Sbjct: 116 GVRMIGPNCPGVITPGECKIGIMPGHIHKPGKVGIVSRSGTLTYEAVKQTTDYGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L+LF  D  TE+IVM+GEIGGSAEEEAA ++KD       KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILKLFQEDPQTEAIVMIGEIGGSAEEEAAAYIKDH----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           G++AG TAP G+ MGHAGA+I+GGKG A++K  A++ AG+    S A IG +L  ++ 
Sbjct: 232 GYIAGVTAPKGKRMGHAGAIIAGGKGTADEKFAALEAAGVKTVRSLADIGEALKAIIK 289


>gi|291616732|ref|YP_003519474.1| SucD [Pantoea ananatis LMG 20103]
 gi|291151762|gb|ADD76346.1| SucD [Pantoea ananatis LMG 20103]
 gi|327393158|dbj|BAK10580.1| succinyl-CoA synthetase alpha chain SucD [Pantoea ananatis AJ13355]
          Length = 291

 Score =  345 bits (884), Expect = 6e-93,   Method: Composition-based stats.
 Identities = 173/297 (58%), Positives = 219/297 (73%), Gaps = 9/297 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL+DKNTKV+ QG TG  GTFH+EQA+ Y  TQ+VGG+ P KG T   G    +PVF 
Sbjct: 1   MSILIDKNTKVICQGFTGGQGTFHSEQALAY-GTQLVGGVTPGKGGTTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T A A+VIYVP     D I+E+I+A I LI+ ITEGIP LDM+ VK +L+++
Sbjct: 56  TVREAVEATGATATVIYVPAPFCKDGILEAIDAGIKLIITITEGIPTLDMLTVKMKLDEA 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TP  CKIGIMPG I + G VGI+SRSGTLTYEAV QT+  G GQST 
Sbjct: 116 GVRMIGPNCPGVITPGECKIGIMPGHIHQPGRVGIVSRSGTLTYEAVKQTTDIGYGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L++F  D  TE+IVM+GEIGGSAEEEAA F+K+       KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILKMFQDDPQTEAIVMIGEIGGSAEEEAAAFIKEH----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELL 297
           G++AG TAP G+ MGHAGA+I+GGKG A++K  A++ AG+    S A IG ++  +L
Sbjct: 232 GYIAGVTAPKGKRMGHAGAIIAGGKGTADEKFAALEAAGVKTVRSLADIGDAVKAVL 288


>gi|254480392|ref|ZP_05093639.1| succinate-CoA ligase, alpha subunit subfamily [marine gamma
           proteobacterium HTCC2148]
 gi|214038975|gb|EEB79635.1| succinate-CoA ligase, alpha subunit subfamily [marine gamma
           proteobacterium HTCC2148]
          Length = 290

 Score =  345 bits (884), Expect = 6e-93,   Method: Composition-based stats.
 Identities = 170/298 (57%), Positives = 214/298 (71%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L+DKNTKV+ QG TG  GTFH+EQAI Y  T++VGG+ P KG     G    +PVF 
Sbjct: 1   MSVLIDKNTKVICQGFTGSQGTFHSEQAIEY-GTKMVGGVTPGKGGQEHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA   T A+ASVIYVP     D+I+E+    + LIVCITEGIP LDM+  K + ++ 
Sbjct: 56  TVVEAVAATGADASVIYVPAPFCKDSILEAANGGVKLIVCITEGIPTLDMLEAKVKCDEL 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             RL+GPNCPG++TP  CKIGIMPG I   G VGI+SRSGTLTYEAV QT+  G GQST 
Sbjct: 116 GVRLVGPNCPGVITPGECKIGIMPGHIHLPGKVGIVSRSGTLTYEAVKQTTDAGYGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+LE+F  D ATE+IVM+GEIGG+AEEEAA ++K        KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILEMFQNDPATEAIVMIGEIGGTAEEEAAAYIKAN----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            ++AG TAP G+ MGHAGA+ISGGKG A++K  A+++AG+    S A IG +L E+ G
Sbjct: 232 SYIAGVTAPKGKRMGHAGAIISGGKGTADEKFAALEDAGVKTVRSLAEIGTALGEITG 289


>gi|145627821|ref|ZP_01783622.1| succinyl-CoA synthetase alpha subunit [Haemophilus influenzae
           22.1-21]
 gi|144979596|gb|EDJ89255.1| succinyl-CoA synthetase alpha subunit [Haemophilus influenzae
           22.1-21]
          Length = 289

 Score =  345 bits (884), Expect = 6e-93,   Method: Composition-based stats.
 Identities = 179/298 (60%), Positives = 221/298 (74%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           M+IL+DKNTKV+ QG TG  GTFH+EQA+ Y  TQ+VGG+ P KG +   G    +PVF 
Sbjct: 1   MAILIDKNTKVICQGFTGGQGTFHSEQALAY-GTQLVGGVSPNKGGSSHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T A A+VIYVP     DAIIE+I+A I LIVCITEGIP LDM++VK +L ++
Sbjct: 56  TVREAVENTGATATVIYVPAPFCKDAIIEAIDAGIKLIVCITEGIPTLDMLKVKQKLNET 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
              +IGPNCPG++TPD CKIGIMP  I +KG VGI+SRSGTLTYEAV QT+ EG GQST 
Sbjct: 116 GVVMIGPNCPGVITPDECKIGIMPAHIHKKGKVGIVSRSGTLTYEAVKQTTDEGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+LE F  D  TE+IVM+GEIGGSAEE+AA F+KD       KP+V
Sbjct: 176 VGIGGDPIPGSSFIDILERFQQDPETEAIVMIGEIGGSAEEDAAIFIKDN----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            ++AG TAP G+ MGHAGA+ISGGKG A +KI A++ AG+    S A IG +L ++L 
Sbjct: 232 AYIAGITAPKGKRMGHAGAIISGGKGTAAEKIAALEAAGVTCVKSLAEIGAALRKILK 289


>gi|261364253|ref|ZP_05977136.1| succinyl-CoA synthetase subunit alpha [Neisseria mucosa ATCC 25996]
 gi|288567495|gb|EFC89055.1| succinyl-CoA synthetase subunit alpha [Neisseria mucosa ATCC 25996]
          Length = 296

 Score =  345 bits (884), Expect = 6e-93,   Method: Composition-based stats.
 Identities = 164/301 (54%), Positives = 223/301 (74%), Gaps = 11/301 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+TKVLVQG TGK GTFH+EQA+ Y  T+VVGG+ P KG        +N+PVF 
Sbjct: 1   MSVLINKDTKVLVQGFTGKNGTFHSEQALAY-GTKVVGGVTPGKGGQTH----LNLPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARL--E 118
           T+ EA + T A+ASVIYVP     D+I+E++++ + L+V ITEG+P LDM++ K  L   
Sbjct: 56  TMKEAVKETGADASVIYVPAPFVLDSIVEAVDSGVGLVVVITEGVPTLDMLKAKRYLETN 115

Query: 119 KSSSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQS 178
            + +RL+GPNCPG++TP  CKIGIMPG I   G +GI+SRSGTLTYEAV QT++ GLGQS
Sbjct: 116 GNGTRLVGPNCPGVITPGECKIGIMPGHIHTPGRIGIISRSGTLTYEAVAQTTKLGLGQS 175

Query: 179 TAVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKP 238
           T +GIGGDP+ G   ID L+LF  D  T++I+M+GEIGG+AEEEAA++++        KP
Sbjct: 176 TCIGIGGDPIPGMNQIDALKLFQEDPDTDAIIMIGEIGGTAEEEAAEYIQSN----VTKP 231

Query: 239 IVGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           +VG++AG TAP G+ MGHAGA+ISGGKG AE+K  A ++AGI    SPA +G +++E+L 
Sbjct: 232 VVGYIAGVTAPKGKRMGHAGAIISGGKGTAEEKFAAFEKAGIAYTRSPAELGSTMLEVLK 291

Query: 299 S 299
           +
Sbjct: 292 A 292


>gi|229162771|ref|ZP_04290728.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Bacillus cereus
           R309803]
 gi|228620653|gb|EEK77522.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Bacillus cereus
           R309803]
          Length = 300

 Score =  345 bits (884), Expect = 6e-93,   Method: Composition-based stats.
 Identities = 180/299 (60%), Positives = 230/299 (76%), Gaps = 9/299 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+LV+K+TKV+VQG+TG  G FHT+Q I Y  T++VGG+ P KG T   G    VPVF 
Sbjct: 1   MSVLVNKDTKVIVQGITGSQGLFHTKQMIEY-GTKIVGGVTPGKGGTDIEG----VPVFD 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV +A + T ANASV+YVPP+ A DAI+E+++AEI L+VCITEGIPVLDMV VK  +   
Sbjct: 56  TVEDAVKATGANASVVYVPPAFAADAIMEAVDAEIDLVVCITEGIPVLDMVNVKRYMAGK 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            +RL+GPNCPG++TPD CKIGIMPG I +KG VGI+SRSGTLTYEAV Q +QEG+GQSTA
Sbjct: 116 HTRLLGPNCPGVITPDECKIGIMPGYIHKKGHVGIVSRSGTLTYEAVHQLTQEGIGQSTA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPV GT+FID L+ F  DE T +++M+GEIGG+AEEEAA+++K        KP+V
Sbjct: 176 VGIGGDPVNGTDFIDALKAFNEDEETHAVIMIGEIGGTAEEEAAEWVKANM----TKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
           GF+ G+TAP G+ MGHAGA+ISGGKG A +KI  M+  GI +A +PA +G +L+ +L  
Sbjct: 232 GFIGGQTAPEGKRMGHAGAIISGGKGTAAEKIKTMEACGIKVAETPAVMGETLISVLKE 290


>gi|188534428|ref|YP_001908225.1| Succinyl-CoA synthetase, alpha subunit [Erwinia tasmaniensis
           Et1/99]
 gi|188029470|emb|CAO97347.1| Succinyl-CoA synthetase, alpha subunit [Erwinia tasmaniensis
           Et1/99]
          Length = 290

 Score =  345 bits (884), Expect = 6e-93,   Method: Composition-based stats.
 Identities = 175/297 (58%), Positives = 220/297 (74%), Gaps = 9/297 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL+DKNTKV+ QG TG  GTFH+EQA+ Y  TQ+VGG+ P KG T   G    +PVF 
Sbjct: 1   MSILIDKNTKVICQGFTGGQGTFHSEQALAY-GTQLVGGVTPGKGGTEHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T A ASVIYVP     D I+E+IEA I LI+ ITEGIP LDM+ VK +L+++
Sbjct: 56  TVREAVEATGATASVIYVPAPFCKDGILEAIEAGIKLIITITEGIPTLDMLTVKVKLDEA 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TP +CKIGIMPG I + G +GI+SRSGTLTYEAV QT+  G GQST 
Sbjct: 116 GVRMIGPNCPGVITPGACKIGIMPGHIHQPGRIGIVSRSGTLTYEAVKQTTDIGYGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L+LF  D  TE+IVM+GEIGGSAEEEAA F+K+       KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILKLFQDDPQTEAIVMIGEIGGSAEEEAAAFIKEH----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELL 297
           G++AG TAP G+ MGHAGA+I+GGKG A++K  A++ AG+    S A IG ++  +L
Sbjct: 232 GYIAGVTAPKGKRMGHAGAIIAGGKGTADEKFAALEAAGVKTVRSLADIGEAVKAVL 288


>gi|293392047|ref|ZP_06636381.1| succinyl-CoA ligase [Aggregatibacter actinomycetemcomitans D7S-1]
 gi|290952581|gb|EFE02700.1| succinyl-CoA ligase [Aggregatibacter actinomycetemcomitans D7S-1]
          Length = 290

 Score =  345 bits (884), Expect = 7e-93,   Method: Composition-based stats.
 Identities = 175/299 (58%), Positives = 220/299 (73%), Gaps = 9/299 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL++ NTKV+ QG TG  GTFH++QA+ Y  T++VGG+ P KG T   G    +PVF 
Sbjct: 1   MSILINNNTKVICQGFTGGQGTFHSQQALAY-GTKLVGGVSPGKGGTTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV +A E T A A+VIYVP  G  DAI+E+I+A I LIVCITEGIP LDM+ VK RL ++
Sbjct: 56  TVRDAVEATGATATVIYVPAPGCKDAILEAIDAGIQLIVCITEGIPTLDMLVVKQRLNQT 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TP+ CKIGIMPG I +KG +GI+SRSGTLTYEAV QT+ EG GQST 
Sbjct: 116 GVRMIGPNCPGVITPEECKIGIMPGDIHKKGKIGIISRSGTLTYEAVKQTTDEGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ F+D+L+LF  D  TE+IVM+GEIGGSAEEEAA F+K        KP+V
Sbjct: 176 VGIGGDPIPGSNFVDILKLFQEDPQTEAIVMIGEIGGSAEEEAAAFIKQH----ITKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
            ++AG TAP  + MGHAGA+ISGGKG A++K  A + AG+    S A IG +L E+L  
Sbjct: 232 SYIAGVTAPKDKRMGHAGAIISGGKGTADEKFAAFEAAGVKTVRSLADIGAALREVLKK 290


>gi|300715881|ref|YP_003740684.1| succinyl-CoA synthetase, alpha subunit [Erwinia billingiae Eb661]
 gi|299061717|emb|CAX58833.1| Succinyl-CoA synthetase, alpha subunit [Erwinia billingiae Eb661]
          Length = 290

 Score =  345 bits (884), Expect = 7e-93,   Method: Composition-based stats.
 Identities = 175/299 (58%), Positives = 220/299 (73%), Gaps = 9/299 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL+DKNTKV+ QG TG  GTFH+EQA+ Y  TQ+VGG+ P KG T   G    +PVF 
Sbjct: 1   MSILIDKNTKVICQGFTGGQGTFHSEQALAY-GTQLVGGVTPGKGGTEHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T A ASVIYVP     D I+E+IEA I LI+ ITEGIP LDM+ VK +L+++
Sbjct: 56  TVREAVEATGATASVIYVPAPFCKDGILEAIEAGIKLIITITEGIPTLDMLTVKVKLDEA 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TP +CKIGIMPG I + G +GI+SRSGTLTYEAV QT+  G GQST 
Sbjct: 116 GVRMIGPNCPGVITPGACKIGIMPGHIHQPGRIGIVSRSGTLTYEAVKQTTDIGYGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L+LF  D  TE+IVM+GEIGGSAEEEAA F+K+       KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILKLFQEDPQTEAIVMIGEIGGSAEEEAAAFIKEH----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
           G++AG TAP G+ MGHAGA+I+GGKG A++K  A++ AG+    S A IG ++  +L  
Sbjct: 232 GYIAGVTAPKGKRMGHAGAIIAGGKGTADEKFAALEAAGVKTVRSLADIGDAVKAVLPK 290


>gi|226330944|ref|ZP_03806462.1| hypothetical protein PROPEN_04867 [Proteus penneri ATCC 35198]
 gi|225201739|gb|EEG84093.1| hypothetical protein PROPEN_04867 [Proteus penneri ATCC 35198]
          Length = 289

 Score =  345 bits (884), Expect = 7e-93,   Method: Composition-based stats.
 Identities = 175/298 (58%), Positives = 220/298 (73%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL+DKNTKV+ QG TG  GTFH+EQAI Y  TQ+VGG+ P KG T   G    +PVF 
Sbjct: 1   MSILIDKNTKVICQGFTGSQGTFHSEQAIAY-GTQMVGGVTPGKGGTTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T A A+VIYVP     D+I+E+I+A I LI+ ITEGIP LDM+ VK +L+++
Sbjct: 56  TVREAVEATGATATVIYVPAPFCKDSILEAIDAGIKLIITITEGIPTLDMLTVKVKLDEA 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TP  CKIGIMPG I   G VGI+SRSGTLTYEAV QT+  GLGQST 
Sbjct: 116 GVRMIGPNCPGVITPGECKIGIMPGHIHLPGKVGIVSRSGTLTYEAVKQTTDVGLGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L+LF  D  TE+IVM+GEIGG+AEEEAA ++KD       KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILKLFQEDPQTEAIVMIGEIGGTAEEEAAAYIKDH----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           G++AG TAP G+ MGHAGA+I+GGKG A++K  A++ AG+    S A IG ++  L+ 
Sbjct: 232 GYIAGVTAPKGKRMGHAGAIIAGGKGTADEKFAALEAAGVKTVRSLADIGEAIKSLIK 289


>gi|157961615|ref|YP_001501649.1| succinyl-CoA synthetase subunit alpha [Shewanella pealeana ATCC
           700345]
 gi|157846615|gb|ABV87114.1| succinyl-CoA synthetase, alpha subunit [Shewanella pealeana ATCC
           700345]
          Length = 290

 Score =  345 bits (884), Expect = 7e-93,   Method: Composition-based stats.
 Identities = 175/294 (59%), Positives = 219/294 (74%), Gaps = 9/294 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+TKV+ QG TG  GTFH+EQAI Y  T++VGG+ P KG     G    +PVF 
Sbjct: 1   MSVLINKDTKVICQGFTGGQGTFHSEQAIAY-GTKMVGGVSPGKGGQIHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV +A E T A ASVIYVP     DAI+E+I+  I LIVCITEGIP LDM++VK +LE++
Sbjct: 56  TVKDAVEVTGATASVIYVPAPFCKDAILEAIDGGIELIVCITEGIPTLDMLQVKVKLEET 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TP  CKIGIMPG I + G VGI+SRSGTLTYEAV QT+ EG GQST 
Sbjct: 116 GVRMIGPNCPGVITPGECKIGIMPGHIHKPGKVGIVSRSGTLTYEAVKQTTDEGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ GT FIDVLE+F  D  TE+IVM+GEIGG+AEEEAA+++K        KP+V
Sbjct: 176 VGIGGDPIPGTNFIDVLEMFQNDPLTEAIVMIGEIGGTAEEEAAEYIKAN----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLV 294
            ++AG TAP G+ MGHAGA+I+GGKG AEDK  A++ AG+    S A IG++L 
Sbjct: 232 SYIAGVTAPEGKRMGHAGAIIAGGKGTAEDKFAALEAAGVTTVRSLADIGKALR 285


>gi|16764109|ref|NP_459724.1| succinyl-CoA synthetase subunit alpha [Salmonella enterica subsp.
           enterica serovar Typhimurium str. LT2]
 gi|62179313|ref|YP_215730.1| succinyl-CoA synthetase subunit alpha [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. SC-B67]
 gi|161615034|ref|YP_001588999.1| succinyl-CoA synthetase subunit alpha [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|167552842|ref|ZP_02346593.1| succinyl-CoA ligase [ADP-forming] subunit alpha [Salmonella
           enterica subsp. enterica serovar Saintpaul str. SARA29]
 gi|167993016|ref|ZP_02574111.1| succinyl-CoA ligase [ADP-forming] subunit alpha [Salmonella
           enterica subsp. enterica serovar 4,[5],12:i:- str.
           CVM23701]
 gi|168230618|ref|ZP_02655676.1| succinyl-CoA ligase [ADP-forming] subunit alpha [Salmonella
           enterica subsp. enterica serovar Kentucky str. CDC 191]
 gi|168238883|ref|ZP_02663941.1| succinyl-CoA ligase [ADP-forming] subunit alpha (Succinyl-CoA
           synthetase subunit alpha) [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. SL480]
 gi|168240591|ref|ZP_02665523.1| succinyl-CoA ligase [ADP-forming] subunit alpha [Salmonella
           enterica subsp. enterica serovar Heidelberg str. SL486]
 gi|168264343|ref|ZP_02686316.1| succinyl-CoA ligase [ADP-forming] subunit alpha [Salmonella
           enterica subsp. enterica serovar Hadar str. RI_05P066]
 gi|168467704|ref|ZP_02701541.1| succinyl-CoA ligase [ADP-forming] subunit alpha [Salmonella
           enterica subsp. enterica serovar Newport str. SL317]
 gi|168820132|ref|ZP_02832132.1| succinyl-CoA ligase [ADP-forming] subunit alpha [Salmonella
           enterica subsp. enterica serovar Weltevreden str.
           HI_N05-537]
 gi|194446366|ref|YP_002039976.1| succinyl-CoA synthetase subunit alpha [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|194450796|ref|YP_002044769.1| succinyl-CoA synthetase subunit alpha [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|194471718|ref|ZP_03077702.1| succinyl-CoA ligase [ADP-forming] subunit alpha [Salmonella
           enterica subsp. enterica serovar Kentucky str. CVM29188]
 gi|194737845|ref|YP_002113845.1| succinyl-CoA synthetase subunit alpha [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. CVM19633]
 gi|197251804|ref|YP_002145697.1| succinyl-CoA synthetase subunit alpha [Salmonella enterica subsp.
           enterica serovar Agona str. SL483]
 gi|197265743|ref|ZP_03165817.1| succinyl-CoA ligase [ADP-forming] subunit alpha [Salmonella
           enterica subsp. enterica serovar Saintpaul str. SARA23]
 gi|200390672|ref|ZP_03217283.1| succinyl-CoA ligase [ADP-forming] subunit alpha [Salmonella
           enterica subsp. enterica serovar Virchow str. SL491]
 gi|204929815|ref|ZP_03220836.1| succinyl-CoA ligase [ADP-forming] subunit alpha [Salmonella
           enterica subsp. enterica serovar Javiana str.
           GA_MM04042433]
 gi|224582554|ref|YP_002636352.1| succinyl-CoA synthetase subunit alpha [Salmonella enterica subsp.
           enterica serovar Paratyphi C strain RKS4594]
 gi|238911669|ref|ZP_04655506.1| succinyl-CoA synthetase subunit alpha [Salmonella enterica subsp.
           enterica serovar Tennessee str. CDC07-0191]
 gi|16419249|gb|AAL19683.1| succinyl-CoA synthetase, alpha subunit [Salmonella enterica subsp.
           enterica serovar Typhimurium str. LT2]
 gi|62126946|gb|AAX64649.1| succinyl-CoA synthetase, alpha subunit [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. SC-B67]
 gi|161364398|gb|ABX68166.1| hypothetical protein SPAB_02794 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194405029|gb|ACF65251.1| succinyl-CoA ligase [ADP-forming] subunit alpha [Salmonella
           enterica subsp. enterica serovar Newport str. SL254]
 gi|194409100|gb|ACF69319.1| succinyl-CoA ligase [ADP-forming] subunit alpha [Salmonella
           enterica subsp. enterica serovar Heidelberg str. SL476]
 gi|194458082|gb|EDX46921.1| succinyl-CoA ligase [ADP-forming] subunit alpha [Salmonella
           enterica subsp. enterica serovar Kentucky str. CVM29188]
 gi|194713347|gb|ACF92568.1| succinyl-CoA ligase [ADP-forming] subunit alpha [Salmonella
           enterica subsp. enterica serovar Schwarzengrund str.
           CVM19633]
 gi|195629158|gb|EDX48526.1| succinyl-CoA ligase [ADP-forming] subunit alpha [Salmonella
           enterica subsp. enterica serovar Newport str. SL317]
 gi|197215507|gb|ACH52904.1| succinyl-CoA ligase [ADP-forming] subunit alpha [Salmonella
           enterica subsp. enterica serovar Agona str. SL483]
 gi|197243998|gb|EDY26618.1| succinyl-CoA ligase [ADP-forming] subunit alpha [Salmonella
           enterica subsp. enterica serovar Saintpaul str. SARA23]
 gi|197288326|gb|EDY27707.1| succinyl-CoA ligase [ADP-forming] subunit alpha (Succinyl-CoA
           synthetase subunit alpha) [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. SL480]
 gi|199603117|gb|EDZ01663.1| succinyl-CoA ligase [ADP-forming] subunit alpha [Salmonella
           enterica subsp. enterica serovar Virchow str. SL491]
 gi|204320809|gb|EDZ06010.1| succinyl-CoA ligase [ADP-forming] subunit alpha [Salmonella
           enterica subsp. enterica serovar Javiana str.
           GA_MM04042433]
 gi|205322550|gb|EDZ10389.1| succinyl-CoA ligase [ADP-forming] subunit alpha [Salmonella
           enterica subsp. enterica serovar Saintpaul str. SARA29]
 gi|205328900|gb|EDZ15664.1| succinyl-CoA ligase [ADP-forming] subunit alpha [Salmonella
           enterica subsp. enterica serovar 4,[5],12:i:- str.
           CVM23701]
 gi|205334878|gb|EDZ21642.1| succinyl-CoA ligase [ADP-forming] subunit alpha [Salmonella
           enterica subsp. enterica serovar Kentucky str. CDC 191]
 gi|205339881|gb|EDZ26645.1| succinyl-CoA ligase [ADP-forming] subunit alpha [Salmonella
           enterica subsp. enterica serovar Heidelberg str. SL486]
 gi|205343019|gb|EDZ29783.1| succinyl-CoA ligase [ADP-forming] subunit alpha [Salmonella
           enterica subsp. enterica serovar Weltevreden str.
           HI_N05-537]
 gi|205347165|gb|EDZ33796.1| succinyl-CoA ligase [ADP-forming] subunit alpha [Salmonella
           enterica subsp. enterica serovar Hadar str. RI_05P066]
 gi|224467081|gb|ACN44911.1| succinyl-CoA synthetase alpha subunit [Salmonella enterica subsp.
           enterica serovar Paratyphi C strain RKS4594]
 gi|261246002|emb|CBG23804.1| succinyl-CoA synthetase alpha chain [Salmonella enterica subsp.
           enterica serovar Typhimurium str. D23580]
 gi|267992477|gb|ACY87362.1| succinyl-CoA synthetase subunit alpha [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 14028S]
 gi|301157330|emb|CBW16819.1| succinyl-CoA synthetase alpha chain [Salmonella enterica subsp.
           enterica serovar Typhimurium str. SL1344]
 gi|312911765|dbj|BAJ35739.1| succinyl-CoA synthetase subunit alpha [Salmonella enterica subsp.
           enterica serovar Typhimurium str. T000240]
 gi|320085008|emb|CBY94797.1| succinyl-CoA synthetase alpha chain [Salmonella enterica subsp.
           enterica serovar Weltevreden str. 2007-60-3289-1]
 gi|321226314|gb|EFX51365.1| Succinyl-CoA ligase [ADP-forming] alpha chain [Salmonella enterica
           subsp. enterica serovar Typhimurium str. TN061786]
 gi|322615828|gb|EFY12746.1| succinyl-CoA synthetase subunit alpha [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315996572]
 gi|322621224|gb|EFY18081.1| succinyl-CoA synthetase subunit alpha [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-1]
 gi|322623644|gb|EFY20482.1| succinyl-CoA synthetase subunit alpha [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-3]
 gi|322628916|gb|EFY25696.1| succinyl-CoA synthetase subunit alpha [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-4]
 gi|322634896|gb|EFY31626.1| succinyl-CoA synthetase subunit alpha [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-1]
 gi|322636576|gb|EFY33280.1| succinyl-CoA synthetase subunit alpha [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-2]
 gi|322641760|gb|EFY38394.1| succinyl-CoA synthetase subunit alpha [Salmonella enterica subsp.
           enterica serovar Montevideo str. 531954]
 gi|322647817|gb|EFY44297.1| succinyl-CoA synthetase subunit alpha [Salmonella enterica subsp.
           enterica serovar Montevideo str. NC_MB110209-0054]
 gi|322651853|gb|EFY48222.1| succinyl-CoA synthetase subunit alpha [Salmonella enterica subsp.
           enterica serovar Montevideo str. OH_2009072675]
 gi|322652650|gb|EFY48999.1| succinyl-CoA synthetase subunit alpha [Salmonella enterica subsp.
           enterica serovar Montevideo str. CASC_09SCPH15965]
 gi|322658458|gb|EFY54721.1| succinyl-CoA synthetase subunit alpha [Salmonella enterica subsp.
           enterica serovar Montevideo str. 19N]
 gi|322664940|gb|EFY61131.1| succinyl-CoA synthetase subunit alpha [Salmonella enterica subsp.
           enterica serovar Montevideo str. 81038-01]
 gi|322668391|gb|EFY64547.1| succinyl-CoA synthetase subunit alpha [Salmonella enterica subsp.
           enterica serovar Montevideo str. MD_MDA09249507]
 gi|322670521|gb|EFY66654.1| succinyl-CoA synthetase subunit alpha [Salmonella enterica subsp.
           enterica serovar Montevideo str. 414877]
 gi|322675261|gb|EFY71337.1| succinyl-CoA synthetase subunit alpha [Salmonella enterica subsp.
           enterica serovar Montevideo str. 366867]
 gi|322679687|gb|EFY75728.1| succinyl-CoA synthetase subunit alpha [Salmonella enterica subsp.
           enterica serovar Montevideo str. 413180]
 gi|322684837|gb|EFY80836.1| succinyl-CoA synthetase subunit alpha [Salmonella enterica subsp.
           enterica serovar Montevideo str. 446600]
 gi|322713782|gb|EFZ05353.1| succinyl-CoA synthetase subunit alpha [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. A50]
 gi|323129049|gb|ADX16479.1| succinyl-CoA synthetase subunit alpha [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 4/74]
 gi|323193155|gb|EFZ78374.1| succinyl-CoA synthetase subunit alpha [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609458-1]
 gi|323200606|gb|EFZ85681.1| succinyl-CoA synthetase subunit alpha [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556150-1]
 gi|323202278|gb|EFZ87326.1| succinyl-CoA synthetase subunit alpha [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609460]
 gi|323205455|gb|EFZ90421.1| succinyl-CoA synthetase subunit alpha [Salmonella enterica subsp.
           enterica serovar Montevideo str. 507440-20]
 gi|323213506|gb|EFZ98299.1| succinyl-CoA synthetase subunit alpha [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556152]
 gi|323215340|gb|EGA00085.1| succinyl-CoA synthetase subunit alpha [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB101509-0077]
 gi|323221785|gb|EGA06192.1| succinyl-CoA synthetase subunit alpha [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB102109-0047]
 gi|323228085|gb|EGA12221.1| succinyl-CoA synthetase subunit alpha [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB110209-0055]
 gi|323231009|gb|EGA15125.1| succinyl-CoA synthetase subunit alpha [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB111609-0052]
 gi|323234158|gb|EGA18247.1| succinyl-CoA synthetase subunit alpha [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009083312]
 gi|323238147|gb|EGA22205.1| succinyl-CoA synthetase subunit alpha [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009085258]
 gi|323243582|gb|EGA27600.1| succinyl-CoA synthetase subunit alpha [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315731156]
 gi|323247394|gb|EGA31353.1| succinyl-CoA synthetase subunit alpha [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2009159199]
 gi|323251382|gb|EGA35254.1| succinyl-CoA synthetase subunit alpha [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008282]
 gi|323258479|gb|EGA42151.1| succinyl-CoA synthetase subunit alpha [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008283]
 gi|323260633|gb|EGA44242.1| succinyl-CoA synthetase subunit alpha [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008284]
 gi|323264705|gb|EGA48207.1| succinyl-CoA synthetase subunit alpha [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008285]
 gi|323270969|gb|EGA54404.1| succinyl-CoA synthetase subunit alpha [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008287]
 gi|332987676|gb|AEF06659.1| succinyl-CoA synthetase subunit alpha [Salmonella enterica subsp.
           enterica serovar Typhimurium str. UK-1]
          Length = 289

 Score =  344 bits (883), Expect = 7e-93,   Method: Composition-based stats.
 Identities = 173/298 (58%), Positives = 220/298 (73%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+TKV+ QG TG  GTFH+EQAI Y  TQ+VGG+ P KG T   G    +PVF 
Sbjct: 1   MSVLINKDTKVICQGFTGSQGTFHSEQAIAY-GTQMVGGVTPGKGGTTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T A ASVIYVP     D+I+E+I+A I LI+ ITEGIP LDM+ VK +L+++
Sbjct: 56  TVREAVEATGATASVIYVPAPFCKDSILEAIDAGIKLIITITEGIPTLDMLTVKVKLDEA 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TP  CKIGIMPG I + G VGI+SRSGTLTYEAV QT+  G GQST 
Sbjct: 116 GVRMIGPNCPGVITPGECKIGIMPGHIHKPGKVGIVSRSGTLTYEAVKQTTDYGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L+LF  D  TE+IVM+GEIGGSAEEEAA ++KD       KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILKLFQEDPQTEAIVMIGEIGGSAEEEAAAYIKDH----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           G++AG TAP G+ MGHAGA+I+GGKG A++K  A++ AG+    S A IG +L  ++ 
Sbjct: 232 GYIAGVTAPKGKRMGHAGAIIAGGKGTADEKFAALEAAGVKTVRSLADIGEALKAIIK 289


>gi|28897624|ref|NP_797229.1| succinyl-CoA synthetase subunit alpha [Vibrio parahaemolyticus RIMD
           2210633]
 gi|153838601|ref|ZP_01991268.1| succinyl-CoA ligase [ADP-forming] subunit alpha [Vibrio
           parahaemolyticus AQ3810]
 gi|260365989|ref|ZP_05778474.1| succinyl-CoA ligase (ADP-forming) subunit alpha [Vibrio
           parahaemolyticus K5030]
 gi|260878221|ref|ZP_05890576.1| succinyl-CoA ligase (ADP-forming) subunit alpha [Vibrio
           parahaemolyticus AN-5034]
 gi|260895658|ref|ZP_05904154.1| succinyl-CoA ligase (ADP-forming) subunit alpha [Vibrio
           parahaemolyticus Peru-466]
 gi|28805836|dbj|BAC59113.1| succinyl-CoA synthase, alpha subunit [Vibrio parahaemolyticus RIMD
           2210633]
 gi|149748019|gb|EDM58878.1| succinyl-CoA ligase [ADP-forming] subunit alpha [Vibrio
           parahaemolyticus AQ3810]
 gi|308088190|gb|EFO37885.1| succinyl-CoA ligase (ADP-forming) subunit alpha [Vibrio
           parahaemolyticus Peru-466]
 gi|308090179|gb|EFO39874.1| succinyl-CoA ligase (ADP-forming) subunit alpha [Vibrio
           parahaemolyticus AN-5034]
 gi|308111267|gb|EFO48807.1| succinyl-CoA ligase (ADP-forming) subunit alpha [Vibrio
           parahaemolyticus K5030]
          Length = 290

 Score =  344 bits (883), Expect = 7e-93,   Method: Composition-based stats.
 Identities = 180/298 (60%), Positives = 222/298 (74%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+TKV+ QG TG  GTFH+EQAI Y  TQ+VGG+ P KG     G    +PVF 
Sbjct: 1   MSVLINKDTKVICQGFTGGQGTFHSEQAIAY-GTQMVGGVSPGKGGQIHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T A A+VIYVP     DAI+E+I+A I LIV ITEGIP  DM+ VK +LE++
Sbjct: 56  TVREAVEATGATATVIYVPAPFCKDAILEAIDAGIELIVTITEGIPTTDMIDVKVKLEET 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TPD CKIGIMPG I +KG VGI+SRSGTLTYEAV QT+ EG GQST 
Sbjct: 116 GVRMIGPNCPGVITPDECKIGIMPGHIHKKGKVGIVSRSGTLTYEAVKQTTDEGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L+LF  D  TE+IVM+GEIGG+AEEEAA F+K+       KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILKLFQEDPETEAIVMIGEIGGTAEEEAAAFIKEN----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            ++AG TAPPG+ MGHAGA+ISGGKG AEDK  A++ AG+    S A IG+ L E+ G
Sbjct: 232 SYIAGVTAPPGKRMGHAGAIISGGKGTAEDKFAALEAAGVKTVKSLADIGQGLREVTG 289


>gi|295096566|emb|CBK85656.1| succinyl-CoA synthetase (ADP-forming) alpha subunit [Enterobacter
           cloacae subsp. cloacae NCTC 9394]
          Length = 289

 Score =  344 bits (883), Expect = 7e-93,   Method: Composition-based stats.
 Identities = 173/298 (58%), Positives = 220/298 (73%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+TKV+ QG TG  GTFH+EQAI Y  TQ+VGG+ P KG T   G    +PVF 
Sbjct: 1   MSVLINKDTKVICQGFTGSQGTFHSEQAIAY-GTQMVGGVTPGKGGTTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T A A+VIYVP     D+I+E+I+A I LI+ ITEGIP LDM+ VK +L+++
Sbjct: 56  TVREAVEATGATATVIYVPAPFCKDSILEAIDAGIKLIITITEGIPTLDMLTVKVKLDEA 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TP  CKIGIMPG I R G VGI+SRSGTLTYEAV QT+  G GQST 
Sbjct: 116 GVRMIGPNCPGVITPGECKIGIMPGHIHRPGKVGIVSRSGTLTYEAVKQTTDYGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L+LF  D  TE+IVM+GEIGGSAEEEAA ++KD       KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILKLFQEDPQTEAIVMIGEIGGSAEEEAAAYIKDH----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           G++AG TAP G+ MGHAGA+I+GGKG A++K  A++ AG+    S A IG +L  ++ 
Sbjct: 232 GYIAGVTAPKGKRMGHAGAIIAGGKGTADEKFAALEAAGVKTVRSLADIGEALKSIIK 289


>gi|37525387|ref|NP_928731.1| succinyl-CoA synthetase subunit alpha [Photorhabdus luminescens
           subsp. laumondii TTO1]
 gi|36784814|emb|CAE13726.1| succinyl-CoA synthetase alpha chain [Photorhabdus luminescens
           subsp. laumondii TTO1]
          Length = 291

 Score =  344 bits (883), Expect = 7e-93,   Method: Composition-based stats.
 Identities = 177/298 (59%), Positives = 221/298 (74%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL+DKNTKV+ QG TG  GTFH+EQAI Y  TQ+VGG+ P KG T   G    +PVF 
Sbjct: 1   MSILIDKNTKVICQGFTGSQGTFHSEQAIAY-GTQMVGGVTPGKGGTEHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T A ASVIYVP     D+I+E+I+A I LI+ ITEGIP LDM+ VK +L+++
Sbjct: 56  TVREAVEATGATASVIYVPAPFCKDSILEAIDAGIKLIITITEGIPTLDMLAVKVKLDEA 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TPD CKIGIMPG I R G VGI+SRSGTLTYEAV QT+  GLGQST 
Sbjct: 116 GVRMIGPNCPGVITPDECKIGIMPGHIHRAGKVGIVSRSGTLTYEAVKQTTDAGLGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L+LF  D  TE+IVM+GEIGG+AEEEAA ++K        KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILKLFQQDPQTEAIVMIGEIGGTAEEEAAAYIKQH----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            ++AG TAP G+ MGHAGA+I+GGKG A++K  A++ AG+    S A IG ++ +LL 
Sbjct: 232 AYIAGVTAPKGKRMGHAGAIIAGGKGTADEKFAALEAAGVKTVRSLADIGDAVKDLLA 289


>gi|207856183|ref|YP_002242834.1| succinyl-CoA synthetase subunit alpha [Salmonella enterica subsp.
           enterica serovar Enteritidis str. P125109]
 gi|206707986|emb|CAR32275.1| succinyl-CoA synthetase alpha chain [Salmonella enterica subsp.
           enterica serovar Enteritidis str. P125109]
          Length = 289

 Score =  344 bits (883), Expect = 7e-93,   Method: Composition-based stats.
 Identities = 172/298 (57%), Positives = 220/298 (73%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+TKV+ QG TG  GTFH+EQAI Y  TQ+VGG+ P KG T   G    +PVF 
Sbjct: 1   MSVLINKDTKVICQGFTGSQGTFHSEQAIAY-GTQMVGGVTPGKGGTTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T A ASVIYVP     D+I+E+I+A I LI+ ITEGIP LDM+ VK +L+++
Sbjct: 56  TVREAVEATGATASVIYVPAPFCKDSILEAIDAGIKLIITITEGIPTLDMLTVKVKLDEA 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TP  CKIGIMPG I + G VGI+SRSGTLTYEAV QT+  G GQST 
Sbjct: 116 GVRMIGPNCPGVITPGECKIGIMPGHIHKPGKVGIVSRSGTLTYEAVKQTTDYGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L+LF  D  TE+IVM+GEIGGSAEEEAA ++K+       KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILKLFQEDPQTEAIVMIGEIGGSAEEEAAAYIKEH----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           G++AG TAP G+ MGHAGA+I+GGKG A++K  A++ AG+    S A IG +L  ++ 
Sbjct: 232 GYIAGVTAPKGKRMGHAGAIIAGGKGTADEKFAALEAAGVKTVRSLADIGEALKAIIK 289


>gi|198242661|ref|YP_002214707.1| succinyl-CoA synthetase subunit alpha [Salmonella enterica subsp.
           enterica serovar Dublin str. CT_02021853]
 gi|197937177|gb|ACH74510.1| succinyl-CoA ligase [ADP-forming] subunit alpha [Salmonella
           enterica subsp. enterica serovar Dublin str.
           CT_02021853]
 gi|326622463|gb|EGE28808.1| succinyl-CoA ligase [Salmonella enterica subsp. enterica serovar
           Dublin str. 3246]
          Length = 289

 Score =  344 bits (883), Expect = 7e-93,   Method: Composition-based stats.
 Identities = 172/298 (57%), Positives = 220/298 (73%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+TKV+ QG TG  GTFH+EQAI Y  TQ+VGG+ P KG T   G    +PVF 
Sbjct: 1   MSVLINKDTKVICQGFTGSQGTFHSEQAIAY-GTQMVGGVTPGKGGTTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T A ASV+YVP     D+I+E+I+A I LI+ ITEGIP LDM+ VK +L+++
Sbjct: 56  TVREAVEATGATASVVYVPAPFCKDSILEAIDAGIKLIITITEGIPTLDMLTVKVKLDEA 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TP  CKIGIMPG I + G VGI+SRSGTLTYEAV QT+  G GQST 
Sbjct: 116 GVRMIGPNCPGVITPGECKIGIMPGHIHKPGKVGIVSRSGTLTYEAVKQTTDYGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L+LF  D  TE+IVM+GEIGGSAEEEAA ++KD       KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILKLFQEDPQTEAIVMIGEIGGSAEEEAAAYIKDH----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           G++AG TAP G+ MGHAGA+I+GGKG A++K  A++ AG+    S A IG +L  ++ 
Sbjct: 232 GYIAGVTAPKGKRMGHAGAIIAGGKGTADEKFAALEAAGVKTVRSLADIGEALKAIIK 289


>gi|148826194|ref|YP_001290947.1| succinyl-CoA synthetase subunit alpha [Haemophilus influenzae
           PittEE]
 gi|148716354|gb|ABQ98564.1| succinyl-CoA synthetase alpha subunit [Haemophilus influenzae
           PittEE]
          Length = 293

 Score =  344 bits (883), Expect = 7e-93,   Method: Composition-based stats.
 Identities = 183/299 (61%), Positives = 222/299 (74%), Gaps = 9/299 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           M+IL+DKNTKV+ QG TG  GTFH+EQA+ Y  TQ+VGG+ P KG T   G    +PVF 
Sbjct: 1   MAILIDKNTKVICQGFTGGQGTFHSEQALAY-GTQLVGGVSPNKGGTTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T + A+VIYVP S   DAIIE+I+A I LIVCITEGIP LDM++VK +L ++
Sbjct: 56  TVCEAVENTGSTATVIYVPASFCKDAIIEAIDAGIQLIVCITEGIPTLDMLKVKQKLNET 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
              +IGPNCPG++TPD CKIGIMP  I +KG VGI+SRSGTLTYEAV QT+ EG GQST 
Sbjct: 116 GVVMIGPNCPGVITPDECKIGIMPAHIHKKGKVGIVSRSGTLTYEAVKQTTDEGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+LE F  D  TE+IVM+GEIGGSAEEEAA F+KD       KP+V
Sbjct: 176 VGIGGDPILGSSFIDILERFQQDPETEAIVMIGEIGGSAEEEAAIFIKDN----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
            ++AG TAP G+ MGHAGA+ISGGKG A +KI A+  AG+    S A IG +L +LL S
Sbjct: 232 AYIAGITAPKGKRMGHAGAIISGGKGTAVEKIAALDAAGVTCVKSLAEIGEALRKLLKS 290


>gi|56964045|ref|YP_175776.1| succinyl-CoA synthetase subunit alpha [Bacillus clausii KSM-K16]
 gi|56910288|dbj|BAD64815.1| succinyl-CoA synthetase alpha subunit [Bacillus clausii KSM-K16]
          Length = 304

 Score =  344 bits (883), Expect = 7e-93,   Method: Composition-based stats.
 Identities = 179/299 (59%), Positives = 230/299 (76%), Gaps = 9/299 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL++K+TKV+VQG+TG  G FHT+QA+ Y  T +VGG+ P KG T   G    VPVF 
Sbjct: 1   MSILINKDTKVIVQGITGATGLFHTKQALEY-GTNIVGGVTPGKGGTDIEG----VPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T ANASVIYVPP+ A DAI+E+ +AE+ L++CITEGIPVLDMV+VK  +   
Sbjct: 56  TVQEAVEATGANASVIYVPPAFAADAIMEATDAELELVICITEGIPVLDMVKVKRYMAGK 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            +RL+GPNCPG++TP+ CKIGIMPG I +KG +G++SRSGTLTYEAV Q S  G+GQSTA
Sbjct: 116 QTRLVGPNCPGVITPEECKIGIMPGYIHKKGHIGVVSRSGTLTYEAVHQLSTAGIGQSTA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPV GT+FIDVL LF  D  T +++M+GEIGG+AEEEAA+++K        KP+V
Sbjct: 176 VGIGGDPVNGTDFIDVLSLFNEDPDTYAVIMIGEIGGTAEEEAAEWVKANM----TKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
           GF+ G+TAPPG+ MGHAGA+ISGGKG A +KI  M+  GI +A +P+ +G +L+E L +
Sbjct: 232 GFIGGQTAPPGKRMGHAGAIISGGKGTAAEKIKTMEACGIRVAATPSDMGETLIEALKA 290


>gi|326489921|dbj|BAJ94034.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gi|326516512|dbj|BAJ92411.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gi|326517002|dbj|BAJ96493.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 329

 Score =  344 bits (883), Expect = 7e-93,   Method: Composition-based stats.
 Identities = 182/297 (61%), Positives = 228/297 (76%), Gaps = 9/297 (3%)

Query: 3   ILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFTTV 62
           + VDK+T+V+ QG+TGK GTFHTEQAI Y  T +VGG+ PKKG T   G    +PVF +V
Sbjct: 35  VFVDKSTRVICQGITGKNGTFHTEQAIEY-GTNMVGGVTPKKGGTEHLG----LPVFNSV 89

Query: 63  AEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEK-SS 121
           AEAK  T ANASVIYVPP  A  AI+E++EAE+ L+VCITEGIP  DMV+VKA L + S 
Sbjct: 90  AEAKAETKANASVIYVPPPFAAAAIMEALEAELDLVVCITEGIPQHDMVKVKAALNRQSK 149

Query: 122 SRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTAV 181
           +RLIGPNCPGI+ P  CKIGIMPG I + G +GI+SRSGTLTYEAVFQT+  GLGQST V
Sbjct: 150 TRLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCV 209

Query: 182 GIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIVG 241
           G+GGDP  GT F+D LE F+ D  TE IV++GEIGG+AEE+AA F+++      +KP+V 
Sbjct: 210 GMGGDPFNGTNFVDCLEKFVDDPQTEGIVLIGEIGGTAEEDAAAFIRE---SKTEKPVVA 266

Query: 242 FVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           F+AG TAPPGR MGHAGA++SGGKG A+DKI A++EAG+ +  SPA+IG ++ E+  
Sbjct: 267 FIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKALREAGVTVVESPAKIGSTMFEIFK 323


>gi|52840779|ref|YP_094578.1| succinyl CoA synthetase alpha chain [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
 gi|52627890|gb|AAU26631.1| succinyl CoA synthetase alpha chain [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
          Length = 291

 Score =  344 bits (883), Expect = 7e-93,   Method: Composition-based stats.
 Identities = 180/299 (60%), Positives = 221/299 (73%), Gaps = 10/299 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+LVDK+TKVL QG TGK GT+HTEQA+ Y  T++VGG+ P KG     G    +PVF 
Sbjct: 1   MSVLVDKHTKVLCQGFTGKQGTYHTEQALAY-GTKMVGGVTPGKGGQMHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           T+ EA E T A+ASVIYVP     D+IIE+ EA I LIVCITEG+PVLDM++VK  +E +
Sbjct: 56  TMREAVEETKADASVIYVPAPFCKDSIIEAAEAGIKLIVCITEGVPVLDMLQVKVYIENN 115

Query: 121 -SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQST 179
             +RLIGPNCPGI+TP  CKIGIMPG I   G VGI+SRSGTLTYEAV QT+ +G GQST
Sbjct: 116 TQARLIGPNCPGIITPGECKIGIMPGYIHLPGKVGIVSRSGTLTYEAVKQTTDKGFGQST 175

Query: 180 AVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPI 239
            +GIGGDP+ GT FID L LF  D  TE+I+MVGEIGGSAEEEAA+F+K       KKP+
Sbjct: 176 CIGIGGDPIPGTSFIDALSLFEKDPKTEAIIMVGEIGGSAEEEAAEFIKSH----VKKPV 231

Query: 240 VGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           V ++AG TAP G+ MGHAGA+ISGGKG A +K  A++ AG+    SPA +G ++ E+ G
Sbjct: 232 VSYIAGVTAPAGKRMGHAGAIISGGKGTAAEKYAALEAAGVKTVRSPADLGDAIAEVTG 290


>gi|319409451|emb|CBI83100.1| succinyl-CoA synthetase, alpha chain [Bartonella schoenbuchensis
           R1]
          Length = 300

 Score =  344 bits (883), Expect = 8e-93,   Method: Composition-based stats.
 Identities = 234/299 (78%), Positives = 271/299 (90%), Gaps = 1/299 (0%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTG-GNVNVPVF 59
           MSILV+KNTKVLVQGLTGK GTFHTEQA+ Y  TQ+VGGI+PKKG   W G     +P+F
Sbjct: 1   MSILVNKNTKVLVQGLTGKTGTFHTEQALAYHGTQMVGGINPKKGGETWEGSKGETLPIF 60

Query: 60  TTVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEK 119
            +VAE KE+T A+ASVIYVPP+GA  AIIE+IEAEI LIVCITEGIPV+DMV VKA+LE+
Sbjct: 61  ASVAEGKEKTGADASVIYVPPAGAAAAIIEAIEAEIGLIVCITEGIPVMDMVEVKAKLEQ 120

Query: 120 SSSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQST 179
           S SRLIGPNCPGILTP+ CKIGIMPGSIF+KGSVGI+SRSGTLTYEAVFQTS+E LGQ+T
Sbjct: 121 SQSRLIGPNCPGILTPNECKIGIMPGSIFKKGSVGIVSRSGTLTYEAVFQTSREDLGQTT 180

Query: 180 AVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPI 239
           A+GIGGDPVKGTEFIDVLE+FLAD+ TESIVM+GEIGGSAEEEAAQF+KDEAK+GRKKP+
Sbjct: 181 AIGIGGDPVKGTEFIDVLEMFLADDETESIVMIGEIGGSAEEEAAQFIKDEAKKGRKKPM 240

Query: 240 VGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           VGF+AG+TAPPGRTMGHAGAVISGGKGGAEDKI+AM+ AGI ++PSP++IG++LV +L 
Sbjct: 241 VGFIAGRTAPPGRTMGHAGAVISGGKGGAEDKISAMESAGIRVSPSPSQIGKTLVSVLK 299


>gi|228992563|ref|ZP_04152490.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Bacillus
           pseudomycoides DSM 12442]
 gi|228998611|ref|ZP_04158198.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Bacillus mycoides
           Rock3-17]
 gi|229006111|ref|ZP_04163799.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Bacillus mycoides
           Rock1-4]
 gi|228755187|gb|EEM04544.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Bacillus mycoides
           Rock1-4]
 gi|228761079|gb|EEM10038.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Bacillus mycoides
           Rock3-17]
 gi|228767197|gb|EEM15833.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Bacillus
           pseudomycoides DSM 12442]
          Length = 300

 Score =  344 bits (883), Expect = 8e-93,   Method: Composition-based stats.
 Identities = 180/299 (60%), Positives = 231/299 (77%), Gaps = 9/299 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+LV+K+TKV+VQG+TG  G FHT+Q I Y  T++VGG+ P KG T   G    VPVF 
Sbjct: 1   MSVLVNKDTKVIVQGITGSQGLFHTKQMIEY-GTKIVGGVTPGKGGTEIEG----VPVFD 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV +A + T ANASV+YVPP+ A DAI+E+++AEI L+VCITEGIPVLDMV+VK  +   
Sbjct: 56  TVEDAVKATGANASVVYVPPAFAADAIMEAVDAEIDLVVCITEGIPVLDMVKVKKYMAGK 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            +RL+GPNCPG++TPD CKIGIMPG I +KG VGI+SRSGTLTYEAV Q +QEG+GQSTA
Sbjct: 116 QTRLLGPNCPGVITPDECKIGIMPGYIHKKGHVGIVSRSGTLTYEAVHQLTQEGIGQSTA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPV GT+FID L+ F  DE T +++M+GEIGG+AEEEAA+++K        KP+V
Sbjct: 176 VGIGGDPVNGTDFIDALKAFNEDEETHAVIMIGEIGGTAEEEAAEWVKANM----TKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
           GF+ G+TAP G+ MGHAGA+ISGGKG A +KI  M+  GI +A +PA +G +L+ +L  
Sbjct: 232 GFIGGQTAPAGKRMGHAGAIISGGKGTAAEKIKTMEACGIKVAETPAVMGETLIAVLKE 290


>gi|304311201|ref|YP_003810799.1| Succinyl-CoA ligase, alpha subunit [gamma proteobacterium HdN1]
 gi|301796934|emb|CBL45147.1| Succinyl-CoA ligase, alpha subunit [gamma proteobacterium HdN1]
          Length = 290

 Score =  344 bits (883), Expect = 8e-93,   Method: Composition-based stats.
 Identities = 175/298 (58%), Positives = 224/298 (75%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+TKV+ QGLTG  GT H++QA+ Y  T++VGG+ P KG T+  G    +PVF 
Sbjct: 1   MSVLINKDTKVICQGLTGSQGTMHSQQAMEY-GTKMVGGVTPGKGGTHHIG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TVAEA+E T A+ASVIYVP +   D+I+E+ +A +PLIVCITEGIP LDM+ VK  +   
Sbjct: 56  TVAEAREATGADASVIYVPAAFCKDSILEAADAGVPLIVCITEGIPALDMLYVKEYVMAK 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             RLIGPNCPGI+TP  CKIGIMPG I   G VGI+SRSGTLTYE V QT+  G GQST 
Sbjct: 116 GLRLIGPNCPGIITPGECKIGIMPGHIHLPGKVGIVSRSGTLTYECVAQTTVLGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           +GIGGDP+ GT FID L+LF  D  TE+I+MVGEIGGSAEEEAA F+K+      KKP+V
Sbjct: 176 IGIGGDPIPGTTFIDALKLFQDDPQTEAIIMVGEIGGSAEEEAAAFIKEY----VKKPMV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            ++AG TAPPG+ MGHAGA+I+GGKG A++K  A+ +AG+ +  +PA IG++L E+ G
Sbjct: 232 SYIAGVTAPPGKRMGHAGAIIAGGKGTADEKFAALSDAGVAVCRNPAEIGKTLKEITG 289


>gi|255065288|ref|ZP_05317143.1| succinyl-CoA synthetase subunit alpha [Neisseria sicca ATCC 29256]
 gi|255050709|gb|EET46173.1| succinyl-CoA synthetase subunit alpha [Neisseria sicca ATCC 29256]
          Length = 296

 Score =  344 bits (883), Expect = 8e-93,   Method: Composition-based stats.
 Identities = 164/301 (54%), Positives = 224/301 (74%), Gaps = 11/301 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+TKVLVQG TGK GTFH+EQA+ Y  T+VVGG+ P KG        +N+PVF 
Sbjct: 1   MSVLINKDTKVLVQGFTGKNGTFHSEQALAY-GTKVVGGVTPGKGGQTH----LNLPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARL--E 118
           T+ EA + T A+ASVIYVP     D+I+E++++ + L+V ITEG+P LDM++ K  L   
Sbjct: 56  TMKEAVKETGADASVIYVPAPFVLDSIVEAVDSGVGLVVVITEGVPTLDMLKAKRYLETN 115

Query: 119 KSSSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQS 178
            + +RL+GPNCPG++TP  CKIGIMPG I + G +GI+SRSGTLTYEAV QT++ GLGQS
Sbjct: 116 GNGTRLVGPNCPGVITPGECKIGIMPGHIHQPGRIGIISRSGTLTYEAVAQTTKLGLGQS 175

Query: 179 TAVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKP 238
           T +GIGGDP+ G   ID L+LF  D  T++I+M+GEIGG+AEEEAA++++        KP
Sbjct: 176 TCIGIGGDPIPGMNQIDALKLFQEDPDTDAIIMIGEIGGTAEEEAAEYIQSN----VTKP 231

Query: 239 IVGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           +VG++AG TAP G+ MGHAGA+ISGGKG AE+K  A ++AGI    SPA +G +++E+L 
Sbjct: 232 VVGYIAGVTAPKGKRMGHAGAIISGGKGTAEEKFAAFEKAGIAYTRSPAELGSTMLEVLK 291

Query: 299 S 299
           +
Sbjct: 292 A 292


>gi|157375946|ref|YP_001474546.1| succinyl-CoA synthetase, alpha subunit [Shewanella sediminis
           HAW-EB3]
 gi|157318320|gb|ABV37418.1| succinyl-CoA synthetase, alpha subunit [Shewanella sediminis
           HAW-EB3]
          Length = 290

 Score =  344 bits (883), Expect = 8e-93,   Method: Composition-based stats.
 Identities = 174/294 (59%), Positives = 218/294 (74%), Gaps = 9/294 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL++K+TKV+ QG TG  GTFH+EQAI Y  TQ+VGG+ P KG     G    +PVF 
Sbjct: 1   MSILINKDTKVICQGFTGGQGTFHSEQAIDY-GTQMVGGVSPGKGGQVHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV +A   T A A+VIYVP     DAI+E+I+  I LIVCITEGIP LDM++VK +LE++
Sbjct: 56  TVKDAVAETGATATVIYVPAPFCKDAILEAIDGGIELIVCITEGIPTLDMLQVKVKLEET 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TP  CKIGIMPG I + G VGI+SRSGTLTYEAV QT+ EG GQST 
Sbjct: 116 GVRMIGPNCPGVITPGECKIGIMPGHIHKPGKVGIVSRSGTLTYEAVKQTTDEGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ GT FIDVLE+F  D  TE+IVM+GEIGG+AEEEAA++++        KP+V
Sbjct: 176 VGIGGDPIPGTNFIDVLEMFQNDPLTEAIVMIGEIGGTAEEEAAEYIQAN----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLV 294
            ++AG TAP G+ MGHAGA+I+GGKG AEDK  A++ AG+    S A IG++L 
Sbjct: 232 SYIAGVTAPEGKRMGHAGAIIAGGKGTAEDKFAALEAAGVTTVRSLAEIGKALR 285


>gi|88860192|ref|ZP_01134831.1| succinyl-CoA synthetase, alpha subunit, NAD(P)-binding protein
           [Pseudoalteromonas tunicata D2]
 gi|88818186|gb|EAR28002.1| succinyl-CoA synthetase, alpha subunit, NAD(P)-binding protein
           [Pseudoalteromonas tunicata D2]
          Length = 290

 Score =  344 bits (883), Expect = 8e-93,   Method: Composition-based stats.
 Identities = 175/298 (58%), Positives = 217/298 (72%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+TKV+ QG TG  GTFH+EQAI Y  TQ+VGG+ P KG     G    +PVF 
Sbjct: 1   MSVLINKDTKVICQGFTGGQGTFHSEQAIAY-GTQMVGGVSPGKGGQTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV +A + T A ASVIYVP     DAI+E+I+A I LIVCITEGIP LDMV VK +LE++
Sbjct: 56  TVRDAVDATGATASVIYVPAPFCKDAILEAIDAGIELIVCITEGIPTLDMVDVKVKLEQT 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TP   KIGIMPG I   G VGI+SRSGTLTYEAV QT+  G GQST 
Sbjct: 116 GVRMIGPNCPGVITPGETKIGIMPGHIHLPGKVGIVSRSGTLTYEAVKQTTDYGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ GT FIDVL+LF  D  TE+IVM+GEIGG+AEEEAA+++K        KP+V
Sbjct: 176 VGIGGDPIPGTNFIDVLKLFQEDPQTEAIVMIGEIGGTAEEEAAEYIKAH----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            ++AG TAP G+ MGHAGA+I+GGKG A +K  A++ AG+    S A IG++L E  G
Sbjct: 232 SYIAGVTAPEGKRMGHAGAIIAGGKGTAVEKFAALEAAGVKTVRSLADIGKALKEKTG 289


>gi|224476372|ref|YP_002633978.1| succinyl-CoA synthetase subunit alpha [Staphylococcus carnosus
           subsp. carnosus TM300]
 gi|222420979|emb|CAL27793.1| putative succinyl-CoA synthetase, alpha chain [Staphylococcus
           carnosus subsp. carnosus TM300]
          Length = 304

 Score =  344 bits (883), Expect = 8e-93,   Method: Composition-based stats.
 Identities = 172/296 (58%), Positives = 222/296 (75%), Gaps = 9/296 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+ VDKNTKV+VQG+TG    FHT+Q + Y  TQ+V G+ P KG     G    VPVF 
Sbjct: 1   MSVYVDKNTKVIVQGITGSTALFHTKQMLEY-GTQIVAGVTPGKGGQVVEG----VPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EAKE T AN SVIYVP   A DAI+E  +A++ L +CITE IPVLDMV+V   LE  
Sbjct: 56  TVEEAKEETGANVSVIYVPAPFAADAILECADADLDLAICITEHIPVLDMVKVVRYLEDK 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
           ++RLIGPNCPG+++PD CKIGIMPG I ++G VG++SRSGTLTYEAV Q ++EG+GQS+A
Sbjct: 116 NTRLIGPNCPGVISPDDCKIGIMPGYIHKRGHVGVVSRSGTLTYEAVHQLTEEGIGQSSA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPV GT FIDVL+ F  D  T+++VM+GEIGG+AEEEAA+++     +   KP++
Sbjct: 176 VGIGGDPVNGTNFIDVLDAFNKDPETKAVVMIGEIGGTAEEEAAEWI----NKNMTKPVI 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVEL 296
           GF+ G+TAPPG+ MGHAGA+ISGGKG A++KI  + E G+  A +P+ IG +L+E 
Sbjct: 232 GFIGGQTAPPGKRMGHAGAIISGGKGTAKEKIKTLNENGVKTADTPSEIGSTLIEA 287


>gi|147673983|ref|YP_001217609.1| succinyl-CoA synthetase subunit alpha [Vibrio cholerae O395]
 gi|262167703|ref|ZP_06035406.1| succinyl-CoA ligase [ADP-forming] alpha chain [Vibrio cholerae
           RC27]
 gi|146315866|gb|ABQ20405.1| succinyl-CoA synthase, alpha subunit [Vibrio cholerae O395]
 gi|227013981|gb|ACP10191.1| succinyl-CoA synthase, alpha subunit [Vibrio cholerae O395]
 gi|262023908|gb|EEY42606.1| succinyl-CoA ligase [ADP-forming] alpha chain [Vibrio cholerae
           RC27]
          Length = 290

 Score =  344 bits (883), Expect = 8e-93,   Method: Composition-based stats.
 Identities = 181/298 (60%), Positives = 224/298 (75%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL++K+TKV+ QG TG  GTFH+EQAI Y  TQ+VGG+ P KG T   G    +PVF 
Sbjct: 1   MSILINKDTKVICQGFTGGQGTFHSEQAITY-GTQMVGGVSPGKGGTTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T A A+VIYVP     DAI+E+I+A I LIV ITEGIP  DM+ VK +LE++
Sbjct: 56  TVREAVEVTGATATVIYVPAPFCKDAILEAIDAGIKLIVTITEGIPTTDMIDVKVKLEQT 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TPD CKIGIMPG I +KG VGI+SRSGTLTYEAV QT+ EG GQST 
Sbjct: 116 GVRMIGPNCPGVITPDECKIGIMPGHIHKKGKVGIVSRSGTLTYEAVKQTTDEGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L++F  D ATE+IVM+GEIGG+AEEEAA F+K        KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILKMFQEDPATEAIVMIGEIGGTAEEEAAAFIKAN----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            ++AG TAPPG+ MGHAGA+ISGGKG AE+K  A++ AG+    S A IG++L E+ G
Sbjct: 232 SYIAGVTAPPGKRMGHAGAIISGGKGTAEEKFAALESAGVKTVKSLADIGKALREVTG 289


>gi|300722389|ref|YP_003711675.1| succinyl-CoA synthetase subunit alpha [Xenorhabdus nematophila ATCC
           19061]
 gi|297628892|emb|CBJ89475.1| succinyl-CoA synthetase, alpha subunit, NAD(P)-binding [Xenorhabdus
           nematophila ATCC 19061]
          Length = 289

 Score =  344 bits (883), Expect = 8e-93,   Method: Composition-based stats.
 Identities = 174/298 (58%), Positives = 221/298 (74%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL+DKNTKV+ QG TG  G+FH+EQAI Y  TQ+VGG+ P KG T   G    +PVF 
Sbjct: 1   MSILIDKNTKVICQGFTGSQGSFHSEQAIAY-GTQMVGGVTPGKGGTEHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA + T A ASVIYVP     D+I+E+I+A I LI+ ITEGIP LDM+ VK +L+++
Sbjct: 56  TVREAVDATGATASVIYVPAPFCKDSILEAIDAGIKLIITITEGIPTLDMLTVKVKLDQA 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TPD CKIGIMPG I + G VGI+SRSGTLTYEAV QT+  GLGQST 
Sbjct: 116 GVRMIGPNCPGVITPDECKIGIMPGHIHKAGKVGIVSRSGTLTYEAVKQTTDAGLGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L+LF  D  TE+IVM+GEIGG+AEEEAA ++K+       KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILKLFQEDPQTEAIVMIGEIGGTAEEEAAAYIKEH----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            ++AG TAP G+ MGHAGA+I+GGKG A++K  A++ AG+    S A IG ++  LL 
Sbjct: 232 AYIAGVTAPKGKRMGHAGAIIAGGKGTADEKFAALEAAGVKTVRSLADIGDAVKALLA 289


>gi|237730692|ref|ZP_04561173.1| succinyl-CoA synthetase subunit alpha [Citrobacter sp. 30_2]
 gi|226906231|gb|EEH92149.1| succinyl-CoA synthetase subunit alpha [Citrobacter sp. 30_2]
          Length = 289

 Score =  344 bits (883), Expect = 8e-93,   Method: Composition-based stats.
 Identities = 172/298 (57%), Positives = 220/298 (73%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+TKV+ QG TG  GTFH+EQAI Y  TQ+VGG+ P KG T   G    +PVF 
Sbjct: 1   MSVLINKDTKVICQGFTGSQGTFHSEQAIAY-GTQMVGGVTPGKGGTTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T A A+VIYVP     D+I+E+I+A I LI+ ITEGIP LDM+ VK +L+++
Sbjct: 56  TVREAVEATGATATVIYVPAPFCKDSILEAIDAGIKLIITITEGIPTLDMLTVKVKLDEA 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TP  CKIGIMPG I + G VGI+SRSGTLTYEAV QT+  G GQST 
Sbjct: 116 GVRMIGPNCPGVITPGECKIGIMPGHIHKPGKVGIVSRSGTLTYEAVKQTTDYGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L+LF  D  TE+IVM+GEIGGSAEEEAA ++KD       KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILKLFQEDPQTEAIVMIGEIGGSAEEEAAAYIKDH----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           G++AG TAP G+ MGHAGA+I+GGKG A++K  A++ AG+    S A IG +L  ++ 
Sbjct: 232 GYIAGVTAPKGKRMGHAGAIIAGGKGTADEKFAALEAAGVKTVRSLADIGEALKTVIK 289


>gi|304395710|ref|ZP_07377593.1| succinyl-CoA synthetase, alpha subunit [Pantoea sp. aB]
 gi|304357004|gb|EFM21368.1| succinyl-CoA synthetase, alpha subunit [Pantoea sp. aB]
          Length = 291

 Score =  344 bits (883), Expect = 8e-93,   Method: Composition-based stats.
 Identities = 174/297 (58%), Positives = 218/297 (73%), Gaps = 9/297 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL+DKNTKV+ QG TG  GTFH+EQA+ Y  TQ+VGG+ P KG T   G    +PVF 
Sbjct: 1   MSILIDKNTKVICQGFTGGQGTFHSEQALAY-GTQLVGGVTPGKGGTTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T A A+VIYVP     D I+E+IEA I LI+ ITEGIP LDM+ VK +L+++
Sbjct: 56  TVREAVEATGATATVIYVPAPFCKDGILEAIEAGIKLIITITEGIPTLDMLTVKVKLDEA 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TP  CKIGIMPG I + G VGI+SRSGTLTYEAV QT+  G GQST 
Sbjct: 116 GVRMIGPNCPGVITPGECKIGIMPGHIHQPGRVGIVSRSGTLTYEAVKQTTDIGYGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L++F  D  TE IVM+GEIGGSAEEEAA F+K+       KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILKMFQDDPQTEVIVMIGEIGGSAEEEAAAFIKEH----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELL 297
           G++AG TAP G+ MGHAGA+I+GGKG A++K  A++ AG+    S A IG ++  +L
Sbjct: 232 GYIAGVTAPKGKRMGHAGAIIAGGKGTADEKFAALEAAGVKTVRSLADIGDAVKAVL 288


>gi|56414144|ref|YP_151219.1| succinyl-CoA synthetase subunit alpha [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. ATCC 9150]
 gi|197363066|ref|YP_002142703.1| succinyl-CoA synthetase subunit alpha [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. AKU_12601]
 gi|56128401|gb|AAV77907.1| succinyl-CoA synthetase alpha chain [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. ATCC 9150]
 gi|197094543|emb|CAR60063.1| succinyl-CoA synthetase alpha chain [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. AKU_12601]
          Length = 289

 Score =  344 bits (883), Expect = 8e-93,   Method: Composition-based stats.
 Identities = 171/298 (57%), Positives = 220/298 (73%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+T+V+ QG TG  GTFH+EQAI Y  TQ+VGG+ P KG T   G    +PVF 
Sbjct: 1   MSVLINKDTRVICQGFTGSQGTFHSEQAIAY-GTQMVGGVTPGKGGTTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T A ASVIYVP     D+I+E+I+A I LI+ ITEGIP LDM+ VK +L+++
Sbjct: 56  TVREAVEATGATASVIYVPAPFCKDSILEAIDAGIKLIITITEGIPTLDMLTVKVKLDEA 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TP  CKIGIMPG I + G VGI+SRSGTLTYEAV QT+  G GQST 
Sbjct: 116 GVRMIGPNCPGVITPGECKIGIMPGHIHKPGKVGIVSRSGTLTYEAVKQTTDYGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L+LF  D  TE+IVM+GEIGGSAEEEAA ++KD       KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILKLFQEDPQTEAIVMIGEIGGSAEEEAAAYIKDH----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           G++AG TAP G+ MGHAGA+I+GG+G A++K  A++ AG+    S A IG +L  ++ 
Sbjct: 232 GYIAGVTAPKGKRMGHAGAIIAGGEGTADEKFAALEAAGVKTVRSLADIGEALKAIIK 289


>gi|308186074|ref|YP_003930205.1| Succinyl-CoA synthetase, alpha subunit [Pantoea vagans C9-1]
 gi|308056584|gb|ADO08756.1| Succinyl-CoA synthetase, alpha subunit [Pantoea vagans C9-1]
          Length = 291

 Score =  344 bits (883), Expect = 8e-93,   Method: Composition-based stats.
 Identities = 174/297 (58%), Positives = 219/297 (73%), Gaps = 9/297 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL+DKNTKV+ QG TG  GTFH+EQA+ Y  TQ+VGG+ P KG T   G    +PVF 
Sbjct: 1   MSILIDKNTKVICQGFTGGQGTFHSEQALAY-GTQLVGGVTPGKGGTTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T A A+VIYVP     D I+E+IEA I LI+ ITEGIP LDM+ VK +L+++
Sbjct: 56  TVREAVEATGATATVIYVPAPFCKDGILEAIEAGIKLIITITEGIPTLDMLTVKVKLDEA 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TP  CKIGIMPG I + G VGI+SRSGTLTYEAV QT+  G GQST 
Sbjct: 116 GVRMIGPNCPGVITPGECKIGIMPGHIHQPGRVGIVSRSGTLTYEAVKQTTDIGYGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L++F  D  TE+IVM+GEIGGSAEEEAA F+K+       KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILKMFQDDPQTEAIVMIGEIGGSAEEEAAAFIKEH----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELL 297
           G++AG TAP G+ MGHAGA+I+GGKG A++K  A++ AG+    S A IG ++  +L
Sbjct: 232 GYIAGVTAPKGKRMGHAGAIIAGGKGTADEKFAALEAAGVKTVRSLADIGDAVKAVL 288


>gi|268590345|ref|ZP_06124566.1| succinyl-CoA synthetase subunit alpha [Providencia rettgeri DSM
           1131]
 gi|291314255|gb|EFE54708.1| succinyl-CoA synthetase subunit alpha [Providencia rettgeri DSM
           1131]
          Length = 290

 Score =  344 bits (883), Expect = 9e-93,   Method: Composition-based stats.
 Identities = 176/299 (58%), Positives = 220/299 (73%), Gaps = 9/299 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL+DKNTKV+ QG TG  GTFH+EQAI Y  TQ+VGG+ P KG T   G    +PVF 
Sbjct: 1   MSILIDKNTKVICQGFTGGQGTFHSEQAIAY-GTQMVGGVTPGKGGTVHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T A ASVIYVP     D+I+E+I+A I LI+ ITEGIP LDM+ VK +L+++
Sbjct: 56  TVREAVEATGATASVIYVPAPFCKDSILEAIDAGIKLIITITEGIPTLDMLTVKVKLDEA 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TP  CKIGI PG I   G VGI+SRSGTLTYEAV QT+  GLGQST 
Sbjct: 116 GVRMIGPNCPGVITPGECKIGIQPGHIHMPGKVGIVSRSGTLTYEAVKQTTDAGLGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L+LF AD  TE+IVM+GEIGG+AEEEAA ++K+       KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILKLFQADPQTEAIVMIGEIGGNAEEEAAAYIKEH----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
           G++AG TAP G+ MGHAGA+I+GGKG A++K  A++ AG+    S A IG ++  LL  
Sbjct: 232 GYIAGVTAPKGKRMGHAGAIIAGGKGTADEKFAALEAAGVKTVRSLADIGDAVKSLLNK 290


>gi|119774567|ref|YP_927307.1| succinyl-CoA synthetase alpha chain [Shewanella amazonensis SB2B]
 gi|119767067|gb|ABL99637.1| succinyl-CoA synthetase (ADP-forming) alpha subunit [Shewanella
           amazonensis SB2B]
          Length = 290

 Score =  344 bits (883), Expect = 9e-93,   Method: Composition-based stats.
 Identities = 178/298 (59%), Positives = 220/298 (73%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+TKV+ QG TG  GTFH+EQAI Y  TQ+VGG+ P KG T   G    +PVF 
Sbjct: 1   MSVLINKDTKVICQGFTGGQGTFHSEQAIAY-GTQMVGGVSPGKGGTTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV +A   T A ASVIYVP     DAI+E+I+  I LIVCITEGIP LDM++VK +LE++
Sbjct: 56  TVKDAVAATGATASVIYVPAPFCKDAILEAIDGGIELIVCITEGIPTLDMLQVKVKLEET 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TP  CKIGIMPG I + G VGI+SRSGTLTYEAV QT+ EG GQST 
Sbjct: 116 GVRMIGPNCPGVITPGECKIGIMPGHIHKPGKVGIVSRSGTLTYEAVKQTTDEGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ GT FIDVLE+F  D  TE+IVM+GEIGG+AEEEAA ++K        KP+V
Sbjct: 176 VGIGGDPIPGTNFIDVLEMFQNDPQTEAIVMIGEIGGTAEEEAAAYIKAN----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            ++AG TAP G+ MGHAGA+I+GGKG AEDK  A++ AG+    S A IG++L E  G
Sbjct: 232 SYIAGVTAPAGKRMGHAGAIIAGGKGTAEDKFAALEAAGVTTVRSLADIGKALREKTG 289


>gi|16078673|ref|NP_389492.1| succinyl-CoA synthetase subunit alpha [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|221309485|ref|ZP_03591332.1| succinyl-CoA synthetase subunit alpha [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|221313810|ref|ZP_03595615.1| succinyl-CoA synthetase subunit alpha [Bacillus subtilis subsp.
           subtilis str. NCIB 3610]
 gi|221318734|ref|ZP_03600028.1| succinyl-CoA synthetase subunit alpha [Bacillus subtilis subsp.
           subtilis str. JH642]
 gi|221323005|ref|ZP_03604299.1| succinyl-CoA synthetase subunit alpha [Bacillus subtilis subsp.
           subtilis str. SMY]
 gi|321315376|ref|YP_004207663.1| succinyl-CoA synthetase subunit alpha [Bacillus subtilis BSn5]
 gi|3915596|sp|P80865|SUCD_BACSU RecName: Full=Succinyl-CoA ligase [ADP-forming] subunit alpha;
           AltName: Full=Succinyl-CoA synthetase subunit alpha;
           Short=SCS-alpha; AltName: Full=Vegetative protein 239;
           Short=VEG239
 gi|2462968|emb|CAA04420.1| putative succinyl-coA synthetase alpha chain [Bacillus subtilis
           subsp. subtilis str. 168]
 gi|2633982|emb|CAB13483.1| succinyl-CoA synthetase (alpha subunit) [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|291484161|dbj|BAI85236.1| succinyl-CoA synthetase subunit alpha [Bacillus subtilis subsp.
           natto BEST195]
 gi|320021650|gb|ADV96636.1| succinyl-CoA synthetase subunit alpha [Bacillus subtilis BSn5]
          Length = 300

 Score =  344 bits (883), Expect = 9e-93,   Method: Composition-based stats.
 Identities = 173/299 (57%), Positives = 227/299 (75%), Gaps = 9/299 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+ ++K+T+V+VQG+TG    FHT+Q + Y  T +VGG+ P KG T   G    VPVF 
Sbjct: 1   MSVFINKDTRVIVQGITGSTALFHTKQMLEY-GTNIVGGVTPGKGGTEAEG----VPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TVAEA + T ANASVIYVP   A DAI+E+++AE+ L++CITE IPVLDMV+VK  +E  
Sbjct: 56  TVAEAVQTTGANASVIYVPAPFAADAIMEAVDAELDLVICITEHIPVLDMVKVKRFMEGK 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            +RLIGPNCPG++TP+ CKIGIMPG I +KG VG++SRSGTLTYEAV Q S+ G+GQSTA
Sbjct: 116 KTRLIGPNCPGVITPEECKIGIMPGYIHKKGHVGVVSRSGTLTYEAVHQLSEAGVGQSTA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPV GT FIDVL+ F  D  T +++M+GEIGG+AEEEAA+++K        KP+V
Sbjct: 176 VGIGGDPVNGTNFIDVLKAFNEDPDTHAVIMIGEIGGTAEEEAAEWVKANM----TKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
           GF+ GKTAPPG+ MGHAGA+ISGGKG A++KI  +   GI +A +P+ +G +L+++L  
Sbjct: 232 GFIGGKTAPPGKRMGHAGAIISGGKGTADEKIKTLNACGIEVAETPSVMGETLIKVLKE 290


>gi|126174725|ref|YP_001050874.1| succinyl-CoA synthetase subunit alpha [Shewanella baltica OS155]
 gi|153001024|ref|YP_001366705.1| succinyl-CoA synthetase subunit alpha [Shewanella baltica OS185]
 gi|160875737|ref|YP_001555053.1| succinyl-CoA synthetase subunit alpha [Shewanella baltica OS195]
 gi|217973016|ref|YP_002357767.1| succinyl-CoA synthetase subunit alpha [Shewanella baltica OS223]
 gi|304409102|ref|ZP_07390723.1| succinyl-CoA synthetase, alpha subunit [Shewanella baltica OS183]
 gi|307303105|ref|ZP_07582860.1| succinyl-CoA synthetase, alpha subunit [Shewanella baltica BA175]
 gi|125997930|gb|ABN62005.1| succinyl-CoA synthetase (ADP-forming) alpha subunit [Shewanella
           baltica OS155]
 gi|151365642|gb|ABS08642.1| succinyl-CoA synthetase, alpha subunit [Shewanella baltica OS185]
 gi|160861259|gb|ABX49793.1| succinyl-CoA synthetase, alpha subunit [Shewanella baltica OS195]
 gi|217498151|gb|ACK46344.1| succinyl-CoA synthetase, alpha subunit [Shewanella baltica OS223]
 gi|304352923|gb|EFM17320.1| succinyl-CoA synthetase, alpha subunit [Shewanella baltica OS183]
 gi|306913465|gb|EFN43887.1| succinyl-CoA synthetase, alpha subunit [Shewanella baltica BA175]
 gi|315267926|gb|ADT94779.1| succinyl-CoA synthetase, alpha subunit [Shewanella baltica OS678]
          Length = 290

 Score =  344 bits (883), Expect = 9e-93,   Method: Composition-based stats.
 Identities = 174/294 (59%), Positives = 217/294 (73%), Gaps = 9/294 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+TKV+ QG TG  GTFH++QAI Y  TQ+VGG+ P KG     G    +PVF 
Sbjct: 1   MSVLINKDTKVICQGFTGGQGTFHSQQAIDY-GTQMVGGVSPGKGGQTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV +A   T A ASVIYVP     DAI+E+I+  I LIVCITEGIP LDM++VK +LE++
Sbjct: 56  TVKDAVAATGATASVIYVPAPFCKDAILEAIDGGIELIVCITEGIPTLDMLQVKVKLEET 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TP  CKIGIMPG I  KG VGI+SRSGTLTYEAV QT+ EG GQST 
Sbjct: 116 GVRMIGPNCPGVITPGECKIGIMPGHIHLKGKVGIVSRSGTLTYEAVKQTTDEGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ GT FIDVLE+F  D  TE+IVM+GEIGG+AEE+AA ++K        KP+V
Sbjct: 176 VGIGGDPIPGTNFIDVLEMFQNDPQTEAIVMIGEIGGNAEEDAAAYIKAH----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLV 294
            ++AG TAP G+ MGHAGA+I+GGKG AEDK  A++ AG+    S A IG++L 
Sbjct: 232 SYIAGVTAPAGKRMGHAGAIIAGGKGTAEDKFAALEAAGVTTVRSLADIGKALR 285


>gi|259909075|ref|YP_002649431.1| Succinyl-CoA synthetase, alpha subunit [Erwinia pyrifoliae Ep1/96]
 gi|224964697|emb|CAX56214.1| Succinyl-CoA synthetase, alpha subunit [Erwinia pyrifoliae Ep1/96]
 gi|283479101|emb|CAY75017.1| succinyl-CoA synthetase alpha chain [Erwinia pyrifoliae DSM 12163]
 gi|310767025|gb|ADP11975.1| Succinyl-CoA synthetase, alpha subunit [Erwinia sp. Ejp617]
          Length = 290

 Score =  344 bits (883), Expect = 9e-93,   Method: Composition-based stats.
 Identities = 173/297 (58%), Positives = 220/297 (74%), Gaps = 9/297 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL+DKNTKV+ QG TG  GTFH+EQA+ Y  TQ+VGG+ P KG +   G    +PVF 
Sbjct: 1   MSILIDKNTKVICQGFTGGQGTFHSEQALAY-GTQLVGGVTPGKGGSEHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T A ASVIYVP     D I+E+I+A I LI+ ITEGIP LDM+ VK +L+++
Sbjct: 56  TVREAVEATGATASVIYVPAPFCKDGILEAIDAGIKLIITITEGIPTLDMLTVKVKLDEA 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TP +CKIGIMPG I + G +GI+SRSGTLTYEAV QT+  G GQST 
Sbjct: 116 GVRMIGPNCPGVITPGACKIGIMPGHIHQPGRIGIVSRSGTLTYEAVKQTTDIGYGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L+LF  D  TE+IVM+GEIGGSAEEEAA F+K+       KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILKLFQDDPQTEAIVMIGEIGGSAEEEAAAFIKEH----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELL 297
           G++AG TAP G+ MGHAGA+I+GGKG A++K  A++ AG+    S A IG ++  +L
Sbjct: 232 GYIAGVTAPKGKRMGHAGAIIAGGKGTADEKFAALEAAGVKTVRSLADIGDAVKAVL 288


>gi|153801968|ref|ZP_01956554.1| succinyl-CoA synthase, alpha subunit [Vibrio cholerae MZO-3]
 gi|124122482|gb|EAY41225.1| succinyl-CoA synthase, alpha subunit [Vibrio cholerae MZO-3]
          Length = 290

 Score =  344 bits (883), Expect = 9e-93,   Method: Composition-based stats.
 Identities = 180/298 (60%), Positives = 223/298 (74%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL++K+TKV+ QG TG  GTFH+EQAI Y  TQ+VGG+ P KG T   G    +PVF 
Sbjct: 1   MSILINKDTKVICQGFTGGQGTFHSEQAIAY-GTQMVGGVSPGKGGTTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T A A+VIYVP     DAI+E+I+A I LIV ITEGIP  DM+ VK +LE++
Sbjct: 56  TVREAVEVTGATATVIYVPAPFCKDAILEAIDAGIKLIVTITEGIPTTDMIDVKVKLEQT 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TPD CKIGIMPG I +KG VGI+SRSGTLTYEAV QT+ EG GQST 
Sbjct: 116 GVRMIGPNCPGVITPDECKIGIMPGHIHKKGKVGIVSRSGTLTYEAVKQTTDEGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L++F  D ATE+IVM+GEIGG+ EEEAA F+K        KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILKMFQEDPATEAIVMIGEIGGTTEEEAAAFIKAN----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            ++AG TAPPG+ MGHAGA+ISGGKG AE+K  A++ AG+    S A IG++L E+ G
Sbjct: 232 SYIAGVTAPPGKRMGHAGAIISGGKGTAEEKFAALESAGVKTVKSLADIGKALREVTG 289


>gi|54293530|ref|YP_125945.1| succinyl-CoA synthetase, alpha subunit [Legionella pneumophila str.
           Lens]
 gi|54296569|ref|YP_122938.1| succinyl-CoA synthetase, alpha subunit [Legionella pneumophila str.
           Paris]
 gi|148360809|ref|YP_001252016.1| succinyl CoA synthetase subnit alpha [Legionella pneumophila str.
           Corby]
 gi|296106127|ref|YP_003617827.1| succinyl-CoA synthetase alpha chain [Legionella pneumophila 2300/99
           Alcoy]
 gi|53750354|emb|CAH11748.1| succinyl-CoA synthetase, alpha subunit [Legionella pneumophila str.
           Paris]
 gi|53753362|emb|CAH14812.1| succinyl-CoA synthetase, alpha subunit [Legionella pneumophila str.
           Lens]
 gi|148282582|gb|ABQ56670.1| succinyl CoA synthetase alpha chain [Legionella pneumophila str.
           Corby]
 gi|295648028|gb|ADG23875.1| succinyl-CoA synthetase alpha chain [Legionella pneumophila 2300/99
           Alcoy]
 gi|307609342|emb|CBW98827.1| succinyl-CoA synthetase, alpha subunit [Legionella pneumophila
           130b]
          Length = 291

 Score =  344 bits (883), Expect = 9e-93,   Method: Composition-based stats.
 Identities = 179/299 (59%), Positives = 221/299 (73%), Gaps = 10/299 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+LVDK+TKVL QG TGK GT+HTEQA+ Y  T++VGG+ P KG     G    +PVF 
Sbjct: 1   MSVLVDKHTKVLCQGFTGKQGTYHTEQALAY-GTKMVGGVTPGKGGQMHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           T+ EA E T A+ASVIYVP     D+IIE+ EA + LIVCITEG+PVLDM++VK  +E +
Sbjct: 56  TMREAVEETQADASVIYVPAPFCKDSIIEAAEAGVKLIVCITEGVPVLDMLQVKVYIENN 115

Query: 121 -SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQST 179
             +RLIGPNCPGI+TP  CKIGIMPG I   G VGI+SRSGTLTYEAV QT+ +G GQST
Sbjct: 116 TQARLIGPNCPGIITPGECKIGIMPGYIHLPGKVGIVSRSGTLTYEAVKQTTDKGFGQST 175

Query: 180 AVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPI 239
            +GIGGDP+ GT FID L LF  D  TE+I+MVGEIGGSAEEEAA+F+K       KKP+
Sbjct: 176 CIGIGGDPIPGTSFIDALSLFEKDPKTEAIIMVGEIGGSAEEEAAEFIKSH----VKKPV 231

Query: 240 VGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           V ++AG TAP G+ MGHAGA+ISGGKG A +K  A++ AG+    SPA +G ++ E+ G
Sbjct: 232 VSYIAGVTAPAGKRMGHAGAIISGGKGTAAEKYAALEAAGVKTVRSPADLGDAIAEVTG 290


>gi|15615032|ref|NP_243335.1| succinyl-CoA synthetase subunit alpha [Bacillus halodurans C-125]
 gi|10175089|dbj|BAB06188.1| succinyl-CoA synthetase (alpha subunit) [Bacillus halodurans C-125]
          Length = 302

 Score =  344 bits (882), Expect = 9e-93,   Method: Composition-based stats.
 Identities = 175/299 (58%), Positives = 231/299 (77%), Gaps = 9/299 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL++K+TKV+VQG+TG  G FHT+QA+ Y  T +VGG+ P KG T   G    +PVF 
Sbjct: 1   MSILINKDTKVIVQGITGATGLFHTKQAVEY-GTNIVGGVTPGKGGTEVEG----IPVFD 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV++A E T ANASVIYVPP+ A DAI+E+++AE+ L +CITEGIPV+DMV+VK  +E  
Sbjct: 56  TVSQAVEATGANASVIYVPPAFAADAIMEAVDAELDLAICITEGIPVMDMVKVKRYMEGK 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            +RL+GPNCPG++TP+ CKIGIMPG I +KG VG++SRSGTLTYEAV Q S  G+GQSTA
Sbjct: 116 KTRLVGPNCPGVITPEECKIGIMPGYIHKKGHVGVVSRSGTLTYEAVHQLSTAGIGQSTA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPV GT FIDVL+LF  D  T +++M+GEIGG+AEEEAA+++K        KP+V
Sbjct: 176 VGIGGDPVNGTNFIDVLKLFNEDPDTYAVIMIGEIGGTAEEEAAEWIKANM----TKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
           GF+ G+TAPPG+ MGHAGA+ISGGKG A +KI  ++  G+ +A +P+ +G +L+ +L  
Sbjct: 232 GFIGGQTAPPGKRMGHAGAIISGGKGTAAEKIKTLESCGVKVAETPSVMGETLISVLKE 290


>gi|56707642|ref|YP_169538.1| succinyl-CoA synthetase, alpha subunit [Francisella tularensis
           subsp. tularensis SCHU S4]
 gi|110670113|ref|YP_666670.1| succinyl-CoA synthetase, alpha subunit [Francisella tularensis
           subsp. tularensis FSC198]
 gi|118497192|ref|YP_898242.1| succinyl-CoA synthetase, alpha subunit [Francisella tularensis
           subsp. novicida U112]
 gi|134302425|ref|YP_001122395.1| succinyl-CoA synthetase, alpha subunit [Francisella tularensis
           subsp. tularensis WY96-3418]
 gi|187932030|ref|YP_001892015.1| succinyl-CoA ligase [ADP-forming] subunit alpha [Francisella
           tularensis subsp. mediasiatica FSC147]
 gi|194323491|ref|ZP_03057268.1| succinyl-CoA synthetase, alpha subunit family [Francisella
           tularensis subsp. novicida FTE]
 gi|208778984|ref|ZP_03246330.1| succinyl-CoA synthetase, alpha subunit family [Francisella novicida
           FTG]
 gi|224456712|ref|ZP_03665185.1| succinyl-CoA ligase [ADP-forming] subunit alpha [Francisella
           tularensis subsp. tularensis MA00-2987]
 gi|254370157|ref|ZP_04986163.1| succinate-CoA ligase [Francisella tularensis subsp. tularensis
           FSC033]
 gi|254372557|ref|ZP_04988046.1| hypothetical protein FTCG_00120 [Francisella tularensis subsp.
           novicida GA99-3549]
 gi|254874459|ref|ZP_05247169.1| succinyl-CoA synthetase [Francisella tularensis subsp. tularensis
           MA00-2987]
 gi|56604134|emb|CAG45136.1| Succinyl-CoA synthetase, alpha subunit [Francisella tularensis
           subsp. tularensis SCHU S4]
 gi|110320446|emb|CAL08519.1| Succinyl-CoA synthetase, alpha subunit [Francisella tularensis
           subsp. tularensis FSC198]
 gi|118423098|gb|ABK89488.1| succinyl-CoA synthetase, alpha subunit [Francisella novicida U112]
 gi|134050202|gb|ABO47273.1| succinyl-CoA synthetase, alpha subunit [Francisella tularensis
           subsp. tularensis WY96-3418]
 gi|151568401|gb|EDN34055.1| succinate-CoA ligase [Francisella tularensis subsp. tularensis
           FSC033]
 gi|151570284|gb|EDN35938.1| hypothetical protein FTCG_00120 [Francisella novicida GA99-3549]
 gi|187712939|gb|ACD31236.1| succinyl-CoA ligase [ADP-forming] subunit alpha [Francisella
           tularensis subsp. mediasiatica FSC147]
 gi|194322346|gb|EDX19827.1| succinyl-CoA synthetase, alpha subunit family [Francisella
           tularensis subsp. novicida FTE]
 gi|208744784|gb|EDZ91082.1| succinyl-CoA synthetase, alpha subunit family [Francisella novicida
           FTG]
 gi|254840458|gb|EET18894.1| succinyl-CoA synthetase [Francisella tularensis subsp. tularensis
           MA00-2987]
 gi|282158800|gb|ADA78191.1| succinyl-CoA synthetase, alpha subunit [Francisella tularensis
           subsp. tularensis NE061598]
 gi|328675716|gb|AEB28391.1| Succinyl-CoA ligase [ADP-forming] alpha chain [Francisella cf.
           novicida 3523]
 gi|328676664|gb|AEB27534.1| Succinyl-CoA ligase [ADP-forming] alpha chain [Francisella cf.
           novicida Fx1]
          Length = 290

 Score =  344 bits (882), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 173/298 (58%), Positives = 217/298 (72%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+LVDKNTKVLVQG TGK GTFH+EQAI Y  T +VGG+ P KG T      ++ PVF 
Sbjct: 1   MSVLVDKNTKVLVQGFTGKNGTFHSEQAIAY-GTNIVGGVTPGKGGTTH----LDRPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           T+AEA   T A+ASVIYVP     D+ IE+I++ + L+V ITEG+P LDM+ VK  L+  
Sbjct: 56  TMAEAVAATGADASVIYVPAPFVKDSAIEAIDSGVKLVVIITEGVPTLDMLVVKEYLKDK 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPGI+TP  CKIGIMPG I  KG VGI+SRSGTLTYEAV QT++ G GQST 
Sbjct: 116 DVRVIGPNCPGIITPGECKIGIMPGHIHMKGKVGIISRSGTLTYEAVAQTTKLGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           +GIGGDP+ G   I+ L+L   D  TE+I+++GEIGG+AEEEAA+++K        KP++
Sbjct: 176 IGIGGDPIPGMNQIEALKLLENDPQTEAIILIGEIGGTAEEEAAEYIKHN----VTKPVI 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           G++AG TAPPG+ MGHAGA+ISGGKG AE+K  A + AGI    SPA IG+ L E+ G
Sbjct: 232 GYIAGVTAPPGKRMGHAGAIISGGKGTAEEKFAAFEAAGIAYTRSPAEIGKKLKEVTG 289


>gi|18655523|pdb|1JKJ|A Chain A, E. Coli Scs
 gi|18655525|pdb|1JKJ|D Chain D, E. Coli Scs
 gi|18655527|pdb|1JLL|A Chain A, Crystal Structure Analysis Of The E197betaa Mutant Of E.
           Coli Scs
 gi|18655529|pdb|1JLL|D Chain D, Crystal Structure Analysis Of The E197betaa Mutant Of E.
           Coli Scs
          Length = 288

 Score =  344 bits (882), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 172/297 (57%), Positives = 217/297 (73%), Gaps = 9/297 (3%)

Query: 2   SILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFTT 61
           SIL+DKNTKV+ QG TG  GTFH+EQAI Y  T++VGG+ P KG T   G    +PVF T
Sbjct: 1   SILIDKNTKVICQGFTGSQGTFHSEQAIAY-GTKMVGGVTPGKGGTTHLG----LPVFNT 55

Query: 62  VAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKSS 121
           V EA   T A ASVIYVP     D+I+E+I+A I LI+ ITEGIP LDM+ VK +L+++ 
Sbjct: 56  VREAVAATGATASVIYVPAPFCKDSILEAIDAGIKLIITITEGIPTLDMLTVKVKLDEAG 115

Query: 122 SRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTAV 181
            R+IGPNCPG++TP  CKIGI PG I + G VGI+SRSGTLTYEAV QT+  G GQST V
Sbjct: 116 VRMIGPNCPGVITPGECKIGIQPGHIHKPGKVGIVSRSGTLTYEAVKQTTDYGFGQSTCV 175

Query: 182 GIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIVG 241
           GIGGDP+ G+ FID+LE+F  D  TE+IVM+GEIGGSAEEEAA ++K+       KP+VG
Sbjct: 176 GIGGDPIPGSNFIDILEMFEKDPQTEAIVMIGEIGGSAEEEAAAYIKEH----VTKPVVG 231

Query: 242 FVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           ++AG TAP G+ MGHAGA+I+GGKG A++K  A++ AG+    S A IG +L  +L 
Sbjct: 232 YIAGVTAPKGKRMGHAGAIIAGGKGTADEKFAALEAAGVKTVRSLADIGEALKTVLK 288


>gi|229098304|ref|ZP_04229251.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Bacillus cereus
           Rock3-29]
 gi|229104397|ref|ZP_04235066.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Bacillus cereus
           Rock3-28]
 gi|229117321|ref|ZP_04246699.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Bacillus cereus
           Rock1-3]
 gi|228666221|gb|EEL21685.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Bacillus cereus
           Rock1-3]
 gi|228679095|gb|EEL33303.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Bacillus cereus
           Rock3-28]
 gi|228685202|gb|EEL39133.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Bacillus cereus
           Rock3-29]
          Length = 300

 Score =  344 bits (882), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 179/299 (59%), Positives = 230/299 (76%), Gaps = 9/299 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+LV+K+TKV+VQG+TG  G FHT+Q I Y  T++VGG+ P KG T   G    VPVF 
Sbjct: 1   MSVLVNKDTKVIVQGITGSQGLFHTKQMIEY-GTKIVGGVTPGKGGTDIEG----VPVFD 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV +A + T ANASV+YVPP+ A DAI+E+++A+I L+VCITEGIPVLDMV VK  +   
Sbjct: 56  TVEDAVKATGANASVVYVPPAFAADAIMEAVDAKIDLVVCITEGIPVLDMVNVKRYMAGK 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            +RL+GPNCPG++TPD CKIGIMPG I +KG VGI+SRSGTLTYEAV Q +QEG+GQSTA
Sbjct: 116 HTRLLGPNCPGVITPDECKIGIMPGYIHKKGHVGIVSRSGTLTYEAVHQLTQEGIGQSTA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPV GT+FID L+ F  DE T +++M+GEIGG+AEEEAA+++K        KP+V
Sbjct: 176 VGIGGDPVNGTDFIDALKAFNEDEETHAVIMIGEIGGTAEEEAAEWVKANM----TKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
           GF+ G+TAP G+ MGHAGA+ISGGKG A +KI  M+  GI +A +PA +G +L+ +L  
Sbjct: 232 GFIGGQTAPEGKRMGHAGAIISGGKGTAAEKIKTMEACGIKVAETPAVMGETLISVLKE 290


>gi|145633073|ref|ZP_01788805.1| succinyl-CoA synthetase alpha chain [Haemophilus influenzae 3655]
 gi|144986299|gb|EDJ92878.1| succinyl-CoA synthetase alpha chain [Haemophilus influenzae 3655]
          Length = 293

 Score =  344 bits (882), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 182/299 (60%), Positives = 222/299 (74%), Gaps = 9/299 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           M+IL+DKNTKV+ QG TG  G FH+EQA+ Y  TQ+VGG+ P KG T   G    +PVF 
Sbjct: 1   MAILIDKNTKVICQGFTGGQGAFHSEQALAY-GTQLVGGVSPNKGGTTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T A A+VIYVP S   DAIIE+I+A I LIVCITEGIP LDM++VK +L ++
Sbjct: 56  TVREAVENTGATATVIYVPASFCKDAIIEAIDAGIQLIVCITEGIPTLDMLKVKQKLNET 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
              +IGPNCPG++TPD CKIGIMP  I +KG VGI+SRSGTLTYEAV QT+ EG GQST 
Sbjct: 116 GVVMIGPNCPGVITPDECKIGIMPAHIHKKGKVGIVSRSGTLTYEAVKQTTDEGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+LE F  D  TE+IVM+GEIGGSAEEEAA F+KD       KP+V
Sbjct: 176 VGIGGDPILGSSFIDILERFQQDPETEAIVMIGEIGGSAEEEAAIFIKDN----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
            ++AG TAP G+ MGHAGA+ISGGKG A +KI A++ AG+    S A IG +L ++L S
Sbjct: 232 AYIAGITAPKGKRMGHAGAIISGGKGTAVEKIAALEAAGVTCVKSLAEIGAALRKVLKS 290


>gi|145639283|ref|ZP_01794889.1| succinyl-CoA synthetase alpha subunit [Haemophilus influenzae
           PittII]
 gi|145271586|gb|EDK11497.1| succinyl-CoA synthetase alpha subunit [Haemophilus influenzae
           PittII]
          Length = 293

 Score =  344 bits (882), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 182/299 (60%), Positives = 221/299 (73%), Gaps = 9/299 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           M+IL+DKNTKV+ QG TG  GTFH+EQA+ Y  TQ+VG + P KG T   G    +PVF 
Sbjct: 1   MAILIDKNTKVICQGFTGGQGTFHSEQALAY-GTQLVGVVSPNKGGTTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T A A+VIYVP S   DAIIE+I+A I LIVCITEGIP LDM++VK +L ++
Sbjct: 56  TVREAVENTGATATVIYVPASFCKDAIIEAIDAGIQLIVCITEGIPTLDMLKVKQKLNET 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
              +IGPNCPG++TPD CKIGIMP  I +KG VGI+SRSGTLTYEAV QT+ EG GQST 
Sbjct: 116 GVVMIGPNCPGVITPDECKIGIMPAHIHKKGKVGIVSRSGTLTYEAVKQTTDEGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+LE F  D  TE+IVM+GEIGGSAEEE A F+KD       KP+V
Sbjct: 176 VGIGGDPILGSSFIDILERFQQDPETEAIVMIGEIGGSAEEEVAIFIKDH----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
            ++AG TAP G+ MGHAGA+ISGGKG A +KI A++ AG+    S A IG +L +LL S
Sbjct: 232 AYIAGITAPKGKRMGHAGAIISGGKGTAVEKIAALEAAGVTCVKSLAEIGEALRKLLKS 290


>gi|261252267|ref|ZP_05944840.1| succinyl-CoA ligase [ADP-forming] alpha chain [Vibrio orientalis
           CIP 102891]
 gi|260935658|gb|EEX91647.1| succinyl-CoA ligase [ADP-forming] alpha chain [Vibrio orientalis
           CIP 102891]
          Length = 290

 Score =  344 bits (882), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 179/298 (60%), Positives = 221/298 (74%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+TKV+ QG TG  GTFH+EQAI Y  TQ+VGG+ P KG     G     PVF 
Sbjct: 1   MSVLINKDTKVICQGFTGGQGTFHSEQAIAY-GTQMVGGVSPGKGGQTHLGQ----PVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T A A+VIYVP     DAI+E+I+A I LIV ITEGIP  DM+ VK +LE++
Sbjct: 56  TVREAVEATGATATVIYVPAPFCKDAILEAIDAGIELIVTITEGIPTTDMIDVKVKLEET 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TPD CKIGIMPG I +KG VGI+SRSGTLTYEAV QT+ EG GQST 
Sbjct: 116 GVRMIGPNCPGVITPDECKIGIMPGHIHKKGKVGIVSRSGTLTYEAVKQTTDEGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L+LF  D  TE+IVM+GEIGG+AEEEAA ++K+       KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILKLFQEDPETEAIVMIGEIGGTAEEEAAAYIKEN----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            ++AG TAPPG+ MGHAGA+ISGGKG AEDK  A++ AG+    S A IG+ L E+ G
Sbjct: 232 SYIAGVTAPPGKRMGHAGAIISGGKGTAEDKFAALEAAGVKTVKSLADIGKGLREVTG 289


>gi|30263838|ref|NP_846215.1| succinyl-CoA synthetase subunit alpha [Bacillus anthracis str.
           Ames]
 gi|42782927|ref|NP_980174.1| succinyl-CoA synthetase subunit alpha [Bacillus cereus ATCC 10987]
 gi|47529263|ref|YP_020612.1| succinyl-CoA synthetase subunit alpha [Bacillus anthracis str.
           'Ames Ancestor']
 gi|47570336|ref|ZP_00240981.1| succinyl-CoA synthetase alpha chain [Bacillus cereus G9241]
 gi|49186685|ref|YP_029937.1| succinyl-CoA synthetase subunit alpha [Bacillus anthracis str.
           Sterne]
 gi|49479151|ref|YP_037896.1| succinyl-CoA synthetase subunit alpha [Bacillus thuringiensis
           serovar konkukian str. 97-27]
 gi|52141653|ref|YP_085176.1| succinyl-CoA synthetase subunit alpha [Bacillus cereus E33L]
 gi|65321162|ref|ZP_00394121.1| COG0074: Succinyl-CoA synthetase, alpha subunit [Bacillus anthracis
           str. A2012]
 gi|165873310|ref|ZP_02217915.1| succinate-CoA ligase (ADP-forming), alpha subunit [Bacillus
           anthracis str. A0488]
 gi|167642032|ref|ZP_02400262.1| succinate-CoA ligase (ADP-forming), alpha subunit [Bacillus
           anthracis str. A0193]
 gi|170689659|ref|ZP_02880839.1| succinate-CoA ligase (ADP-forming), alpha subunit [Bacillus
           anthracis str. A0465]
 gi|170709357|ref|ZP_02899771.1| succinate-CoA ligase (ADP-forming), alpha subunit [Bacillus
           anthracis str. A0389]
 gi|177656001|ref|ZP_02937128.1| succinate-CoA ligase (ADP-forming), alpha subunit [Bacillus
           anthracis str. A0174]
 gi|196042355|ref|ZP_03109626.1| succinate-CoA ligase (ADP-forming), alpha subunit [Bacillus cereus
           NVH0597-99]
 gi|206972725|ref|ZP_03233661.1| succinate-CoA ligase (ADP-forming), alpha subunit [Bacillus cereus
           AH1134]
 gi|217961255|ref|YP_002339823.1| succinyl-CoA synthetase subunit alpha [Bacillus cereus AH187]
 gi|218232394|ref|YP_002368636.1| succinyl-CoA synthetase subunit alpha [Bacillus cereus B4264]
 gi|218898988|ref|YP_002447399.1| succinate-CoA ligase (ADP-forming), alpha subunit [Bacillus cereus
           G9842]
 gi|218904963|ref|YP_002452797.1| succinate-CoA ligase (ADP-forming), alpha subunit [Bacillus cereus
           AH820]
 gi|222097280|ref|YP_002531337.1| succinyl-CoA synthetase subunit alpha [Bacillus cereus Q1]
 gi|225865816|ref|YP_002751194.1| succinate-CoA ligase (ADP-forming), alpha subunit [Bacillus cereus
           03BB102]
 gi|227813257|ref|YP_002813266.1| succinate-CoA ligase (ADP-forming), alpha subunit [Bacillus
           anthracis str. CDC 684]
 gi|228902338|ref|ZP_04066495.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Bacillus
           thuringiensis IBL 4222]
 gi|228909660|ref|ZP_04073483.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Bacillus
           thuringiensis IBL 200]
 gi|228916472|ref|ZP_04080038.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Bacillus
           thuringiensis serovar pulsiensis BGSC 4CC1]
 gi|228922589|ref|ZP_04085889.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Bacillus
           thuringiensis serovar huazhongensis BGSC 4BD1]
 gi|228928883|ref|ZP_04091915.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Bacillus
           thuringiensis serovar pondicheriensis BGSC 4BA1]
 gi|228935149|ref|ZP_04097976.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Bacillus
           thuringiensis serovar andalousiensis BGSC 4AW1]
 gi|228940923|ref|ZP_04103482.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Bacillus
           thuringiensis serovar berliner ATCC 10792]
 gi|228947554|ref|ZP_04109844.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Bacillus
           thuringiensis serovar monterrey BGSC 4AJ1]
 gi|228954111|ref|ZP_04116140.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Bacillus
           thuringiensis serovar kurstaki str. T03a001]
 gi|228960051|ref|ZP_04121715.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Bacillus
           thuringiensis serovar pakistani str. T13001]
 gi|228966780|ref|ZP_04127824.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Bacillus
           thuringiensis serovar sotto str. T04001]
 gi|228973852|ref|ZP_04134428.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Bacillus
           thuringiensis serovar thuringiensis str. T01001]
 gi|228980442|ref|ZP_04140752.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Bacillus
           thuringiensis Bt407]
 gi|228986978|ref|ZP_04147104.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Bacillus
           thuringiensis serovar tochigiensis BGSC 4Y1]
 gi|229031465|ref|ZP_04187465.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Bacillus cereus
           AH1271]
 gi|229047521|ref|ZP_04193111.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Bacillus cereus
           AH676]
 gi|229071333|ref|ZP_04204556.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Bacillus cereus
           F65185]
 gi|229081090|ref|ZP_04213600.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Bacillus cereus
           Rock4-2]
 gi|229092877|ref|ZP_04224011.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Bacillus cereus
           Rock3-42]
 gi|229111306|ref|ZP_04240859.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Bacillus cereus
           Rock1-15]
 gi|229123349|ref|ZP_04252553.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Bacillus cereus
           95/8201]
 gi|229129111|ref|ZP_04258084.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Bacillus cereus
           BDRD-Cer4]
 gi|229140477|ref|ZP_04269032.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Bacillus cereus
           BDRD-ST26]
 gi|229146406|ref|ZP_04274777.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Bacillus cereus
           BDRD-ST24]
 gi|229157411|ref|ZP_04285489.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Bacillus cereus
           ATCC 4342]
 gi|229174501|ref|ZP_04302033.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Bacillus cereus
           MM3]
 gi|229180111|ref|ZP_04307455.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Bacillus cereus
           172560W]
 gi|229186075|ref|ZP_04313244.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Bacillus cereus
           BGSC 6E1]
 gi|229192004|ref|ZP_04318974.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Bacillus cereus
           ATCC 10876]
 gi|229197945|ref|ZP_04324660.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Bacillus cereus
           m1293]
 gi|229604162|ref|YP_002868072.1| succinate-CoA ligase (ADP-forming), alpha subunit [Bacillus
           anthracis str. A0248]
 gi|254683458|ref|ZP_05147318.1| succinyl-CoA synthetase subunit alpha [Bacillus anthracis str.
           CNEVA-9066]
 gi|254721979|ref|ZP_05183768.1| succinyl-CoA synthetase subunit alpha [Bacillus anthracis str.
           A1055]
 gi|254735873|ref|ZP_05193579.1| succinyl-CoA synthetase subunit alpha [Bacillus anthracis str.
           Western North America USA6153]
 gi|254739602|ref|ZP_05197296.1| succinyl-CoA synthetase subunit alpha [Bacillus anthracis str.
           Kruger B]
 gi|254751204|ref|ZP_05203243.1| succinyl-CoA synthetase subunit alpha [Bacillus anthracis str.
           Vollum]
 gi|254759313|ref|ZP_05211338.1| succinyl-CoA synthetase subunit alpha [Bacillus anthracis str.
           Australia 94]
 gi|296504330|ref|YP_003666030.1| succinyl-CoA synthetase subunit alpha [Bacillus thuringiensis
           BMB171]
 gi|30258482|gb|AAP27701.1| succinate-CoA ligase (ADP-forming), alpha subunit [Bacillus
           anthracis str. Ames]
 gi|42738854|gb|AAS42782.1| succinyl-CoA synthase, alpha subunit [Bacillus cereus ATCC 10987]
 gi|47504411|gb|AAT33087.1| succinate-CoA ligase (ADP-forming), alpha subunit [Bacillus
           anthracis str. 'Ames Ancestor']
 gi|47553001|gb|EAL11407.1| succinyl-CoA synthetase alpha chain [Bacillus cereus G9241]
 gi|49180612|gb|AAT55988.1| succinyl-CoA synthase, alpha subunit [Bacillus anthracis str.
           Sterne]
 gi|49330707|gb|AAT61353.1| succinyl-CoA synthase, alpha subunit [Bacillus thuringiensis
           serovar konkukian str. 97-27]
 gi|51975122|gb|AAU16672.1| succinyl-CoA synthase, alpha subunit [Bacillus cereus E33L]
 gi|164710948|gb|EDR16520.1| succinate-CoA ligase (ADP-forming), alpha subunit [Bacillus
           anthracis str. A0488]
 gi|167510012|gb|EDR85428.1| succinate-CoA ligase (ADP-forming), alpha subunit [Bacillus
           anthracis str. A0193]
 gi|170125731|gb|EDS94644.1| succinate-CoA ligase (ADP-forming), alpha subunit [Bacillus
           anthracis str. A0389]
 gi|170666383|gb|EDT17166.1| succinate-CoA ligase (ADP-forming), alpha subunit [Bacillus
           anthracis str. A0465]
 gi|172079900|gb|EDT65008.1| succinate-CoA ligase (ADP-forming), alpha subunit [Bacillus
           anthracis str. A0174]
 gi|196026811|gb|EDX65447.1| succinate-CoA ligase (ADP-forming), alpha subunit [Bacillus cereus
           NVH0597-99]
 gi|206732347|gb|EDZ49533.1| succinate-CoA ligase (ADP-forming), alpha subunit [Bacillus cereus
           AH1134]
 gi|217063692|gb|ACJ77942.1| succinate-CoA ligase (ADP-forming), alpha subunit [Bacillus cereus
           AH187]
 gi|218160351|gb|ACK60343.1| succinate-CoA ligase (ADP-forming), alpha subunit [Bacillus cereus
           B4264]
 gi|218538957|gb|ACK91355.1| succinate-CoA ligase (ADP-forming), alpha subunit [Bacillus cereus
           AH820]
 gi|218545726|gb|ACK98120.1| succinate-CoA ligase (ADP-forming), alpha subunit [Bacillus cereus
           G9842]
 gi|221241338|gb|ACM14048.1| succinyl-CoA synthase, alpha subunit [Bacillus cereus Q1]
 gi|225788869|gb|ACO29086.1| succinate-CoA ligase (ADP-forming), alpha subunit [Bacillus cereus
           03BB102]
 gi|227002998|gb|ACP12741.1| succinate-CoA ligase (ADP-forming), alpha subunit [Bacillus
           anthracis str. CDC 684]
 gi|228585524|gb|EEK43627.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Bacillus cereus
           m1293]
 gi|228591555|gb|EEK49404.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Bacillus cereus
           ATCC 10876]
 gi|228597251|gb|EEK54902.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Bacillus cereus
           BGSC 6E1]
 gi|228603320|gb|EEK60797.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Bacillus cereus
           172560W]
 gi|228609061|gb|EEK66351.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Bacillus cereus
           MM3]
 gi|228626138|gb|EEK82887.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Bacillus cereus
           ATCC 4342]
 gi|228637039|gb|EEK93498.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Bacillus cereus
           BDRD-ST24]
 gi|228643038|gb|EEK99314.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Bacillus cereus
           BDRD-ST26]
 gi|228654348|gb|EEL10213.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Bacillus cereus
           BDRD-Cer4]
 gi|228660125|gb|EEL15761.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Bacillus cereus
           95/8201]
 gi|228672082|gb|EEL27373.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Bacillus cereus
           Rock1-15]
 gi|228690499|gb|EEL44282.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Bacillus cereus
           Rock3-42]
 gi|228702134|gb|EEL54610.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Bacillus cereus
           Rock4-2]
 gi|228711787|gb|EEL63739.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Bacillus cereus
           F65185]
 gi|228723768|gb|EEL75123.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Bacillus cereus
           AH676]
 gi|228729754|gb|EEL80734.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Bacillus cereus
           AH1271]
 gi|228772756|gb|EEM21196.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Bacillus
           thuringiensis serovar tochigiensis BGSC 4Y1]
 gi|228779262|gb|EEM27519.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Bacillus
           thuringiensis Bt407]
 gi|228785877|gb|EEM33880.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Bacillus
           thuringiensis serovar thuringiensis str. T01001]
 gi|228792879|gb|EEM40437.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Bacillus
           thuringiensis serovar sotto str. T04001]
 gi|228799567|gb|EEM46520.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Bacillus
           thuringiensis serovar pakistani str. T13001]
 gi|228805677|gb|EEM52267.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Bacillus
           thuringiensis serovar kurstaki str. T03a001]
 gi|228812074|gb|EEM58405.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Bacillus
           thuringiensis serovar monterrey BGSC 4AJ1]
 gi|228818759|gb|EEM64825.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Bacillus
           thuringiensis serovar berliner ATCC 10792]
 gi|228824514|gb|EEM70319.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Bacillus
           thuringiensis serovar andalousiensis BGSC 4AW1]
 gi|228830690|gb|EEM76295.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Bacillus
           thuringiensis serovar pondicheriensis BGSC 4BA1]
 gi|228837018|gb|EEM82359.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Bacillus
           thuringiensis serovar huazhongensis BGSC 4BD1]
 gi|228843051|gb|EEM88133.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Bacillus
           thuringiensis serovar pulsiensis BGSC 4CC1]
 gi|228849949|gb|EEM94780.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Bacillus
           thuringiensis IBL 200]
 gi|228857307|gb|EEN01810.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Bacillus
           thuringiensis IBL 4222]
 gi|229268570|gb|ACQ50207.1| succinate-CoA ligase (ADP-forming), alpha subunit [Bacillus
           anthracis str. A0248]
 gi|296325382|gb|ADH08310.1| succinyl-CoA synthetase subunit alpha [Bacillus thuringiensis
           BMB171]
 gi|324327732|gb|ADY22992.1| succinyl-CoA synthetase subunit alpha [Bacillus thuringiensis
           serovar finitimus YBT-020]
 gi|326941604|gb|AEA17500.1| succinyl-CoA synthetase subunit alpha [Bacillus thuringiensis
           serovar chinensis CT-43]
          Length = 300

 Score =  344 bits (882), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 180/299 (60%), Positives = 230/299 (76%), Gaps = 9/299 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+LV+K+TKV+VQG+TG  G FHT+Q I Y  T++VGG+ P KG T   G    VPVF 
Sbjct: 1   MSVLVNKDTKVIVQGITGSQGLFHTKQMIEY-GTKIVGGVTPGKGGTDIEG----VPVFD 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV +A + T ANASV+YVPP+ A DAI+E+++AEI L+VCITEGIPVLDMV VK  +   
Sbjct: 56  TVEDAVKATGANASVVYVPPAFAADAIMEAVDAEIDLVVCITEGIPVLDMVNVKRYMAGK 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            +RL+GPNCPG++TPD CKIGIMPG I +KG VGI+SRSGTLTYEAV Q +QEG+GQSTA
Sbjct: 116 HTRLLGPNCPGVITPDECKIGIMPGYIHKKGHVGIVSRSGTLTYEAVHQLTQEGIGQSTA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPV GT+FID L+ F  DE T +++M+GEIGG+AEEEAA+++K        KP+V
Sbjct: 176 VGIGGDPVNGTDFIDALKAFNEDEETHAVIMIGEIGGTAEEEAAEWVKANM----TKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
           GF+ G+TAP G+ MGHAGA+ISGGKG A +KI  M+  GI +A +PA +G +L+ +L  
Sbjct: 232 GFIGGQTAPAGKRMGHAGAIISGGKGTAAEKIKTMEACGIKVAETPAVMGETLISVLKE 290


>gi|296103342|ref|YP_003613488.1| succinyl-CoA synthetase alpha subunit [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
 gi|295057801|gb|ADF62539.1| succinyl-CoA synthetase alpha subunit [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
          Length = 289

 Score =  344 bits (882), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 171/298 (57%), Positives = 220/298 (73%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+TKV+ QG TG  GTFH+EQAI Y  TQ+VGG+ P KG T   G    +PVF 
Sbjct: 1   MSVLINKDTKVICQGFTGSQGTFHSEQAIAY-GTQMVGGVTPGKGGTTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T A A+VIYVP     D+I+E+I+A I LI+ ITEGIP LDM+ VK +L+++
Sbjct: 56  TVREAVEATGATATVIYVPAPFCKDSILEAIDAGIKLIITITEGIPTLDMLTVKVKLDEA 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TP  CKIGIMPG I + G VGI+SRSGTLTYEAV QT+  G GQST 
Sbjct: 116 GVRMIGPNCPGVITPGECKIGIMPGHIHKPGKVGIVSRSGTLTYEAVKQTTDYGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L+LF  D  TE+IVM+GEIGGSAEEEAA ++K+       KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILKLFQEDPQTEAIVMIGEIGGSAEEEAAAYIKEH----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           G++AG TAP G+ MGHAGA+I+GGKG A++K  A++ AG+    S A IG +L  ++ 
Sbjct: 232 GYIAGVTAPKGKRMGHAGAIIAGGKGTADEKFAALEAAGVKTVRSLADIGEALKSIIK 289


>gi|152969299|ref|YP_001334408.1| succinyl-CoA synthetase subunit alpha [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|238893766|ref|YP_002918500.1| succinyl-CoA synthetase subunit alpha [Klebsiella pneumoniae
           NTUH-K2044]
 gi|262041209|ref|ZP_06014421.1| succinyl-CoA synthetase subunit alpha [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|329998754|ref|ZP_08303208.1| succinate-CoA ligase, alpha subunit [Klebsiella sp. MS 92-3]
 gi|150954148|gb|ABR76178.1| succinyl-CoA synthetase alpha subunit [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|238546082|dbj|BAH62433.1| succinyl-CoA synthetase alpha subunit [Klebsiella pneumoniae subsp.
           pneumoniae NTUH-K2044]
 gi|259041438|gb|EEW42497.1| succinyl-CoA synthetase subunit alpha [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|328538581|gb|EGF64685.1| succinate-CoA ligase, alpha subunit [Klebsiella sp. MS 92-3]
          Length = 289

 Score =  344 bits (882), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 171/298 (57%), Positives = 220/298 (73%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+TKV+ QG TG  GTFH+EQAI Y  TQ+VGG+ P KG T   G    +PVF 
Sbjct: 1   MSVLINKDTKVICQGFTGSQGTFHSEQAIAY-GTQMVGGVTPGKGGTTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T A A+VIYVP     D+I+E+I+A I LI+ ITEGIP LDM+ VK +L+++
Sbjct: 56  TVREAVEATGATATVIYVPAPFCKDSILEAIDAGIKLIITITEGIPTLDMLTVKVKLDEA 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TP  CKIGIMPG I + G VGI+SRSGTLTYEAV QT+  G GQST 
Sbjct: 116 GVRMIGPNCPGVITPGECKIGIMPGHIHKPGKVGIVSRSGTLTYEAVKQTTDYGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L++F  D  TE+IVM+GEIGGSAEEEAA ++KD       KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILKMFEEDPQTEAIVMIGEIGGSAEEEAAAYIKDH----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           G++AG TAP G+ MGHAGA+I+GGKG A++K  A++ AG+    S A IG +L  ++ 
Sbjct: 232 GYIAGVTAPKGKRMGHAGAIIAGGKGTADEKFAALEAAGVKTVRSLADIGEALKAIIK 289


>gi|242046092|ref|XP_002460917.1| hypothetical protein SORBIDRAFT_02g037420 [Sorghum bicolor]
 gi|241924294|gb|EER97438.1| hypothetical protein SORBIDRAFT_02g037420 [Sorghum bicolor]
          Length = 332

 Score =  344 bits (882), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 181/298 (60%), Positives = 229/298 (76%), Gaps = 9/298 (3%)

Query: 2   SILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFTT 61
           ++ VDK+T+V+ QG+TGK GTFHTEQAI Y  T +VGG+ PKKG T   G    +PVF +
Sbjct: 37  AVFVDKSTRVICQGITGKNGTFHTEQAIEY-GTNMVGGVTPKKGGTEHLG----LPVFNS 91

Query: 62  VAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEK-S 120
           VAEAK  T ANASVIYVPP  A  AI+E+++AE+ L+VCITEGIP  DMV+VKA L + S
Sbjct: 92  VAEAKAETKANASVIYVPPPFAAAAIMEAMDAELDLVVCITEGIPQHDMVKVKAALNRQS 151

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            +RLIGPNCPGI+ P  CKIGIMPG I + G +GI+SRSGTLTYEAVFQT+  GLGQST 
Sbjct: 152 KTRLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTC 211

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP  GT F+D LE F+ D  TE IV++GEIGG+AEE+AA F+++      +KP+V
Sbjct: 212 VGIGGDPFNGTNFVDCLEKFVDDPQTEGIVLIGEIGGTAEEDAATFIQE---SKTQKPVV 268

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            F+AG TAPPGR MGHAGA+++GGKG A+DKI A++EAG+ +  SPA+IG ++ E+  
Sbjct: 269 AFIAGLTAPPGRRMGHAGAIVAGGKGTAQDKIKALREAGVTVVESPAKIGSTMFEIFK 326


>gi|167855518|ref|ZP_02478281.1| SucD [Haemophilus parasuis 29755]
 gi|167853384|gb|EDS24635.1| SucD [Haemophilus parasuis 29755]
          Length = 290

 Score =  344 bits (882), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 177/299 (59%), Positives = 223/299 (74%), Gaps = 9/299 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL++K+TKV+ QG TG  GTFH++QA+ Y  TQ+VGG+ P KG T   G    +PVF 
Sbjct: 1   MSILINKDTKVICQGFTGGQGTFHSQQALDY-GTQLVGGVSPGKGGTTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T A A+VIYVP  G  DAI+E+I+A I L+VCITEGIP LDM++VK RL ++
Sbjct: 56  TVREAVEATGATATVIYVPAPGCKDAILEAIDAGIQLVVCITEGIPTLDMLQVKQRLNQT 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TP+ CKIGIMPGSI +KG +GI+SRSGTLTYEAV QT+  G GQST 
Sbjct: 116 GVRMIGPNCPGVITPNECKIGIMPGSIHKKGKIGIVSRSGTLTYEAVKQTTDYGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L LF AD  TE+I+M+GEIGGSAEEEAA F+K        KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILTLFQADPETEAIIMIGEIGGSAEEEAAAFIKAN----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
            ++AG TAP G+ MGHAGA+ISGGKG A++K  A++ AG+    S A IG +L  +L  
Sbjct: 232 SYIAGVTAPKGKRMGHAGAIISGGKGTADEKFAALEAAGVKTVRSLADIGVALQAVLNK 290


>gi|229152034|ref|ZP_04280229.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Bacillus cereus
           m1550]
 gi|228631383|gb|EEK88017.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Bacillus cereus
           m1550]
          Length = 300

 Score =  344 bits (882), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 180/299 (60%), Positives = 229/299 (76%), Gaps = 9/299 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+LV+K+TKV+VQG+TG  G FHT+Q I Y  T++VGG+ P KG T   G    VPVF 
Sbjct: 1   MSVLVNKDTKVIVQGITGSQGLFHTKQMIEY-GTKIVGGVTPGKGGTDIEG----VPVFD 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV +A + T ANASV+YVPP+ A DAI+E+++AEI L+VCITEGIPVLDMV VK  +   
Sbjct: 56  TVEDAVKATGANASVVYVPPAFAADAIMEAVDAEIDLVVCITEGIPVLDMVNVKRYMAGK 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            +RL+GPNCPG++TPD CKIGIMPG I +KG VGI+SRSGTLTYEAV Q +QEG+GQSTA
Sbjct: 116 HTRLLGPNCPGVITPDECKIGIMPGYIHKKGHVGIVSRSGTLTYEAVHQLTQEGIGQSTA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPV GT+FID L  F  DE T +++M+GEIGG+AEEEAA+++K        KP+V
Sbjct: 176 VGIGGDPVNGTDFIDALRAFNEDEETHAVIMIGEIGGTAEEEAAEWVKANM----TKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
           GF+ G+TAP G+ MGHAGA+ISGGKG A +KI  M+  GI +A +PA +G +L+ +L  
Sbjct: 232 GFIGGQTAPAGKRMGHAGAIISGGKGTAAEKIKTMEACGIKVAETPAVMGETLISVLKE 290


>gi|296330825|ref|ZP_06873300.1| succinyl-CoA synthetase subunit alpha [Bacillus subtilis subsp.
           spizizenii ATCC 6633]
 gi|305674343|ref|YP_003866015.1| succinyl-CoA synthetase subunit alpha [Bacillus subtilis subsp.
           spizizenii str. W23]
 gi|296151830|gb|EFG92704.1| succinyl-CoA synthetase subunit alpha [Bacillus subtilis subsp.
           spizizenii ATCC 6633]
 gi|305412587|gb|ADM37706.1| succinyl-CoA synthetase subunit alpha [Bacillus subtilis subsp.
           spizizenii str. W23]
          Length = 300

 Score =  344 bits (882), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 172/299 (57%), Positives = 226/299 (75%), Gaps = 9/299 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+ ++K+T+V+VQG+TG    FHT+Q + Y  T +VGG+ P KG T   G    VPVF 
Sbjct: 1   MSVFINKDTRVIVQGITGSTALFHTKQMLEY-GTNIVGGVTPGKGGTEAEG----VPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TVAEA + T ANASVIYVP   A DAI+E+++AE+ L++CITE IPVLDMV+VK  +E  
Sbjct: 56  TVAEAVQTTGANASVIYVPAPFAADAIMEAVDAELDLVICITEHIPVLDMVKVKRFMEGK 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            +RLIGPNCPG++TP+ CKIGIMPG I +KG VG++SRSGTLTYEAV Q S+ G+GQSTA
Sbjct: 116 KTRLIGPNCPGVITPEECKIGIMPGYIHKKGHVGVVSRSGTLTYEAVHQLSEAGVGQSTA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPV GT FID L+ F  D  T +++M+GEIGG+AEEEAA+++K        KP+V
Sbjct: 176 VGIGGDPVNGTNFIDALKAFNEDPDTHAVIMIGEIGGTAEEEAAEWVKANM----TKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
           GF+ GKTAPPG+ MGHAGA+ISGGKG A++KI  +   GI +A +P+ +G +L+++L  
Sbjct: 232 GFIGGKTAPPGKRMGHAGAIISGGKGTADEKIKTLNACGIEVAETPSVMGETLIKVLKE 290


>gi|261341315|ref|ZP_05969173.1| succinyl-CoA synthetase subunit alpha [Enterobacter cancerogenus
           ATCC 35316]
 gi|288316619|gb|EFC55557.1| succinyl-CoA synthetase subunit alpha [Enterobacter cancerogenus
           ATCC 35316]
          Length = 289

 Score =  344 bits (882), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 171/298 (57%), Positives = 220/298 (73%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+TKV+ QG TG  GTFH+EQAI Y  TQ+VGG+ P KG T   G    +PVF 
Sbjct: 1   MSVLINKDTKVICQGFTGSQGTFHSEQAIAY-GTQMVGGVTPGKGGTTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T A A+VIYVP     D+I+E+I+A I LI+ ITEGIP LDM+ VK +L+++
Sbjct: 56  TVREAVEATGATATVIYVPAPFCKDSILEAIDAGIKLIITITEGIPTLDMLTVKVKLDEA 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TP  CKIGIMPG I + G VGI+SRSGTLTYEAV QT+  G GQST 
Sbjct: 116 GVRMIGPNCPGVITPGECKIGIMPGHIHKPGKVGIVSRSGTLTYEAVKQTTDYGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L+LF  D  TE+IVM+GEIGGSAEEEAA ++K+       KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILKLFQEDPQTEAIVMIGEIGGSAEEEAAAYIKEN----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           G++AG TAP G+ MGHAGA+I+GGKG A++K  A++ AG+    S A IG +L  ++ 
Sbjct: 232 GYIAGVTAPKGKRMGHAGAIIAGGKGTADEKFAALEAAGVKTVRSLADIGEALKSIIK 289


>gi|89098657|ref|ZP_01171539.1| succinyl-CoA synthetase alpha subunit [Bacillus sp. NRRL B-14911]
 gi|89086619|gb|EAR65738.1| succinyl-CoA synthetase alpha subunit [Bacillus sp. NRRL B-14911]
          Length = 300

 Score =  344 bits (882), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 173/299 (57%), Positives = 225/299 (75%), Gaps = 9/299 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+ ++K+TKV+VQG+TG    FHT+Q + Y  TQ+VGG  P KG     G    VPVF 
Sbjct: 1   MSVFINKDTKVIVQGITGSTALFHTKQMLEY-GTQIVGGTTPGKGGMEVEG----VPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA + T A ASVIYVP + A DAI+E+++AE+ L +CITE IPVLDMV+VK  +E  
Sbjct: 56  TVQEAVKETGATASVIYVPAAFAADAILEAVDAELDLAICITEHIPVLDMVKVKRYMEGK 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            +RL+GPNCPG++TPD CKIGIMPG I  KG VG++SRSGTLTYEAV Q +Q G+GQSTA
Sbjct: 116 KTRLVGPNCPGVITPDECKIGIMPGYIHTKGHVGVVSRSGTLTYEAVHQLTQAGIGQSTA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPV GT FIDVL+ F  D  T++++M+GEIGG+AEEEAA+++K        KP+V
Sbjct: 176 VGIGGDPVNGTNFIDVLKAFNEDPETKAVIMIGEIGGTAEEEAAEWVKANM----TKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
           GF+ G+TAPPG+ MGHAGA+ISGGKG A++KI  M E GI +A +P+ +G +L+++L  
Sbjct: 232 GFIGGRTAPPGKRMGHAGAIISGGKGTADEKIRVMNECGIQVADTPSVMGETLIKVLKE 290


>gi|317129220|ref|YP_004095502.1| succinyl-CoA synthetase, subunit alpha [Bacillus cellulosilyticus
           DSM 2522]
 gi|315474168|gb|ADU30771.1| succinyl-CoA synthetase, alpha subunit [Bacillus cellulosilyticus
           DSM 2522]
          Length = 301

 Score =  344 bits (882), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 179/299 (59%), Positives = 232/299 (77%), Gaps = 9/299 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSI+++K+TK++VQG+TG  G FHT+QAI Y  T VVGG+ P KG T   G    VPVF 
Sbjct: 1   MSIMINKDTKLIVQGITGATGLFHTKQAIEY-GTNVVGGVTPGKGGTEVEG----VPVFD 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV++A E T ANASVIYVPP  A DAI+E+ +A + L++ ITEGIPV DM++VK  LE  
Sbjct: 56  TVSQAVEATGANASVIYVPPPFAADAIMEATDAGVELVITITEGIPVTDMIKVKRYLEGK 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
           ++RLIGPNCPG++TP+ CKIGIMPG I +KG VG++SRSGTLTYEAV Q S EG+GQSTA
Sbjct: 116 NTRLIGPNCPGVITPEECKIGIMPGYIHKKGHVGVVSRSGTLTYEAVHQLSTEGIGQSTA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPV GT FIDVL+LF  DE T +++M+GEIGG+AEEEAA+++K+       KP+V
Sbjct: 176 VGIGGDPVNGTNFIDVLKLFNEDEDTYAVIMIGEIGGTAEEEAAEWIKENM----TKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
           GF+ G+TAPPG+ MGHAGA+ISGGKG A +KI  ++ AG+ +A +PA +G +L+ +L  
Sbjct: 232 GFIGGQTAPPGKRMGHAGAIISGGKGTASEKIKTLENAGVKVAETPAVMGETLISVLKE 290


>gi|262375859|ref|ZP_06069091.1| succinyl-CoA synthetase subunit alpha [Acinetobacter lwoffii SH145]
 gi|262309462|gb|EEY90593.1| succinyl-CoA synthetase subunit alpha [Acinetobacter lwoffii SH145]
          Length = 296

 Score =  344 bits (882), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 166/301 (55%), Positives = 221/301 (73%), Gaps = 11/301 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+LV+K+TKVLVQG TGK GTFH+EQA+ Y  T+VVGG+ P KG        + +PVF 
Sbjct: 1   MSVLVNKDTKVLVQGFTGKNGTFHSEQALAY-GTKVVGGVTPGKGGQTH----LELPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARL--E 118
           T+ EA + T A+ASVIYVP     D+I+E++++ I LIV ITEG+P +DM++ K  L   
Sbjct: 56  TMREAVKETGADASVIYVPAPFVLDSIVEAVDSGIELIVVITEGVPTIDMLKAKRYLETN 115

Query: 119 KSSSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQS 178
            + +RLIGPNCPGI+TP  CKIGIMPG I + G +GI+SRSGTLTYEAV QT++ GLGQS
Sbjct: 116 GNGTRLIGPNCPGIITPGECKIGIMPGHIHQPGKIGIISRSGTLTYEAVAQTTKLGLGQS 175

Query: 179 TAVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKP 238
           T +GIGGDP+ G   ID L+LF  D  TE+I+M+GEIGG+AEEEAA++++        KP
Sbjct: 176 TCIGIGGDPIPGMNQIDCLKLFQEDPQTEAIIMIGEIGGTAEEEAAEYIQSN----VTKP 231

Query: 239 IVGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           +VG++AG TAP G+ MGHAGA+ISGGKG AE+K  A + AG+    SPA +G +++++L 
Sbjct: 232 VVGYIAGVTAPKGKRMGHAGAIISGGKGTAEEKFAAFERAGMAYTRSPAELGSTMLQVLK 291

Query: 299 S 299
            
Sbjct: 292 D 292


>gi|319637661|ref|ZP_07992427.1| succinyl-CoA ligase subunit alpha [Neisseria mucosa C102]
 gi|317400816|gb|EFV81471.1| succinyl-CoA ligase subunit alpha [Neisseria mucosa C102]
          Length = 296

 Score =  344 bits (882), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 164/301 (54%), Positives = 223/301 (74%), Gaps = 11/301 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+TKVLVQG TGK GTFH+EQA+ Y  T+VVGG+ P KG        +N+PVF 
Sbjct: 1   MSVLINKDTKVLVQGFTGKNGTFHSEQALAY-GTKVVGGVTPGKGGQTH----LNLPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARL--E 118
           T+ EA + T A+ASVIYVP     D+I+E++++ + L+V ITEG+P LDM++ K  L   
Sbjct: 56  TMKEAVKETGADASVIYVPAPFVLDSIVEAVDSGVGLVVVITEGVPTLDMLKAKRYLETN 115

Query: 119 KSSSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQS 178
            + +RL+GPNCPG++TP  CKIGIMPG I   G +GI+SRSGTLTYEAV QT++ GLGQS
Sbjct: 116 GNGTRLVGPNCPGVITPGECKIGIMPGHIHTPGRIGIISRSGTLTYEAVAQTTKLGLGQS 175

Query: 179 TAVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKP 238
           T +GIGGDP+ G   ID L+LF  D  T++I+M+GEIGG+AEEEAA++++        KP
Sbjct: 176 TCIGIGGDPIPGMNQIDALKLFQEDPDTDAIIMIGEIGGTAEEEAAEYIQSN----VTKP 231

Query: 239 IVGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           +VG++AG TAP G+ MGHAGA+ISGGKG AE+K  A ++AGI    SPA +G +++E+L 
Sbjct: 232 VVGYIAGVTAPKGKRMGHAGAIISGGKGTAEEKFAAFEKAGIAYTRSPAELGSTMLEVLK 291

Query: 299 S 299
           +
Sbjct: 292 A 292


>gi|160872669|ref|ZP_02062801.1| succinyl-CoA synthetase, alpha subunit [Rickettsiella grylli]
 gi|159121468|gb|EDP46806.1| succinyl-CoA synthetase, alpha subunit [Rickettsiella grylli]
          Length = 289

 Score =  343 bits (881), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 179/298 (60%), Positives = 220/298 (73%), Gaps = 10/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL+DKNTKV+ QG TGK GTFH+EQAI Y  T++VGG+ P KG T   G    +PVF 
Sbjct: 1   MSILIDKNTKVICQGFTGKQGTFHSEQAIAY-GTKMVGGVTPGKGGTQHLG----LPVFD 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLE-K 119
           TVA+A  +T A+ASVIYVP     D+IIE+ +A I  IVCITEGIPVLDM+ VK  LE K
Sbjct: 56  TVADAVAKTGADASVIYVPAPFCKDSIIEAADAGISFIVCITEGIPVLDMLDVKVYLETK 115

Query: 120 SSSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQST 179
           + +RL+GPNCPG++TP  CKIGIMPG I + G VGI+SRSGTLTYEAV QT+  GLGQST
Sbjct: 116 NIARLVGPNCPGVITPGECKIGIMPGYIHQSGRVGIVSRSGTLTYEAVKQTTDLGLGQST 175

Query: 180 AVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPI 239
            VGIGGDP+ G  F+DVL LF  D  TE+I+MVGEIGG+AEEEAA F+K        KP+
Sbjct: 176 CVGIGGDPIPGMNFVDVLRLFQEDPQTEAILMVGEIGGNAEEEAAAFIKT----KVTKPV 231

Query: 240 VGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELL 297
           V ++AG TAP G+ MGHAGA+ISGGKG A +K  A++ AG+    SP  +G+ + +LL
Sbjct: 232 VAYIAGVTAPVGKRMGHAGAIISGGKGTAAEKFKALEAAGVYTVKSPTDMGKRIAQLL 289


>gi|183598179|ref|ZP_02959672.1| hypothetical protein PROSTU_01558 [Providencia stuartii ATCC 25827]
 gi|188020346|gb|EDU58386.1| hypothetical protein PROSTU_01558 [Providencia stuartii ATCC 25827]
          Length = 290

 Score =  343 bits (881), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 172/299 (57%), Positives = 219/299 (73%), Gaps = 9/299 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL+DKNTKV+ QG TG  GTFH+EQAI Y  T++VGG+ P KG T   G    +PVF 
Sbjct: 1   MSILIDKNTKVICQGFTGGQGTFHSEQAIAY-GTKMVGGVTPGKGGTTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T A ASVIYVP     D+I+E+I+A I LI+ ITEGIP LDM+ VK +L+++
Sbjct: 56  TVREAVEATGATASVIYVPAPFCKDSILEAIDAGIKLIITITEGIPTLDMLTVKVKLDEA 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TP  CKIGI PG I   G VGI+SRSGTLTYEAV QT+  GLGQST 
Sbjct: 116 GVRMIGPNCPGVITPGECKIGIQPGHIHMPGKVGIVSRSGTLTYEAVKQTTDAGLGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L++F  D  TE+IVM+GEIGG+AEEEAA ++K+       KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILKMFQEDPQTEAIVMIGEIGGNAEEEAAAYIKEH----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
           G++AG TAP G+ MGHAGA+I+GGKG A++K  A++ AG+    S A IG ++  +L  
Sbjct: 232 GYIAGVTAPKGKRMGHAGAIIAGGKGTADEKFAALEAAGVKTVRSLADIGDAVKSMLAK 290


>gi|170726193|ref|YP_001760219.1| succinyl-CoA synthetase subunit alpha [Shewanella woodyi ATCC
           51908]
 gi|169811540|gb|ACA86124.1| succinyl-CoA synthetase, alpha subunit [Shewanella woodyi ATCC
           51908]
          Length = 290

 Score =  343 bits (881), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 175/294 (59%), Positives = 217/294 (73%), Gaps = 9/294 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+TKV+ QG TG  GTFH+EQAI Y  TQ+VGG+ P KG        +N+PVF 
Sbjct: 1   MSVLINKDTKVICQGFTGGQGTFHSEQAIDY-GTQMVGGVSPGKGGQVH----LNLPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV +A   T A ASVIYVP     DAI E+I+  I LIVCITEGIP LDM++VK +LE++
Sbjct: 56  TVKDAVAETGATASVIYVPAPFCKDAIFEAIDGGIELIVCITEGIPTLDMLQVKVKLEET 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TP  CKIGIMPG I + G VGI+SRSGTLTYEAV QT+ EG GQST 
Sbjct: 116 GVRMIGPNCPGVITPGECKIGIMPGHIHKPGKVGIVSRSGTLTYEAVKQTTDEGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ GT FIDVLE+F  D  TE+IVM+GEIGG+AEEEAA ++K        KP+V
Sbjct: 176 VGIGGDPIPGTNFIDVLEMFQNDPLTEAIVMIGEIGGTAEEEAADYIKAN----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLV 294
            ++AG TAP G+ MGHAGA+I+GGKG AEDK  A++ AG+    S A IG++L 
Sbjct: 232 SYIAGVTAPEGKRMGHAGAIIAGGKGTAEDKFAALEAAGVTTVRSLADIGKALR 285


>gi|225075112|ref|ZP_03718311.1| hypothetical protein NEIFLAOT_00111 [Neisseria flavescens
           NRL30031/H210]
 gi|224953596|gb|EEG34805.1| hypothetical protein NEIFLAOT_00111 [Neisseria flavescens
           NRL30031/H210]
          Length = 296

 Score =  343 bits (881), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 164/301 (54%), Positives = 224/301 (74%), Gaps = 11/301 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+TKVLVQG TGK GTFH+EQA+ Y  T+VVGG+ P KG        +N+PVF 
Sbjct: 1   MSVLINKDTKVLVQGFTGKNGTFHSEQALAY-GTKVVGGVTPGKGGQTH----LNLPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARL--E 118
           T+ EA + T A+ASVIYVP     D+I+E++++ + L+V ITEG+P LDM++ K  L   
Sbjct: 56  TMKEAVKETGADASVIYVPAPFVLDSIVEAVDSGVGLVVVITEGVPTLDMLKAKRYLETN 115

Query: 119 KSSSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQS 178
            + +RL+GPNCPG++TP  CKIGIMPG I + G +GI+SRSGTLTYEAV QT++ GLGQS
Sbjct: 116 GNGTRLVGPNCPGVITPGECKIGIMPGHIHQPGRIGIISRSGTLTYEAVAQTTKLGLGQS 175

Query: 179 TAVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKP 238
           T +GIGGDP+ G   ID L+LF  D  T++I+M+GEIGG+AEEEAA++++        KP
Sbjct: 176 TCIGIGGDPIPGMNQIDALKLFQEDPDTDAIIMIGEIGGTAEEEAAEYIQSN----VTKP 231

Query: 239 IVGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           +VG++AG TAP G+ MGHAGA+ISGGKG AE+K  A ++AGI    SPA +G +++E+L 
Sbjct: 232 VVGYIAGVTAPKGKRMGHAGAIISGGKGTAEEKFAAFEKAGIAYTRSPAELGTTMLEVLK 291

Query: 299 S 299
           +
Sbjct: 292 A 292


>gi|206579009|ref|YP_002239647.1| succinate-CoA ligase, alpha subunit [Klebsiella pneumoniae 342]
 gi|288936488|ref|YP_003440547.1| succinyl-CoA synthetase, subunit alpha [Klebsiella variicola At-22]
 gi|290510456|ref|ZP_06549826.1| succinyl-CoA ligase subunit alpha [Klebsiella sp. 1_1_55]
 gi|206568067|gb|ACI09843.1| succinate-CoA ligase, alpha subunit [Klebsiella pneumoniae 342]
 gi|288891197|gb|ADC59515.1| succinyl-CoA synthetase, alpha subunit [Klebsiella variicola At-22]
 gi|289777172|gb|EFD85170.1| succinyl-CoA ligase subunit alpha [Klebsiella sp. 1_1_55]
          Length = 289

 Score =  343 bits (881), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 171/298 (57%), Positives = 220/298 (73%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+TKV+ QG TG  GTFH+EQAI Y  TQ+VGG+ P KG T   G    +PVF 
Sbjct: 1   MSVLINKDTKVICQGFTGSQGTFHSEQAIAY-GTQMVGGVTPGKGGTTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T A A+VIYVP     D+I+E+I+A I LI+ ITEGIP LDM+ VK +L+++
Sbjct: 56  TVREAVEATGATATVIYVPAPFCKDSILEAIDAGIKLIITITEGIPTLDMLTVKVKLDEA 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TP  CKIGIMPG I + G VGI+SRSGTLTYEAV QT+  G GQST 
Sbjct: 116 GVRMIGPNCPGVITPGECKIGIMPGHIHKPGKVGIVSRSGTLTYEAVKQTTDYGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L+LF  D  TE+IVM+GEIGGSAEEEAA ++K+       KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILKLFQEDPQTEAIVMIGEIGGSAEEEAAAYIKEH----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           G++AG TAP G+ MGHAGA+I+GGKG A++K  A++ AG+    S A IG +L  ++ 
Sbjct: 232 GYIAGVTAPKGKRMGHAGAIIAGGKGTADEKFAALEAAGVKTVRSLADIGEALKAIIK 289


>gi|301055325|ref|YP_003793536.1| succinyl-CoA synthetase subunit alpha [Bacillus anthracis CI]
 gi|300377494|gb|ADK06398.1| succinyl-CoA synthetase alpha subunit [Bacillus cereus biovar
           anthracis str. CI]
          Length = 300

 Score =  343 bits (881), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 180/299 (60%), Positives = 231/299 (77%), Gaps = 9/299 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+LV+K+TKV+VQG+TG  G FHT+Q I Y  T++VGG+ P KG T   G    VPVF 
Sbjct: 1   MSVLVNKDTKVIVQGITGSQGLFHTKQMIEY-GTKIVGGVTPGKGGTDIEG----VPVFD 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV +A + T ANASV+YVPP+ A DAI+E+++AEI L+VCITEGIPVLDMV VK  +   
Sbjct: 56  TVEDAVKATGANASVVYVPPAFAADAIMEAVDAEIDLVVCITEGIPVLDMVNVKRYMAGK 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            +RL+GPNCPG++TPD CKIGIMPG I +KG VGI+SRSGTLTYEAV Q +QEG+GQSTA
Sbjct: 116 HTRLLGPNCPGVITPDECKIGIMPGYIHKKGHVGIVSRSGTLTYEAVHQLTQEGIGQSTA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPV GT+FID L++F  DE T +++M+GEIGG+AEEEAA+++K        KP+V
Sbjct: 176 VGIGGDPVNGTDFIDALKVFNEDEETHAVIMIGEIGGTAEEEAAEWVKANM----TKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
           GF+ G+TAP G+ MGHAGA+ISGGKG A +KI  M+  GI +A +PA +G +L+ +L  
Sbjct: 232 GFIGGQTAPAGKRMGHAGAIISGGKGTAAEKIKTMEACGIKVAETPAVMGETLISVLKE 290


>gi|268318044|ref|YP_003291763.1| succinyl-CoA synthetase, alpha subunit [Rhodothermus marinus DSM
           4252]
 gi|262335578|gb|ACY49375.1| succinyl-CoA synthetase, alpha subunit [Rhodothermus marinus DSM
           4252]
          Length = 292

 Score =  343 bits (881), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 171/300 (57%), Positives = 223/300 (74%), Gaps = 9/300 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSILVD+NT+++VQG+TGK GTFHT+Q I Y  T VV G+ P KG        ++ PVF 
Sbjct: 1   MSILVDRNTRLVVQGITGKEGTFHTQQMIEY-GTNVVAGVTPGKGGQKH----LDRPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TVAEA E+  AN S+I+VPP+ A DAI+E+ +A I +IVCITEGIPV DM+ V   +++ 
Sbjct: 56  TVAEAVEKEGANTSIIFVPPAFAADAILEAADAGIEVIVCITEGIPVRDMIPVYHYVKQK 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             +LIGPNCPG++TP   K+GIMPG IF++G +G++SRSGTLTYEAV Q ++ GLGQSTA
Sbjct: 116 GVKLIGPNCPGVITPGQAKVGIMPGMIFKEGPIGVVSRSGTLTYEAVDQLTRLGLGQSTA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G  F DVL LF  D  TE++V++GEIGG+AEEEAA F+K+       KP+ 
Sbjct: 176 VGIGGDPIIGLRFTDVLRLFQDDPETEAVVLIGEIGGTAEEEAAAFIKEHM----TKPVF 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGSL 300
            F+AG TAPPGR MGHAGA+I+GGKG AE+K  A++ AG  +  +PA IG ++ E LG+L
Sbjct: 232 AFIAGATAPPGRRMGHAGAIIAGGKGTAEEKFKALEAAGAVVIRNPALIGETVREHLGAL 291


>gi|312959848|ref|ZP_07774364.1| succinyl-CoA synthetase alpha [Pseudomonas fluorescens WH6]
 gi|311286014|gb|EFQ64579.1| succinyl-CoA synthetase alpha [Pseudomonas fluorescens WH6]
          Length = 293

 Score =  343 bits (881), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 169/298 (56%), Positives = 214/298 (71%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+TKV+ QG+TG  G+FHT+QAI Y  T++VGG+ P KG T   G    +PVF 
Sbjct: 1   MSVLINKDTKVICQGITGSQGSFHTQQAIEY-GTKMVGGVTPGKGGTEHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV +A   T A ASVIYVP     D+I+E+    I LIVCITEGIP LDM+  K + ++ 
Sbjct: 56  TVKDAVAATGATASVIYVPAPFCKDSILEAAFGGIKLIVCITEGIPTLDMLDAKVKCDEL 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
              LIGPNCPG++TP  CKIGIMPG I   G VGI+SRSGTLTYEAV QT+  G GQST 
Sbjct: 116 GVVLIGPNCPGVITPGECKIGIMPGHIHLPGKVGIVSRSGTLTYEAVKQTTDAGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L+LF  D  TE+IVM+GEIGGSAEEEAA ++K        KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILKLFQEDPKTEAIVMIGEIGGSAEEEAAAYIKAH----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            ++AG TAP G+ MGHAGA+ISGGKG A++K  A+++AG+    S A IG++L EL G
Sbjct: 232 SYIAGVTAPAGKRMGHAGAIISGGKGTADEKFAALQDAGVKTVRSLADIGKALAELTG 289


>gi|205352003|ref|YP_002225804.1| succinyl-CoA synthetase subunit alpha [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 287/91]
 gi|205271784|emb|CAR36618.1| succinyl-CoA synthetase alpha chain [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 287/91]
 gi|326627043|gb|EGE33386.1| succinyl-CoA synthetase subunit alpha [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 9]
          Length = 289

 Score =  343 bits (881), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 171/298 (57%), Positives = 219/298 (73%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+TKV+ QG TG  GTFH+EQ I Y  TQ+VGG+ P KG T   G    +PVF 
Sbjct: 1   MSVLINKDTKVICQGFTGSQGTFHSEQEIAY-GTQMVGGVTPGKGGTTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T A ASVIYVP     D+I+E+I+A I LI+ ITEGIP LDM+ VK +L+++
Sbjct: 56  TVREAVEATGATASVIYVPAPFCKDSILEAIDAGIKLIITITEGIPTLDMLTVKVKLDEA 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TP  CKIGIMPG I + G VGI+SRSGTLTYEAV QT+  G GQST 
Sbjct: 116 GVRMIGPNCPGVITPGECKIGIMPGHIHKPGKVGIVSRSGTLTYEAVKQTTDYGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L+LF  D  TE+IVM+GEIGGSAEEEAA ++K+       KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILKLFQEDPQTEAIVMIGEIGGSAEEEAAAYIKEH----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           G++AG TAP G+ MGHAGA+I+GGKG A++K  A++ AG+    S A IG +L  ++ 
Sbjct: 232 GYIAGVTAPKGKRMGHAGAIIAGGKGTADEKFAALEAAGVKTVRSLADIGEALKAIIK 289


>gi|161831593|ref|YP_001597237.1| succinate-CoA ligase (ADP-forming), alpha subunit [Coxiella
           burnetii RSA 331]
 gi|161763460|gb|ABX79102.1| succinate-CoA ligase (ADP-forming), alpha subunit [Coxiella
           burnetii RSA 331]
          Length = 294

 Score =  343 bits (881), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 175/299 (58%), Positives = 224/299 (74%), Gaps = 10/299 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL+DK T+VL QG TGK GTFH+EQAI Y  TQ+VGG+ P KG     G    +P+F 
Sbjct: 1   MSILIDKETRVLCQGFTGKQGTFHSEQAIEY-GTQMVGGVTPGKGGQSHLG----LPIFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           +V EA E T+A+A++I+VP     D+IIE+++A + L+VCITEGIPVLDM+ VKA L + 
Sbjct: 56  SVHEAVEETSADATMIFVPAPFCKDSIIEAVDAGVRLVVCITEGIPVLDMLEVKAYLRQH 115

Query: 121 S-SRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQST 179
              R+IGPNCPG++TP  CKIGIMPG I ++G VGI+SRSGTLTYEAV QT+Q G GQST
Sbjct: 116 PDVRMIGPNCPGVITPGECKIGIMPGHIHQRGKVGIVSRSGTLTYEAVNQTTQMGFGQST 175

Query: 180 AVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPI 239
            VGIGGDP+ GT FI VLE+F  D  T++IVMVGEIGG+AEEEAA+F++       KKP+
Sbjct: 176 CVGIGGDPIPGTSFIGVLEMFEKDSQTQAIVMVGEIGGTAEEEAAEFIQSN----VKKPV 231

Query: 240 VGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           + ++AG TAPPG+ MGHAGA+I+GGKG A DK  A++ AG+ +  SPA IG+ + E  G
Sbjct: 232 ISYIAGVTAPPGKRMGHAGAIIAGGKGTAADKYAALEAAGVFVVKSPAEIGKGVAEATG 290


>gi|329891083|ref|ZP_08269426.1| succinyl-CoA ligase ADP-forming subunit alpha [Brevundimonas
           diminuta ATCC 11568]
 gi|328846384|gb|EGF95948.1| succinyl-CoA ligase ADP-forming subunit alpha [Brevundimonas
           diminuta ATCC 11568]
          Length = 300

 Score =  343 bits (881), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 222/299 (74%), Positives = 267/299 (89%), Gaps = 1/299 (0%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVN-VPVF 59
           MSILV+K+TK+LVQGLTGK G FHTEQA+ Y  T++VGG+HP KG   WTG +   +P+F
Sbjct: 1   MSILVNKDTKILVQGLTGKTGGFHTEQALAYYNTKMVGGVHPTKGGQTWTGSHGETLPIF 60

Query: 60  TTVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEK 119
            +VAE KERT A+A+VIYVPP+GA DAIIE+I+AEIP I CITEGIPV DMVRVKARL++
Sbjct: 61  ASVAEGKERTGADATVIYVPPAGAADAIIEAIDAEIPFITCITEGIPVQDMVRVKARLDR 120

Query: 120 SSSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQST 179
           S+SRL+GPNCPG+LTP+ CKIGIMPG+IF+KG+VGI+SRSGTLTYEAVFQT+ EGLGQ+T
Sbjct: 121 SNSRLLGPNCPGVLTPEECKIGIMPGNIFKKGNVGIVSRSGTLTYEAVFQTTNEGLGQTT 180

Query: 180 AVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPI 239
           AVGIGGDPVKGTEFIDVLE+FLAD+ATESI+M+GEIGG+AEE+AAQFL DEAK+GRKKP+
Sbjct: 181 AVGIGGDPVKGTEFIDVLEMFLADDATESIIMIGEIGGAAEEDAAQFLIDEAKKGRKKPM 240

Query: 240 VGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            GF+AG+TAP GRTMGHAGAV+SGGKG AE KI AM+ AGI ++PSPAR+G +LVE+L 
Sbjct: 241 AGFIAGRTAPKGRTMGHAGAVVSGGKGDAESKIAAMEAAGIRVSPSPARLGATLVEVLK 299


>gi|146310887|ref|YP_001175961.1| succinyl-CoA synthetase subunit alpha [Enterobacter sp. 638]
 gi|145317763|gb|ABP59910.1| succinyl-CoA synthetase (ADP-forming) alpha subunit [Enterobacter
           sp. 638]
          Length = 289

 Score =  343 bits (881), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 174/298 (58%), Positives = 220/298 (73%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L+DKNTKV+ QG TG  GTFH+EQAI Y  TQ+VGG+ P KG T   G    +PVF 
Sbjct: 1   MSVLIDKNTKVICQGFTGSQGTFHSEQAIAY-GTQMVGGVTPGKGGTTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T A A+VIYVP     D+I+E+I+A I LI+ ITEGIP LDM+ VK +L+++
Sbjct: 56  TVREAVEATGATATVIYVPAPFCKDSILEAIDAGIKLIITITEGIPTLDMLTVKVKLDEA 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TP  CKIGIMPG I + G VGI+SRSGTLTYEAV QT+  G GQST 
Sbjct: 116 GVRMIGPNCPGVITPGECKIGIMPGHIHKPGKVGIVSRSGTLTYEAVKQTTDYGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L+LF  D  TE+IVM+GEIGGSAEEEAA ++KD       KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILKLFQEDPQTEAIVMIGEIGGSAEEEAAAYIKDH----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           G++AG TAP G+ MGHAGA+I+GGKG A++K  A++ AG+    S A IG +L  ++ 
Sbjct: 232 GYIAGVTAPKGKRMGHAGAIIAGGKGTADEKFAALEAAGVKTVRSLADIGDALKAIIK 289


>gi|90406990|ref|ZP_01215180.1| succinyl-CoA synthetase alpha subunit [Psychromonas sp. CNPT3]
 gi|90311861|gb|EAS39956.1| succinyl-CoA synthetase alpha subunit [Psychromonas sp. CNPT3]
          Length = 301

 Score =  343 bits (881), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 177/298 (59%), Positives = 221/298 (74%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL++K+TKV+ QG TG  GTFH+EQAI Y  TQ+VGG+ P KG     G    +PVF 
Sbjct: 1   MSILINKDTKVICQGFTGGQGTFHSEQAIDY-GTQMVGGVSPGKGGQTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA + T A A+VIYVP     DAI+E+I+A I LIV ITEG+P LDM+ VK +L+++
Sbjct: 56  TVREAIDATGATATVIYVPAPFCKDAILEAIDAGISLIVTITEGMPTLDMLEVKVKLDQA 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
              +IGPNCPG++TPD CKIGIMPG I +KG VGI+SRSGTLTYEAV QT+ EG GQST 
Sbjct: 116 GVVMIGPNCPGVITPDECKIGIMPGHIHKKGKVGIVSRSGTLTYEAVKQTTDEGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G  FID+L LF AD  TE+IVM+GEIGG+AEEEAA F+K        KP+V
Sbjct: 176 VGIGGDPIPGASFIDILALFEADPETEAIVMIGEIGGTAEEEAAAFIKQH----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            ++AG TAP G+ MGHAGA+I+GGKG AEDK  A+++AG+    S A IG++L E+ G
Sbjct: 232 SYIAGVTAPEGKRMGHAGAIIAGGKGTAEDKFRALEDAGVKTTKSLAEIGKALREVTG 289


>gi|219870878|ref|YP_002475253.1| succinyl-CoA synthetase alpha chain [Haemophilus parasuis SH0165]
 gi|219691082|gb|ACL32305.1| succinyl-CoA synthetase alpha chain [Haemophilus parasuis SH0165]
          Length = 290

 Score =  343 bits (881), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 177/299 (59%), Positives = 221/299 (73%), Gaps = 9/299 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL++K+TKV+ QG TG  GTFH++QA+ Y  TQ+VGG+ P KG T   G    +PVF 
Sbjct: 1   MSILINKDTKVICQGFTGGQGTFHSQQALDY-GTQLVGGVSPGKGGTTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T A A+VIYVP  G  DAI+E+I+A I L+VCITEGIP LDM++VK RL ++
Sbjct: 56  TVREAVEATGATATVIYVPAPGCKDAILEAIDAGIQLVVCITEGIPTLDMLQVKQRLNQT 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TPD CKIGIMPG I +KG +GI+SRSGTLTYEAV QT+  G GQST 
Sbjct: 116 GVRMIGPNCPGVITPDECKIGIMPGCIHKKGKIGIVSRSGTLTYEAVKQTTDYGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L LF AD  TE+IVM+GEIGGSAEEEAA F+K        KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILTLFQADPETEAIVMIGEIGGSAEEEAAAFIKAN----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
            ++AG TAP G+ MGHAGA+ISGGKG A++K  A++ AG+    S   IG +L  +L  
Sbjct: 232 SYIAGVTAPKGKRMGHAGAIISGGKGTADEKFAALEAAGVKTVRSLGDIGAALQAVLNK 290


>gi|30021923|ref|NP_833554.1| succinyl-CoA synthetase subunit alpha [Bacillus cereus ATCC 14579]
 gi|29897479|gb|AAP10755.1| Succinyl-CoA synthetase alpha chain [Bacillus cereus ATCC 14579]
          Length = 300

 Score =  343 bits (881), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 181/299 (60%), Positives = 230/299 (76%), Gaps = 9/299 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+LV+K+TKV+VQG+TG  G FHT+Q I Y  T++VGG+ P KG T   G    VPVF 
Sbjct: 1   MSVLVNKDTKVIVQGITGSQGLFHTKQMIEY-GTKIVGGVTPGKGGTDIEG----VPVFD 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV +A + T ANASV+YVPP+ A DAI+E+++AEI L+VCITEGIPVLDMV VK  +   
Sbjct: 56  TVEDAVKATGANASVVYVPPAFAADAIMEAVDAEIDLVVCITEGIPVLDMVNVKRYMAGK 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            +RL+GPNCPG++TPD CKIGIMPG I +KG VGILSRSGTLTYEAV Q +QEG+GQSTA
Sbjct: 116 HTRLLGPNCPGVITPDECKIGIMPGYIHKKGHVGILSRSGTLTYEAVHQLTQEGIGQSTA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPV GT+FID L+ F  DE T +++M+GEIGG+AEEEAA+++K        KP+V
Sbjct: 176 VGIGGDPVNGTDFIDALKAFNEDEETHAVIMIGEIGGTAEEEAAEWVKANM----TKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
           GF+ G+TAP G+ MGHAGA+ISGGKG A +KI  M+  GI +A +PA +G +L+ +L  
Sbjct: 232 GFIGGQTAPAGKRMGHAGAIISGGKGTAAEKIKTMEACGIKVAETPAVMGETLISVLKE 290


>gi|148252002|ref|YP_001236587.1| succinyl-CoA synthetase (ADP-forming) subunit alpha [Bradyrhizobium
           sp. BTAi1]
 gi|146404175|gb|ABQ32681.1| succinyl-CoA synthetase (ADP-forming) alpha subunit [Bradyrhizobium
           sp. BTAi1]
          Length = 294

 Score =  343 bits (881), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 216/299 (72%), Positives = 251/299 (83%), Gaps = 5/299 (1%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL+DKNTKV+ QG TGK GTFH+E AI Y  T++VGG  P KG +   G    +PVF 
Sbjct: 1   MSILIDKNTKVICQGFTGKNGTFHSEAAIAY-GTKMVGGTSPGKGGSTHLG----LPVFD 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA+E T A+ASVIYVPP GA DAI E+I+AE+PLIVCITEGIPVLDMVRVK  L+ S
Sbjct: 56  TVKEAREATGADASVIYVPPPGAADAICEAIDAEVPLIVCITEGIPVLDMVRVKRSLQGS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            SRLIGPNCPG++T   CKIGIMP +IF+ GSVGI+SRSGTLTYEAVFQT+ EGLGQ+TA
Sbjct: 116 KSRLIGPNCPGVMTAGECKIGIMPANIFKPGSVGIVSRSGTLTYEAVFQTTSEGLGQTTA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPVKGTEFID+LE+FLAD  TESI+M+GEIGGSAEE+AAQF+KDEAKRGRKKP+V
Sbjct: 176 VGIGGDPVKGTEFIDMLEMFLADPKTESIIMIGEIGGSAEEDAAQFIKDEAKRGRKKPMV 235

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
           GF+AG TAPPGR MGHAGA+ISGGKG A  K  AM+ AGI ++PSPAR+G++LVE L S
Sbjct: 236 GFIAGVTAPPGRRMGHAGAIISGGKGDAGSKTAAMEAAGITVSPSPARLGKTLVEKLKS 294


>gi|289209200|ref|YP_003461266.1| succinyl-CoA synthetase, subunit alpha [Thioalkalivibrio sp.
           K90mix]
 gi|288944831|gb|ADC72530.1| succinyl-CoA synthetase, alpha subunit [Thioalkalivibrio sp.
           K90mix]
          Length = 291

 Score =  343 bits (881), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 170/298 (57%), Positives = 222/298 (74%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSILVD++TKV+ QG TGK G+FH+EQAI Y  T++VGG+ P KG        ++ PVF 
Sbjct: 1   MSILVDRDTKVICQGFTGKQGSFHSEQAIAY-GTRLVGGVTPGKGGQTH----LDRPVFD 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TVA+A  +T A  S+IYVP   A DAI E+ +A I L VCITEGIPV DM+RVK  L  S
Sbjct: 56  TVADAVAQTGATVSMIYVPAPFAADAICEAADAGIELAVCITEGIPVQDMIRVKQVLAGS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
           S+RLIGPNCPGI+TPD+CK+GIMPG I ++G +GI+SRSGTLTYEAV QTS  GLGQST 
Sbjct: 116 STRLIGPNCPGIITPDACKVGIMPGYIHQRGRIGIISRSGTLTYEAVKQTSDRGLGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           +GIGGDP++G +F+D L LF  D  T+ +++VGEIGG AEE AA+++++E      KP+ 
Sbjct: 176 IGIGGDPIQGLDFVDCLRLFRDDPETDGVLLVGEIGGDAEERAARYIENE----FDKPVA 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            ++AG TAPPGR MGHAGA+I+GG+G AE K+ A++ AG  +A SPA +G+++   L 
Sbjct: 232 AYIAGATAPPGRRMGHAGAIIAGGQGTAEQKMAALRAAGASVAESPAELGQAMQSALD 289


>gi|229589341|ref|YP_002871460.1| succinyl-CoA synthetase subunit alpha [Pseudomonas fluorescens
           SBW25]
 gi|229361207|emb|CAY48071.1| succinyl-CoA synthetase alpha chain [Pseudomonas fluorescens SBW25]
          Length = 293

 Score =  343 bits (881), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 169/298 (56%), Positives = 214/298 (71%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+TKV+ QG+TG  G+FHT+QAI Y  T++VGG+ P KG T   G    +PVF 
Sbjct: 1   MSVLINKDTKVICQGITGSQGSFHTQQAIEY-GTKMVGGVTPGKGGTEHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV +A   T A ASVIYVP     D+I+E+    I LIVCITEGIP LDM+  K + ++ 
Sbjct: 56  TVKDAVAATGATASVIYVPAPFCKDSILEAAFGGIKLIVCITEGIPTLDMLDAKVKCDEL 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
              LIGPNCPG++TP  CKIGIMPG I   G VGI+SRSGTLTYEAV QT+  G GQST 
Sbjct: 116 GVILIGPNCPGVITPGECKIGIMPGHIHLPGKVGIVSRSGTLTYEAVKQTTDAGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L+LF  D  TE+IVM+GEIGGSAEEEAA ++K        KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILKLFQEDPKTEAIVMIGEIGGSAEEEAAAYIKAH----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            ++AG TAP G+ MGHAGA+ISGGKG A++K  A+++AG+    S A IG++L EL G
Sbjct: 232 SYIAGVTAPAGKRMGHAGAIISGGKGTADEKFAALEDAGVKTVRSLADIGKALSELTG 289


>gi|292487656|ref|YP_003530529.1| succinyl-CoA synthetase subunit alpha [Erwinia amylovora CFBP1430]
 gi|292898893|ref|YP_003538262.1| succinyl-CoA ligase [ADP-forming] subunit alpha [Erwinia amylovora
           ATCC 49946]
 gi|291198741|emb|CBJ45850.1| succinyl-CoA ligase [ADP-forming] subunit alpha [Erwinia amylovora
           ATCC 49946]
 gi|291553076|emb|CBA20121.1| succinyl-CoA synthetase alpha chain [Erwinia amylovora CFBP1430]
 gi|312171764|emb|CBX80022.1| succinyl-CoA synthetase alpha chain [Erwinia amylovora ATCC
           BAA-2158]
          Length = 290

 Score =  343 bits (881), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 174/297 (58%), Positives = 220/297 (74%), Gaps = 9/297 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL+DKNTKV+ QG TG  GTFH+EQA+ Y  TQ+VGG+ P KG +   G    +PVF 
Sbjct: 1   MSILIDKNTKVICQGFTGGQGTFHSEQALAY-GTQLVGGVTPGKGGSEHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T A ASVIYVP     D I+E+IEA I LI+ ITEGIP LDM+ VK +L+++
Sbjct: 56  TVREAVEATGATASVIYVPAPFCKDGILEAIEAGIKLIITITEGIPTLDMLTVKVKLDEA 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TP +CKIGIMPG I + G +GI+SRSGTLTYEAV QT+  G GQST 
Sbjct: 116 GVRMIGPNCPGVITPGACKIGIMPGHIHQPGRIGIVSRSGTLTYEAVKQTTDIGYGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L+LF  D  TE+IVM+GEIGGSAEEEAA F+K+       KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILKLFQDDPQTEAIVMIGEIGGSAEEEAAAFIKEY----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELL 297
           G++AG TAP G+ MGHAGA+I+GGKG A++K  A++ AG+    S A IG ++  +L
Sbjct: 232 GYIAGVTAPKGKRMGHAGAIIAGGKGTADEKFAALEAAGVKTVRSLADIGDAVKAVL 288


>gi|254283561|ref|ZP_04958529.1| succinyl-CoA ligase, alpha subunit [gamma proteobacterium NOR51-B]
 gi|219679764|gb|EED36113.1| succinyl-CoA ligase, alpha subunit [gamma proteobacterium NOR51-B]
          Length = 290

 Score =  343 bits (881), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 171/298 (57%), Positives = 214/298 (71%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL++  TKV+ QG TG  GTFH+EQAI Y  T++VGG+ P KG     G    +PVF 
Sbjct: 1   MSILINSETKVICQGFTGSQGTFHSEQAIAY-GTKMVGGVTPGKGGQEHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV +A E T A ASVIYVP     D+I+E+  A + LIVCITEGIP LDM+  K + ++ 
Sbjct: 56  TVVDAVEATGAQASVIYVPAPFCKDSILEAANAGLELIVCITEGIPTLDMLEAKVKCDEL 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             RLIGPNCPG++TP  CKIGIMPG I + G VGI+SRSGTLTYEAV QT+  G GQST 
Sbjct: 116 GVRLIGPNCPGVITPGECKIGIMPGHIHQPGKVGIVSRSGTLTYEAVKQTTDAGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+LELF  D ATE+IVM+GEIGG+AEEEAA ++K        KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILELFEKDPATEAIVMIGEIGGTAEEEAAAYIKAN----VSKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            ++AG TAP G+ MGHAGA+ISGGKG A++K  A+++AG+    S A IG +L E+ G
Sbjct: 232 SYIAGVTAPKGKRMGHAGAIISGGKGTADEKFAALEDAGVKTVRSLAEIGSALSEITG 289


>gi|59801308|ref|YP_208020.1| succinyl-CoA synthetase subunit alpha [Neisseria gonorrhoeae FA
           1090]
 gi|240014233|ref|ZP_04721146.1| succinyl-CoA synthetase subunit alpha [Neisseria gonorrhoeae DGI18]
 gi|240016669|ref|ZP_04723209.1| succinyl-CoA synthetase subunit alpha [Neisseria gonorrhoeae
           FA6140]
 gi|240080858|ref|ZP_04725401.1| succinyl-CoA synthetase subunit alpha [Neisseria gonorrhoeae FA19]
 gi|240115529|ref|ZP_04729591.1| succinyl-CoA synthetase subunit alpha [Neisseria gonorrhoeae PID18]
 gi|240117824|ref|ZP_04731886.1| succinyl-CoA synthetase subunit alpha [Neisseria gonorrhoeae PID1]
 gi|240121796|ref|ZP_04734758.1| succinyl-CoA synthetase subunit alpha [Neisseria gonorrhoeae
           PID24-1]
 gi|240123379|ref|ZP_04736335.1| succinyl-CoA synthetase subunit alpha [Neisseria gonorrhoeae
           PID332]
 gi|240125627|ref|ZP_04738513.1| succinyl-CoA synthetase subunit alpha [Neisseria gonorrhoeae
           SK-92-679]
 gi|260440660|ref|ZP_05794476.1| succinyl-CoA synthetase subunit alpha [Neisseria gonorrhoeae DGI2]
 gi|268596975|ref|ZP_06131142.1| succinyl-CoA synthetase subunit alpha [Neisseria gonorrhoeae FA19]
 gi|268601204|ref|ZP_06135371.1| succinyl-CoA synthetase alpha subunit [Neisseria gonorrhoeae PID18]
 gi|268603524|ref|ZP_06137691.1| succinyl-CoA synthetase alpha subunit [Neisseria gonorrhoeae PID1]
 gi|268682004|ref|ZP_06148866.1| succinyl-CoA synthetase alpha subunit [Neisseria gonorrhoeae
           PID332]
 gi|268684216|ref|ZP_06151078.1| succinyl-CoA synthetase alpha subunit [Neisseria gonorrhoeae
           SK-92-679]
 gi|291043968|ref|ZP_06569684.1| succinyl-CoA synthetase subunit alpha [Neisseria gonorrhoeae DGI2]
 gi|293399168|ref|ZP_06643333.1| succinyl-CoA ligase subunit alpha [Neisseria gonorrhoeae F62]
 gi|59718203|gb|AAW89608.1| putative succinyl-CoA synthetase alpha subunit [Neisseria
           gonorrhoeae FA 1090]
 gi|268550763|gb|EEZ45782.1| succinyl-CoA synthetase subunit alpha [Neisseria gonorrhoeae FA19]
 gi|268585335|gb|EEZ50011.1| succinyl-CoA synthetase alpha subunit [Neisseria gonorrhoeae PID18]
 gi|268587655|gb|EEZ52331.1| succinyl-CoA synthetase alpha subunit [Neisseria gonorrhoeae PID1]
 gi|268622288|gb|EEZ54688.1| succinyl-CoA synthetase alpha subunit [Neisseria gonorrhoeae
           PID332]
 gi|268624500|gb|EEZ56900.1| succinyl-CoA synthetase alpha subunit [Neisseria gonorrhoeae
           SK-92-679]
 gi|291012431|gb|EFE04420.1| succinyl-CoA synthetase subunit alpha [Neisseria gonorrhoeae DGI2]
 gi|291610582|gb|EFF39692.1| succinyl-CoA ligase subunit alpha [Neisseria gonorrhoeae F62]
          Length = 296

 Score =  343 bits (881), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 163/301 (54%), Positives = 222/301 (73%), Gaps = 11/301 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+TKVLVQG TGK GTFH+EQA+ Y  T+VVGG+ P KG        +++PVF 
Sbjct: 1   MSVLINKDTKVLVQGFTGKNGTFHSEQALAY-GTKVVGGVTPGKGGQTH----LDLPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARL--E 118
           T+ EA + T A+ASVIYVP     D+I+E++++ + L+V ITEG+P LDM++ K  L   
Sbjct: 56  TMKEAVKETGADASVIYVPAPFVLDSIVEAVDSGVGLVVVITEGVPTLDMLKAKRYLETN 115

Query: 119 KSSSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQS 178
            + +RL+GPNCPG++TP  CKIGIMPG I   G +GI+SRSGTLTYEAV QT+  GLGQS
Sbjct: 116 GNGTRLVGPNCPGVITPGECKIGIMPGHIHTPGRIGIISRSGTLTYEAVAQTTNLGLGQS 175

Query: 179 TAVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKP 238
           T +GIGGDP+ G   ID L+LF  D  T++I+M+GEIGG+AEEEAA++++        KP
Sbjct: 176 TCIGIGGDPIPGMNQIDALKLFQEDPDTDAIIMIGEIGGTAEEEAAEYIQSN----VTKP 231

Query: 239 IVGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           +VG++AG TAP G+ MGHAGA+ISGGKG AE+K  A ++AGI    SPA +G +++E+L 
Sbjct: 232 VVGYIAGVTAPKGKRMGHAGAIISGGKGTAEEKFAAFEKAGIAYTRSPAELGTTMLEVLK 291

Query: 299 S 299
           +
Sbjct: 292 A 292


>gi|298369258|ref|ZP_06980576.1| succinate-CoA ligase, alpha subunit [Neisseria sp. oral taxon 014
           str. F0314]
 gi|298283261|gb|EFI24748.1| succinate-CoA ligase, alpha subunit [Neisseria sp. oral taxon 014
           str. F0314]
          Length = 296

 Score =  343 bits (881), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 164/301 (54%), Positives = 223/301 (74%), Gaps = 11/301 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+TKVLVQG TGK GTFH+EQA+ Y  T+VVGG+ P KG        +N+PVF 
Sbjct: 1   MSVLINKDTKVLVQGFTGKNGTFHSEQALAY-GTKVVGGVTPGKGGQTH----LNLPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARL--E 118
           T+ EA + T A+ASVIYVP     D+I+E++++ + L+V ITEG+P LDM++ K  L   
Sbjct: 56  TMKEAVKETGADASVIYVPAPFVLDSIVEAVDSGVGLVVVITEGVPTLDMLKAKRYLETN 115

Query: 119 KSSSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQS 178
            + +RL+GPNCPG++TP  CKIGIMPG I   G +GI+SRSGTLTYEAV QT++ GLGQS
Sbjct: 116 GNGTRLVGPNCPGVITPGECKIGIMPGHIHTPGRIGIISRSGTLTYEAVAQTTKLGLGQS 175

Query: 179 TAVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKP 238
           T +GIGGDP+ G   ID L+LF  D  T++I+M+GEIGG+AEEEAA++++        KP
Sbjct: 176 TCIGIGGDPIPGMNQIDALKLFQEDPDTDAIIMIGEIGGTAEEEAAEYIQSN----VTKP 231

Query: 239 IVGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           +VG++AG TAP G+ MGHAGA+ISGGKG AE+K  A ++AGI    SPA +G +++E+L 
Sbjct: 232 VVGYIAGVTAPKGKRMGHAGAIISGGKGTAEEKFAAFEKAGIAYTRSPAELGSTILEVLK 291

Query: 299 S 299
           +
Sbjct: 292 A 292


>gi|194098454|ref|YP_002001513.1| succinyl-CoA synthetase subunit alpha [Neisseria gonorrhoeae
           NCCP11945]
 gi|239998852|ref|ZP_04718776.1| succinyl-CoA synthetase subunit alpha [Neisseria gonorrhoeae 35/02]
 gi|240128083|ref|ZP_04740744.1| succinyl-CoA synthetase subunit alpha [Neisseria gonorrhoeae
           SK-93-1035]
 gi|241760343|ref|ZP_04758438.1| succinate-CoA ligase, alpha subunit family [Neisseria flavescens
           SK114]
 gi|268594695|ref|ZP_06128862.1| succinyl-CoA synthetase subunit alpha [Neisseria gonorrhoeae 35/02]
 gi|268686472|ref|ZP_06153334.1| succinyl-CoA synthetase alpha subunit [Neisseria gonorrhoeae
           SK-93-1035]
 gi|193933744|gb|ACF29568.1| succinyl-CoA synthetase alpha subunit [Neisseria gonorrhoeae
           NCCP11945]
 gi|241319221|gb|EER55699.1| succinate-CoA ligase, alpha subunit family [Neisseria flavescens
           SK114]
 gi|268548084|gb|EEZ43502.1| succinyl-CoA synthetase subunit alpha [Neisseria gonorrhoeae 35/02]
 gi|268626756|gb|EEZ59156.1| succinyl-CoA synthetase alpha subunit [Neisseria gonorrhoeae
           SK-93-1035]
 gi|317164140|gb|ADV07681.1| succinyl-CoA synthetase subunit alpha [Neisseria gonorrhoeae
           TCDC-NG08107]
          Length = 296

 Score =  343 bits (881), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 163/301 (54%), Positives = 223/301 (74%), Gaps = 11/301 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+TKVLVQG TGK GTFH+EQA+ Y  T+VVGG+ P KG        +++PVF 
Sbjct: 1   MSVLINKDTKVLVQGFTGKNGTFHSEQALAY-GTKVVGGVTPGKGGQTH----LDLPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARL--E 118
           T+ EA + T A+ASVIYVP     D+I+E++++ + L+V ITEG+P LDM++ K  L   
Sbjct: 56  TMKEAVKETGADASVIYVPAPFVLDSIVEAVDSGVGLVVVITEGVPTLDMLKAKRYLETN 115

Query: 119 KSSSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQS 178
            + +RL+GPNCPG++TP  CKIGIMPG I   G +GI+SRSGTLTYEAV QT++ GLGQS
Sbjct: 116 GNGTRLVGPNCPGVITPGECKIGIMPGHIHTPGRIGIISRSGTLTYEAVAQTTKLGLGQS 175

Query: 179 TAVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKP 238
           T +GIGGDP+ G   ID L+LF  D  T++I+M+GEIGG+AEEEAA++++        KP
Sbjct: 176 TCIGIGGDPIPGMNQIDALKLFQEDPDTDAIIMIGEIGGTAEEEAAEYIQSN----VTKP 231

Query: 239 IVGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           +VG++AG TAP G+ MGHAGA+ISGGKG AE+K  A ++AGI    SPA +G +++E+L 
Sbjct: 232 VVGYIAGVTAPKGKRMGHAGAIISGGKGTAEEKFAAFEKAGIAYTRSPAELGTTMLEVLK 291

Query: 299 S 299
           +
Sbjct: 292 A 292


>gi|218768043|ref|YP_002342555.1| succinyl-CoA synthetase subunit alpha [Neisseria meningitidis
           Z2491]
 gi|121052051|emb|CAM08360.1| putative succinyl-CoA synthetase alpha subunit [Neisseria
           meningitidis Z2491]
          Length = 296

 Score =  343 bits (881), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 163/300 (54%), Positives = 222/300 (74%), Gaps = 11/300 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+TKVLVQG TGK GTFH+EQA+ Y  T+VVGG+ P KG        +++PVF 
Sbjct: 1   MSVLINKDTKVLVQGFTGKNGTFHSEQALAY-GTKVVGGVTPGKGGQTH----LDLPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARL--E 118
           T+ EA + T A+ASVIYVP     D+I+E++++ + L+V ITEG+P LDM++ K  L   
Sbjct: 56  TMKEAVKETGADASVIYVPAPFVLDSIVEAVDSGVGLVVVITEGVPTLDMLKAKRYLETN 115

Query: 119 KSSSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQS 178
            + +RL+GPNCPG++TP  CKIGIMPG I   G +GI+SRSGTLTYEAV QT++ GLGQS
Sbjct: 116 GNGTRLVGPNCPGVITPGECKIGIMPGHIHTPGRIGIISRSGTLTYEAVAQTTKLGLGQS 175

Query: 179 TAVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKP 238
           T +GIGGDP+ G   ID L+LF  D  T++I+M+GEIGG+AEEEAA++++        KP
Sbjct: 176 TCIGIGGDPIPGMNQIDALKLFQEDPDTDAIIMIGEIGGTAEEEAAEYIQSN----VSKP 231

Query: 239 IVGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           +VG++AG TAP G+ MGHAGA+ISGGKG AE+K  A ++AGI    SPA +G +++E+L 
Sbjct: 232 VVGYIAGVTAPKGKRMGHAGAIISGGKGTAEEKFAAFEKAGIAYTRSPAELGTTMLEVLK 291


>gi|225850686|ref|YP_002730920.1| succinate-CoA ligase, alpha subunit subfamily [Persephonella marina
           EX-H1]
 gi|225646629|gb|ACO04815.1| succinate-CoA ligase, alpha subunit subfamily [Persephonella marina
           EX-H1]
          Length = 292

 Score =  343 bits (881), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 167/301 (55%), Positives = 220/301 (73%), Gaps = 11/301 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+LVDKNTKV+VQG+TG+ G+FH  Q   Y  TQVVGG+ P KG     G    +PVF 
Sbjct: 1   MSVLVDKNTKVIVQGITGREGSFHATQCKAY-GTQVVGGVTPGKGGQEVEG----IPVFD 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           +V EA + T A+ S+I+VPP  A DAI+E+++A I  ++CITEGIPV DM+ VK  ++  
Sbjct: 56  SVKEAVDNTGADCSLIFVPPPFAADAILEAVDAGIKTVICITEGIPVNDMIPVKNYIKTY 115

Query: 121 --SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQS 178
              + LIGPNCPG++TP+  KIGIMPG IF++G+VGI+SRSGTLTYEA FQ S +G+GQS
Sbjct: 116 YPDTVLIGPNCPGVITPEEAKIGIMPGHIFKRGNVGIVSRSGTLTYEAAFQLSNKGIGQS 175

Query: 179 TAVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKP 238
           T +GIGGDPV GT F DVL+ F  D  TE+IVM+GEIGG+AEEEAA+F+K+       KP
Sbjct: 176 TVIGIGGDPVPGTVFSDVLKWFQDDPETEAIVMIGEIGGTAEEEAAEFIKEY----VTKP 231

Query: 239 IVGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           +V ++AG TAPPG+ MGHAGA+I+GGKG A++K  A++ AG     + + IG  + E+LG
Sbjct: 232 VVAYIAGVTAPPGKRMGHAGAIIAGGKGTADEKYRALEAAGATTVKNISTIGDVVAEVLG 291

Query: 299 S 299
            
Sbjct: 292 K 292


>gi|253990445|ref|YP_003041801.1| succinyl-CoA synthetase subunit alpha [Photorhabdus asymbiotica
           subsp. asymbiotica ATCC 43949]
 gi|211638988|emb|CAR67603.1| succinyl-coa synthetase, alpha subunit (ec 6.2.1.4) [Photorhabdus
           asymbiotica subsp. asymbiotica ATCC 43949]
 gi|253781895|emb|CAQ85059.1| succinyl-CoA synthetase, alpha subunit [Photorhabdus asymbiotica]
          Length = 291

 Score =  343 bits (881), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 176/298 (59%), Positives = 221/298 (74%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL+DKNTKV+ QG TG  GTFH+EQAI Y  TQ+VGG+ P KG T   G    +PVF 
Sbjct: 1   MSILIDKNTKVICQGFTGSQGTFHSEQAIAY-GTQMVGGVTPGKGGTEHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T A ASVIYVP     D+I+E+I+A I LI+ ITEGIP LDM+ VK +L+++
Sbjct: 56  TVREAVEATGATASVIYVPAPFCKDSILEAIDAGIKLIITITEGIPTLDMLAVKVKLDEA 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TPD CKIGIMPG I + G VGI+SRSGTLTYEAV QT+  GLGQST 
Sbjct: 116 GVRMIGPNCPGVITPDECKIGIMPGHIHQAGKVGIVSRSGTLTYEAVKQTTDAGLGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L+LF  D  TE+IVM+GEIGG+AEEEAA ++K        KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILKLFQEDPQTEAIVMIGEIGGTAEEEAAAYIKQ----QVTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            ++AG TAP G+ MGHAGA+I+GGKG A++K  A++ AG+    S A IG ++ +LL 
Sbjct: 232 AYIAGVTAPKGKRMGHAGAIIAGGKGTADEKFAALEAAGVKTVRSLADIGDAVKDLLA 289


>gi|113461099|ref|YP_719167.1| succinyl-CoA synthetase (ADP-forming) subunit alpha [Haemophilus
           somnus 129PT]
 gi|112823142|gb|ABI25231.1| succinyl-CoA synthetase (ADP-forming) alpha subunit [Haemophilus
           somnus 129PT]
          Length = 290

 Score =  343 bits (881), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 173/297 (58%), Positives = 221/297 (74%), Gaps = 9/297 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           M+IL++KNTKV+ QG TGK GTFH EQA+ Y  TQ+VGG+ P K  +   G    +PVF 
Sbjct: 1   MAILINKNTKVICQGFTGKQGTFHCEQALAY-GTQLVGGVSPGKSGSLHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV E  E+T A A++IYVP     DAI+E+I+  I  IVCITEGIP LDM+ VK +L++S
Sbjct: 56  TVREVVEKTGATATMIYVPAPFCKDAILEAIDGGIKFIVCITEGIPTLDMLEVKKKLQQS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
              +IGPNCPG++TP+ CK+GIMPG+I +KG +GI+SRSGTLTYEAV QT+ EG GQST 
Sbjct: 116 DVVMIGPNCPGVITPEECKMGIMPGNIHKKGRIGIVSRSGTLTYEAVKQTTDEGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L+LF AD  T++IVM+GEIGGSAEEEAA F+         KP+V
Sbjct: 176 VGIGGDPIPGSSFIDILKLFQADPETDAIVMIGEIGGSAEEEAADFIHKH----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELL 297
            ++AG TAP G+ MGHAGA+ISGGKG AE+KI A+++AG+    S A IG+ L  LL
Sbjct: 232 AYIAGVTAPKGKRMGHAGAIISGGKGTAEEKIVALEKAGVKTVRSLADIGKVLRTLL 288


>gi|304387735|ref|ZP_07369915.1| succinyl-CoA synthetase subunit alpha [Neisseria meningitidis ATCC
           13091]
 gi|304338211|gb|EFM04341.1| succinyl-CoA synthetase subunit alpha [Neisseria meningitidis ATCC
           13091]
          Length = 296

 Score =  343 bits (881), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 163/300 (54%), Positives = 222/300 (74%), Gaps = 11/300 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+TKVLVQG TGK GTFH+EQA+ Y  T+VVGG+ P KG        +++PVF 
Sbjct: 1   MSVLINKDTKVLVQGFTGKNGTFHSEQALAY-GTKVVGGVTPGKGGQTH----LDLPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARL--E 118
           T+ EA + T A+ASVIYVP     D+I+E++++ + L+V ITEG+P LDM++ K  L   
Sbjct: 56  TMKEAVKETGADASVIYVPAPFVLDSIVEAVDSGVGLVVVITEGVPTLDMLKAKRYLETN 115

Query: 119 KSSSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQS 178
            + +RL+GPNCPG++TP  CKIGIMPG I   G +GI+SRSGTLTYEAV QT++ GLGQS
Sbjct: 116 GNGTRLVGPNCPGVITPGECKIGIMPGHIHTPGRIGIISRSGTLTYEAVAQTTKLGLGQS 175

Query: 179 TAVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKP 238
           T +GIGGDP+ G   ID L+LF  D  T++I+M+GEIGG+AEEEAA++++        KP
Sbjct: 176 TCIGIGGDPIPGMNQIDALKLFQEDPDTDAIIMIGEIGGTAEEEAAEYIQSN----VTKP 231

Query: 239 IVGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           +VG++AG TAP G+ MGHAGA+ISGGKG AE+K  A ++AGI    SPA +G +++E+L 
Sbjct: 232 VVGYIAGVTAPKGKRMGHAGAIISGGKGTAEEKFAAFEKAGIAYTRSPAELGTTMLEVLK 291


>gi|261377714|ref|ZP_05982287.1| succinyl-CoA synthetase subunit alpha [Neisseria cinerea ATCC
           14685]
 gi|269145989|gb|EEZ72407.1| succinyl-CoA synthetase subunit alpha [Neisseria cinerea ATCC
           14685]
          Length = 296

 Score =  343 bits (880), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 164/301 (54%), Positives = 223/301 (74%), Gaps = 11/301 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+TKVLVQG TGK GTFH+EQA+ Y  T+VVGG+ P KG        +N+PVF 
Sbjct: 1   MSVLINKDTKVLVQGFTGKNGTFHSEQALAY-GTKVVGGVTPGKGGQTH----LNLPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARL--E 118
           T+ EA + T A+ASVIYVP     D+I+E++++ + L+V ITEG+P LDM++ K  L   
Sbjct: 56  TMKEAVKETGADASVIYVPAPFVLDSIVEAVDSGVGLVVVITEGVPTLDMLKAKRYLETN 115

Query: 119 KSSSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQS 178
            + +RL+GPNCPG++TP  CKIGIMPG I   G +GI+SRSGTLTYEAV QT++ GLGQS
Sbjct: 116 GNGTRLVGPNCPGVITPGECKIGIMPGHIHTPGRIGIISRSGTLTYEAVAQTTKLGLGQS 175

Query: 179 TAVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKP 238
           T +GIGGDP+ G   ID L+LF  D  T++I+M+GEIGG+AEEEAA++++        KP
Sbjct: 176 TCIGIGGDPIPGMNQIDALKLFQEDPDTDAIIMIGEIGGTAEEEAAEYIQSN----VTKP 231

Query: 239 IVGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           +VG++AG TAP G+ MGHAGA+ISGGKG AE+K  A ++AGI    SPA +G +++E+L 
Sbjct: 232 VVGYIAGVTAPKGKRMGHAGAIISGGKGTAEEKFAAFEKAGIAYTRSPAELGTTMLEVLK 291

Query: 299 S 299
           +
Sbjct: 292 A 292


>gi|168026667|ref|XP_001765853.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162683030|gb|EDQ69444.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 324

 Score =  343 bits (880), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 184/299 (61%), Positives = 232/299 (77%), Gaps = 9/299 (3%)

Query: 2   SILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFTT 61
           ++ VDK T+V+ QG+TGK GTFHTEQAI Y  T +VGG+ PKKG T   G    +PVF T
Sbjct: 30  AVFVDKTTRVICQGITGKNGTFHTEQAIDY-GTNMVGGVTPKKGGTEHLG----LPVFNT 84

Query: 62  VAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARL-EKS 120
           VAEAK+ T ANASVIYVP S A +AI+E+++AE+ L+VCITEGIP  DMV+VK+ L ++S
Sbjct: 85  VAEAKKETKANASVIYVPASLAANAILEALDAELDLVVCITEGIPQHDMVKVKSALLQQS 144

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            +RLIGPNCPGI+ P  CKIGIMPG I + G +GI+SRSGTLTYEAVFQT+  GLGQST 
Sbjct: 145 KTRLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTC 204

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP  GT F+D LE F+ D  TE IV++GEIGGSAEE+AA F+++    G +KP+V
Sbjct: 205 VGIGGDPFNGTNFVDCLEKFVDDPQTEGIVLIGEIGGSAEEDAAAFIRE---SGTQKPVV 261

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
            F+AG TAPPGR MGHAGA+ISGGKG A DKINA++ AG+ +  SPA+IG +++++   
Sbjct: 262 SFIAGLTAPPGRRMGHAGAIISGGKGTATDKINALRAAGVTVCESPAQIGATMLKVFEE 320


>gi|88703458|ref|ZP_01101174.1| Succinyl-CoA synthetase alpha chain [Congregibacter litoralis KT71]
 gi|88702172|gb|EAQ99275.1| Succinyl-CoA synthetase alpha chain [Congregibacter litoralis KT71]
          Length = 290

 Score =  343 bits (880), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 170/298 (57%), Positives = 213/298 (71%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL++K+TKV+ QG TG  GTFH+EQAI Y  T++VGG+ P KG     G    +PVF 
Sbjct: 1   MSILINKDTKVICQGFTGSQGTFHSEQAIEY-GTKMVGGVTPGKGGQEHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV+EA   T A ASVIYVP     D+I+E+    I L+VCITEGIP LDM+  K + ++ 
Sbjct: 56  TVSEAVAATGAEASVIYVPAPFCKDSILEAANGGIKLVVCITEGIPTLDMLEAKVKCDEL 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             RL+GPNCPG++TP  CKIGIMPG I   G VGI+SRSGTLTYEAV QTS  G GQST 
Sbjct: 116 GVRLVGPNCPGVITPGECKIGIMPGHIHLPGKVGIVSRSGTLTYEAVKQTSDAGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L +F AD ATE+IVM+GEIGG+AEEEAA ++K        KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILAMFEADPATEAIVMIGEIGGTAEEEAAAYIKAN----VSKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            ++AG TAP G+ MGHAGA+ISGGKG A++K  A+++AG+    S A IG  L E+ G
Sbjct: 232 SYIAGVTAPKGKRMGHAGAIISGGKGTADEKFAALEDAGVKTVRSLADIGSGLSEITG 289


>gi|121634761|ref|YP_975006.1| succinyl-CoA synthetase subunit alpha [Neisseria meningitidis
           FAM18]
 gi|120866467|emb|CAM10213.1| putative succinyl-CoA synthetase alpha subunit [Neisseria
           meningitidis FAM18]
          Length = 296

 Score =  343 bits (880), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 165/300 (55%), Positives = 223/300 (74%), Gaps = 11/300 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+TKVLVQG TGK GTFH+EQA+ Y  T+VVGG+ P KG        +N+PVF 
Sbjct: 1   MSVLINKDTKVLVQGFTGKNGTFHSEQALAY-GTKVVGGVTPGKGGQTH----LNLPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARL--E 118
           T+ EA + T A+ASVIYVP     D+I+E++++ + L+V ITEG+P LDM++ K  L   
Sbjct: 56  TMKEAVKETGADASVIYVPAPFVLDSIVEAVDSGVGLVVVITEGVPTLDMLKAKRYLETN 115

Query: 119 KSSSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQS 178
            + +RL+GPNCPG++TPD CKIGIMPG I   G +GI+SRSGTLTYEAV QT++ GLGQS
Sbjct: 116 GNGTRLVGPNCPGVITPDECKIGIMPGHIHTPGRIGIISRSGTLTYEAVAQTTKLGLGQS 175

Query: 179 TAVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKP 238
           T +GIGGDP+ G   ID L+LF  D  T++I+M+GEIGG+AEEEAA++++        KP
Sbjct: 176 TCIGIGGDPIPGMNQIDALKLFQEDPDTDAIIMIGEIGGTAEEEAAEYIQSN----VTKP 231

Query: 239 IVGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           +VG++AG TAP G+ MGHAGA+ISGGKG AE+K  A ++AGI    SPA +G +++E+L 
Sbjct: 232 VVGYIAGVTAPKGKRMGHAGAIISGGKGTAEEKFAAFEKAGIAYTRSPAELGTTMLEVLK 291


>gi|52080212|ref|YP_079003.1| succinyl-CoA synthetase subunit alpha [Bacillus licheniformis ATCC
           14580]
 gi|52785589|ref|YP_091418.1| succinyl-CoA synthetase subunit alpha [Bacillus licheniformis ATCC
           14580]
 gi|319646009|ref|ZP_08000239.1| succinyl-CoA ligase subunit alpha [Bacillus sp. BT1B_CT2]
 gi|52003423|gb|AAU23365.1| succinyl-CoA synthetase (alpha subunit) [Bacillus licheniformis
           ATCC 14580]
 gi|52348091|gb|AAU40725.1| SucD [Bacillus licheniformis ATCC 14580]
 gi|317391759|gb|EFV72556.1| succinyl-CoA ligase subunit alpha [Bacillus sp. BT1B_CT2]
          Length = 300

 Score =  343 bits (880), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 174/299 (58%), Positives = 228/299 (76%), Gaps = 9/299 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+ ++K+TKV+VQG+TG    FHT+Q + Y  T++VGG+ P KG T   G    VPVF 
Sbjct: 1   MSVFINKDTKVIVQGITGSTALFHTKQMLEY-GTKIVGGVTPGKGGTEVEG----VPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA ++T ANASVIYVP + A DAI+E+ +AE+ L++CITE IPVLDMV+VK  +E  
Sbjct: 56  TVEEAVKQTGANASVIYVPAAFAADAIMEATDAELDLVICITEHIPVLDMVKVKRYMEGK 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            +RLIGPNCPG++TP+ CKIGIMPG I +KG VG++SRSGTLTYEAV Q S+ G+GQSTA
Sbjct: 116 KTRLIGPNCPGVITPEECKIGIMPGYIHKKGHVGVVSRSGTLTYEAVHQLSEAGVGQSTA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPV GT FIDVL+ F  D  T +++M+GEIGG+AEEEAA+++K        KP+V
Sbjct: 176 VGIGGDPVNGTNFIDVLKAFNEDPDTHAVIMIGEIGGTAEEEAAEWVKANM----TKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
           GF+ GKTAPPG+ MGHAGA+ISGGKG A++KI  M   GI +A +P+ +G +L+++L  
Sbjct: 232 GFIGGKTAPPGKRMGHAGAIISGGKGTADEKIKTMNACGIEVAETPSVMGETLIKVLKE 290


>gi|237808970|ref|YP_002893410.1| succinyl-CoA synthetase, alpha subunit [Tolumonas auensis DSM 9187]
 gi|237501231|gb|ACQ93824.1| succinyl-CoA synthetase, alpha subunit [Tolumonas auensis DSM 9187]
          Length = 291

 Score =  343 bits (880), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 175/298 (58%), Positives = 216/298 (72%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL++K TKV+ QG TG  GTFH+EQAI Y  TQ+VGG+ P KG +   G    +PVF 
Sbjct: 1   MSILINKETKVICQGFTGSQGTFHSEQAIAY-GTQMVGGVSPGKGGSTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV +A E T A ASVIYVP     DAI+E+I+A I LIVCITEGIP LDM++VK RL+++
Sbjct: 56  TVRDAVETTGATASVIYVPAPFCKDAILEAIDAGIQLIVCITEGIPTLDMLQVKCRLDET 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TP  CKIGIMP  I   G VGI+SRSGTLTYEAV QT+  G GQST 
Sbjct: 116 GVRMIGPNCPGVITPGECKIGIMPAHIHLPGKVGIVSRSGTLTYEAVKQTTDAGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L+LF  D  TE+IVM+GEIGG+AEEEAA F+K        KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILKLFQEDPETEAIVMIGEIGGTAEEEAAAFIKAN----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            ++AG TAP G+ MGHAGA+I+GGKG A +K  A++EAG+    S A I   L E+ G
Sbjct: 232 SYIAGVTAPAGKRMGHAGAIIAGGKGTAAEKFAALEEAGVKTVRSLADIAVGLREVTG 289


>gi|238650299|ref|YP_002916151.1| succinyl-CoA synthetase subunit alpha [Rickettsia peacockii str.
           Rustic]
 gi|238624397|gb|ACR47103.1| succinyl-CoA synthetase subunit alpha [Rickettsia peacockii str.
           Rustic]
          Length = 292

 Score =  343 bits (880), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 176/296 (59%), Positives = 231/296 (78%), Gaps = 8/296 (2%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           M+IL++K T+V+ QG TG  GTFH+EQAI Y  T +VGG+ P KG        +++PV+ 
Sbjct: 1   MAILINKKTQVICQGFTGLQGTFHSEQAIAY-GTNMVGGVTPGKGGHTH----LDLPVYN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EAK +T ANASVIYVPP  A D+I+E+I+AEI ++VCITEGIPVLDM++VK  L  S
Sbjct: 56  TVHEAKAKTGANASVIYVPPGFAADSILEAIDAEIEVVVCITEGIPVLDMMKVKRALVGS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            +RLIGPNCPG++TP  CKIGIMPG I ++G++GI+SRSGTLTYEAV QT+  GLGQST 
Sbjct: 116 KTRLIGPNCPGVITPGECKIGIMPGHIHKRGTIGIVSRSGTLTYEAVAQTTAVGLGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPV GT F+D +E+FL D+ T++I+M+GEIGG+AEE+AA+F+K       KKPIV
Sbjct: 176 VGIGGDPVNGTNFVDCIEMFLKDDETKAIIMIGEIGGNAEEDAAEFIKQ---SKIKKPIV 232

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVEL 296
            F+AG TAPPG+ MGHAGA+I G  G AEDK+ A++ AG+ I  SPA IG++++++
Sbjct: 233 SFIAGITAPPGKRMGHAGAIIVGRTGSAEDKLEALQSAGVIITRSPADIGKTMLDV 288


>gi|157146663|ref|YP_001453982.1| succinyl-CoA synthetase subunit alpha [Citrobacter koseri ATCC
           BAA-895]
 gi|157083868|gb|ABV13546.1| hypothetical protein CKO_02429 [Citrobacter koseri ATCC BAA-895]
          Length = 289

 Score =  343 bits (880), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 172/298 (57%), Positives = 219/298 (73%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L+DKNTKV+ QG TG  GTFH+EQAI Y  TQ+VGG+ P KG T   G    +PVF 
Sbjct: 1   MSVLIDKNTKVICQGFTGSQGTFHSEQAIAY-GTQMVGGVTPGKGGTTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T A A+VIYVP     D+I+E+++A I LI+ ITEGIP LDM+ VK  L+++
Sbjct: 56  TVREAVEATGATATVIYVPAPFCKDSILEAVDAGIKLIITITEGIPTLDMLTVKVALDEA 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TP  CKIGIMPG I + G VGI+SRSGTLTYEAV QT+  G GQST 
Sbjct: 116 GVRMIGPNCPGVITPGECKIGIMPGHIHKPGKVGIVSRSGTLTYEAVKQTTDYGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L+LF  D  TE+IVM+GEIGGSAEEEAA ++K+       KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILKLFQEDPQTEAIVMIGEIGGSAEEEAAAYIKEH----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           G++AG TAP G+ MGHAGA+I+GGKG A++K  A++ AG+    S A IG +L  ++ 
Sbjct: 232 GYIAGVTAPKGKRMGHAGAIIAGGKGTADEKFAALEAAGVKTVRSLADIGEALKAVMK 289


>gi|167644202|ref|YP_001681865.1| succinyl-CoA synthetase subunit alpha [Caulobacter sp. K31]
 gi|167346632|gb|ABZ69367.1| succinyl-CoA synthetase, alpha subunit [Caulobacter sp. K31]
          Length = 294

 Score =  343 bits (880), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 211/298 (70%), Positives = 254/298 (85%), Gaps = 5/298 (1%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL+   TKV+ QG+TG  GTFH+EQAI Y  T++VGG+ P KG     G    +PVF 
Sbjct: 1   MSILIGSQTKVICQGITGAQGTFHSEQAIAY-GTKMVGGVTPGKGGQTHIG----LPVFD 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA+E T A+A+ IYVPP  A D+I+E+I+AEIPLI+CITEGIPVLDMV+VK  L+ S
Sbjct: 56  TVGEAREATGADATAIYVPPPFAADSILEAIDAEIPLIICITEGIPVLDMVKVKKALQGS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            SRLIGPNCPG+LTP+ CKIGIMPGSIF +GSVG++SRSGTLTYEAVFQT+  GLGQ+TA
Sbjct: 116 KSRLIGPNCPGVLTPNQCKIGIMPGSIFSQGSVGVVSRSGTLTYEAVFQTTNAGLGQTTA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPVKGTEFID+LELFLAD+AT+SIVM+GEIGGSAEE+AAQF+ DEAKRGR KP+V
Sbjct: 176 VGIGGDPVKGTEFIDILELFLADDATKSIVMIGEIGGSAEEDAAQFIADEAKRGRSKPMV 235

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           GF+AG+TAPPGR MGHAGA+ISGGKGGAEDKI AM+ AGI ++PSPA++G +L+E+L 
Sbjct: 236 GFIAGRTAPPGRHMGHAGAIISGGKGGAEDKIAAMEAAGIRVSPSPAKLGETLLEVLK 293


>gi|308389602|gb|ADO31922.1| putative succinyl-CoA synthetase alpha subunit [Neisseria
           meningitidis alpha710]
 gi|325130102|gb|EGC52885.1| succinate-CoA ligase, alpha subunit [Neisseria meningitidis
           OX99.30304]
 gi|325136105|gb|EGC58714.1| succinate-CoA ligase, alpha subunit [Neisseria meningitidis M0579]
 gi|325202253|gb|ADY97707.1| succinate-CoA ligase, alpha subunit [Neisseria meningitidis
           M01-240149]
 gi|325207994|gb|ADZ03446.1| succinate-CoA ligase, alpha subunit [Neisseria meningitidis
           NZ-05/33]
          Length = 296

 Score =  343 bits (880), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 164/300 (54%), Positives = 222/300 (74%), Gaps = 11/300 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+TKVLVQG TGK GTFH+EQA+ Y  T+VVGG+ P KG        +N+PVF 
Sbjct: 1   MSVLINKDTKVLVQGFTGKNGTFHSEQALAY-GTKVVGGVTPGKGGQTH----LNLPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARL--E 118
           T+ EA + T A+ASVIYVP     D+I+E++++ + L+V ITEG+P LDM++ K  L   
Sbjct: 56  TMKEAVKETGADASVIYVPAPFVLDSIVEAVDSGVGLVVVITEGVPTLDMLKAKRYLETN 115

Query: 119 KSSSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQS 178
            + +RL+GPNCPG++TP  CKIGIMPG I   G +GI+SRSGTLTYEAV QT++ GLGQS
Sbjct: 116 GNGTRLVGPNCPGVITPGECKIGIMPGHIHTPGRIGIISRSGTLTYEAVAQTTKLGLGQS 175

Query: 179 TAVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKP 238
           T +GIGGDP+ G   ID L+LF  D  T++I+M+GEIGG+AEEEAA++++        KP
Sbjct: 176 TCIGIGGDPIPGMNQIDALKLFQEDPDTDAIIMIGEIGGTAEEEAAEYIQSN----VSKP 231

Query: 239 IVGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           +VG++AG TAP G+ MGHAGA+ISGGKG AE+K  A ++AGI    SPA +G +++E+L 
Sbjct: 232 VVGYIAGVTAPKGKRMGHAGAIISGGKGTAEEKFAAFEKAGIAYTRSPAELGTTMLEVLK 291


>gi|161869872|ref|YP_001599041.1| succinyl-CoA synthetase subunit alpha [Neisseria meningitidis
           053442]
 gi|254804842|ref|YP_003083063.1| succinyl-CoA synthetase alpha chain [Neisseria meningitidis
           alpha14]
 gi|261379708|ref|ZP_05984281.1| succinyl-CoA synthetase subunit alpha [Neisseria subflava NJ9703]
 gi|296314777|ref|ZP_06864718.1| succinyl-CoA synthetase subunit alpha [Neisseria polysaccharea ATCC
           43768]
 gi|161595425|gb|ABX73085.1| succinyl-CoA synthetase alpha subunit [Neisseria meningitidis
           053442]
 gi|254668384|emb|CBA05494.1| succinyl-CoA synthetase alpha chain [Neisseria meningitidis
           alpha14]
 gi|254669448|emb|CBA03310.1| succinyl-CoA synthetase alpha chain [Neisseria meningitidis
           alpha153]
 gi|254672883|emb|CBA07162.1| succinyl-CoA synthetase alpha chain [Neisseria meningitidis
           alpha275]
 gi|284797375|gb|EFC52722.1| succinyl-CoA synthetase subunit alpha [Neisseria subflava NJ9703]
 gi|296838420|gb|EFH22358.1| succinyl-CoA synthetase subunit alpha [Neisseria polysaccharea ATCC
           43768]
 gi|309380078|emb|CBX21489.1| unnamed protein product [Neisseria lactamica Y92-1009]
 gi|319410292|emb|CBY90634.1| succinyl-CoA synthetase alpha chain (SCS-alpha) [Neisseria
           meningitidis WUE 2594]
 gi|325132158|gb|EGC54854.1| succinate-CoA ligase, alpha subunit [Neisseria meningitidis M6190]
 gi|325138090|gb|EGC60663.1| succinate-CoA ligase, alpha subunit [Neisseria meningitidis
           ES14902]
 gi|325204031|gb|ADY99484.1| succinate-CoA ligase, alpha subunit [Neisseria meningitidis
           M01-240355]
          Length = 296

 Score =  343 bits (880), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 164/301 (54%), Positives = 223/301 (74%), Gaps = 11/301 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+TKVLVQG TGK GTFH+EQA+ Y  T+VVGG+ P KG        +N+PVF 
Sbjct: 1   MSVLINKDTKVLVQGFTGKNGTFHSEQALAY-GTKVVGGVTPGKGGQTH----LNLPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARL--E 118
           T+ EA + T A+ASVIYVP     D+I+E++++ + L+V ITEG+P LDM++ K  L   
Sbjct: 56  TMKEAVKETGADASVIYVPAPFVLDSIVEAVDSGVGLVVVITEGVPTLDMLKAKRYLETN 115

Query: 119 KSSSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQS 178
            + +RL+GPNCPG++TP  CKIGIMPG I   G +GI+SRSGTLTYEAV QT++ GLGQS
Sbjct: 116 GNGTRLVGPNCPGVITPGECKIGIMPGHIHTPGRIGIISRSGTLTYEAVAQTTKLGLGQS 175

Query: 179 TAVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKP 238
           T +GIGGDP+ G   ID L+LF  D  T++I+M+GEIGG+AEEEAA++++        KP
Sbjct: 176 TCIGIGGDPIPGMNQIDALKLFQEDPDTDAIIMIGEIGGTAEEEAAEYIQSN----VTKP 231

Query: 239 IVGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           +VG++AG TAP G+ MGHAGA+ISGGKG AE+K  A ++AGI    SPA +G +++E+L 
Sbjct: 232 VVGYIAGVTAPKGKRMGHAGAIISGGKGTAEEKFAAFEKAGIAYTRSPAELGTTMLEVLK 291

Query: 299 S 299
           +
Sbjct: 292 A 292


>gi|71281395|ref|YP_268947.1| succinyl-CoA synthase subunit alpha [Colwellia psychrerythraea 34H]
 gi|71147135|gb|AAZ27608.1| succinyl-CoA synthase, alpha subunit [Colwellia psychrerythraea
           34H]
          Length = 290

 Score =  343 bits (880), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 174/298 (58%), Positives = 216/298 (72%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+TKV+ QG TG  GTFH+EQAI Y  TQ+VGG+ P KG     G    +PVF 
Sbjct: 1   MSVLINKDTKVICQGFTGGQGTFHSEQAIDY-GTQMVGGVSPGKGGQTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV +A E T A A+VIYVP     DAI+E+I+A I LIV ITEGIP LDMV VKA+L ++
Sbjct: 56  TVRDAVEATGATATVIYVPAPFCKDAILEAIDAGIELIVTITEGIPTLDMVDVKAKLTQT 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TP   KIGIMPG I   G VGI+SRSGTLTYEAV QT+  G GQST 
Sbjct: 116 GVRMIGPNCPGVITPGETKIGIMPGHIHLPGKVGIVSRSGTLTYEAVKQTTDAGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ GT FIDVLE+F  D  TE+IVM+GEIGG+AEEEAA+++K        KP+V
Sbjct: 176 VGIGGDPIPGTNFIDVLEMFQNDPQTEAIVMIGEIGGTAEEEAAEYIKAN----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            ++AG TAP G+ MGHAGA+I+GGKG A++K  A++ AG+    S A IG +L E  G
Sbjct: 232 SYIAGVTAPEGKRMGHAGAIIAGGKGTADEKFAALEAAGVKTVRSLADIGVALKEKTG 289


>gi|311280397|ref|YP_003942628.1| succinyl-CoA synthetase, alpha subunit [Enterobacter cloacae SCF1]
 gi|308749592|gb|ADO49344.1| succinyl-CoA synthetase, alpha subunit [Enterobacter cloacae SCF1]
          Length = 289

 Score =  343 bits (880), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 172/298 (57%), Positives = 219/298 (73%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++KNTKV+ QG TG  GTFH+EQAI Y  TQ+VGG+ P KG T   G    +PVF 
Sbjct: 1   MSVLINKNTKVICQGFTGSQGTFHSEQAIAY-GTQMVGGVTPGKGGTTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T A A+VIYVP     D+I+E+I+A I LI+ ITEGIP LDM+ VK +L+++
Sbjct: 56  TVREAVEATGATATVIYVPAPFCKDSILEAIDAGIKLIITITEGIPTLDMLTVKVKLDEA 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TP  CKIGIMPG I + G VGI+SRSGTLTYEAV QT+  G GQST 
Sbjct: 116 GVRMIGPNCPGVITPGECKIGIMPGHIHKPGKVGIVSRSGTLTYEAVKQTTDYGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L+LF  D  TE+IVM+GEIGGSAEEEAA ++K        KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILKLFQEDPQTEAIVMIGEIGGSAEEEAAAYIKAN----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           G++AG TAP G+ MGHAGA+I+GGKG A++K  A++ AG+    S A IG +L  ++ 
Sbjct: 232 GYIAGVTAPKGKRMGHAGAIIAGGKGTADEKFAALEAAGVKTVRSLADIGEALKSIIK 289


>gi|15676853|ref|NP_273998.1| succinyl-CoA synthetase subunit alpha [Neisseria meningitidis MC58]
 gi|261401147|ref|ZP_05987272.1| succinyl-CoA synthetase subunit alpha [Neisseria lactamica ATCC
           23970]
 gi|313668598|ref|YP_004048882.1| succinyl-CoA synthetase alpha subunit [Neisseria lactamica ST-640]
 gi|7226200|gb|AAF41366.1| succinyl-CoA synthetase, alpha subunit [Neisseria meningitidis
           MC58]
 gi|269208925|gb|EEZ75380.1| succinyl-CoA synthetase subunit alpha [Neisseria lactamica ATCC
           23970]
 gi|313006060|emb|CBN87521.1| putative succinyl-CoA synthetase alpha subunit [Neisseria lactamica
           020-06]
 gi|316985362|gb|EFV64311.1| succinyl-CoA ligase [ADP-forming] subunit alpha [Neisseria
           meningitidis H44/76]
 gi|325134124|gb|EGC56776.1| succinate-CoA ligase, alpha subunit [Neisseria meningitidis M13399]
 gi|325140151|gb|EGC62678.1| succinate-CoA ligase, alpha subunit [Neisseria meningitidis CU385]
 gi|325144249|gb|EGC66554.1| succinate-CoA ligase, alpha subunit [Neisseria meningitidis
           M01-240013]
 gi|325200356|gb|ADY95811.1| succinate-CoA ligase, alpha subunit [Neisseria meningitidis H44/76]
 gi|325206210|gb|ADZ01663.1| succinate-CoA ligase, alpha subunit [Neisseria meningitidis
           M04-240196]
          Length = 296

 Score =  343 bits (880), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 164/301 (54%), Positives = 223/301 (74%), Gaps = 11/301 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+TKVLVQG TGK GTFH+EQA+ Y  T+VVGG+ P KG        +N+PVF 
Sbjct: 1   MSVLINKDTKVLVQGFTGKNGTFHSEQALAY-GTKVVGGVTPGKGGQTH----LNLPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARL--E 118
           T+ EA + T A+ASVIYVP     D+I+E++++ + L+V ITEG+P LDM++ K  L   
Sbjct: 56  TMKEAVKETGADASVIYVPAPFVLDSIVEAVDSGVGLVVVITEGVPTLDMLKAKRYLETN 115

Query: 119 KSSSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQS 178
            + +RL+GPNCPG++TP  CKIGIMPG I   G +GI+SRSGTLTYEAV QT++ GLGQS
Sbjct: 116 GNGTRLVGPNCPGVITPGECKIGIMPGHIHTPGRIGIISRSGTLTYEAVAQTTKLGLGQS 175

Query: 179 TAVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKP 238
           T +GIGGDP+ G   ID L+LF  D  T++I+M+GEIGG+AEEEAA++++        KP
Sbjct: 176 TCIGIGGDPIPGMNQIDALKLFQEDPDTDAIIMIGEIGGTAEEEAAEYIQSN----VSKP 231

Query: 239 IVGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           +VG++AG TAP G+ MGHAGA+ISGGKG AE+K  A ++AGI    SPA +G +++E+L 
Sbjct: 232 VVGYIAGVTAPKGKRMGHAGAIISGGKGTAEEKFAAFEKAGIAYTRSPAELGTTMLEVLK 291

Query: 299 S 299
           +
Sbjct: 292 A 292


>gi|283784484|ref|YP_003364349.1| succinyl-CoA synthetase alpha chain [Citrobacter rodentium ICC168]
 gi|282947938|emb|CBG87502.1| succinyl-CoA synthetase alpha chain [Citrobacter rodentium ICC168]
          Length = 289

 Score =  343 bits (880), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 174/298 (58%), Positives = 220/298 (73%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L+DKNTKV+ QG TG  GTFH+EQAI Y  TQ+VGG+ P KG T   G    +PVF 
Sbjct: 1   MSVLIDKNTKVICQGFTGSQGTFHSEQAIAY-GTQMVGGVTPGKGGTTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T A A+VIYVP     D+I+E+I+A I LI+ ITEGIP LDM+ VK +L+++
Sbjct: 56  TVREAVEATGAIATVIYVPAPFCKDSILEAIDAGIKLIITITEGIPTLDMLTVKVKLDEA 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TP  CKIGIMPG I + G VGI+SRSGTLTYEAV QT+  G GQST 
Sbjct: 116 GVRMIGPNCPGVITPGECKIGIMPGHIHKPGKVGIVSRSGTLTYEAVKQTTDYGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L+LF  D  TE+IVM+GEIGGSAEEEAA ++KD       KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILKLFQEDPQTEAIVMIGEIGGSAEEEAAAYIKDH----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           G++AG TAP G+ MGHAGA+I+GGKG A++K  A++ AG+    S A IG +L  ++ 
Sbjct: 232 GYIAGVTAPKGKRMGHAGAIIAGGKGTADEKFAALEAAGVKTVRSLADIGEALKAVIK 289


>gi|261392693|emb|CAX50266.1| succinyl-CoA synthetase alpha chain (SCS-alpha) [Neisseria
           meningitidis 8013]
 gi|325128082|gb|EGC50977.1| succinate-CoA ligase, alpha subunit [Neisseria meningitidis N1568]
 gi|325142235|gb|EGC64652.1| succinate-CoA ligase, alpha subunit [Neisseria meningitidis
           961-5945]
 gi|325198192|gb|ADY93648.1| succinate-CoA ligase, alpha subunit [Neisseria meningitidis G2136]
          Length = 296

 Score =  343 bits (880), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 164/300 (54%), Positives = 222/300 (74%), Gaps = 11/300 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+TKVLVQG TGK GTFH+EQA+ Y  T+VVGG+ P KG        +N+PVF 
Sbjct: 1   MSVLINKDTKVLVQGFTGKNGTFHSEQALAY-GTKVVGGVTPGKGGQTH----LNLPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARL--E 118
           T+ EA + T A+ASVIYVP     D+I+E++++ + L+V ITEG+P LDM++ K  L   
Sbjct: 56  TMKEAVKETGADASVIYVPAPFVLDSIVEAVDSGVGLVVVITEGVPTLDMLKAKRYLETN 115

Query: 119 KSSSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQS 178
            + +RL+GPNCPG++TP  CKIGIMPG I   G +GI+SRSGTLTYEAV QT++ GLGQS
Sbjct: 116 GNGTRLVGPNCPGVITPGECKIGIMPGHIHTPGRIGIISRSGTLTYEAVAQTTKLGLGQS 175

Query: 179 TAVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKP 238
           T +GIGGDP+ G   ID L+LF  D  T++I+M+GEIGG+AEEEAA++++        KP
Sbjct: 176 TCIGIGGDPIPGMNQIDALKLFQEDPDTDAIIMIGEIGGTAEEEAAEYIQSN----VTKP 231

Query: 239 IVGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           +VG++AG TAP G+ MGHAGA+ISGGKG AE+K  A ++AGI    SPA +G +++E+L 
Sbjct: 232 VVGYIAGVTAPKGKRMGHAGAIISGGKGTAEEKFAAFEKAGIAYTRSPAELGTTMLEVLK 291


>gi|254498638|ref|ZP_05111356.1| succinyl CoA synthetase alpha chain [Legionella drancourtii LLAP12]
 gi|254352086|gb|EET10903.1| succinyl CoA synthetase alpha chain [Legionella drancourtii LLAP12]
          Length = 291

 Score =  343 bits (880), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 176/299 (58%), Positives = 218/299 (72%), Gaps = 10/299 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+LV+K TKVL QG TGK GT+H+EQAI Y  T++VGG+ P KG     G    +PVF 
Sbjct: 1   MSVLVNKQTKVLCQGFTGKQGTYHSEQAIAY-GTRMVGGVTPGKGGQTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           T+ EA + T A ASVIYVP     D+IIE+ +A I LIVCITEG+PVLDM+ VK  LE +
Sbjct: 56  TMREAVDATKAEASVIYVPAPFCKDSIIEAADAGIQLIVCITEGVPVLDMLEVKVYLENN 115

Query: 121 -SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQST 179
             +RLIGPNCPGI+TP  CKIGIMPGSI   G VGI+SRSGTLTYEAV QT+ +G GQST
Sbjct: 116 TQARLIGPNCPGIITPGECKIGIMPGSIHLPGKVGIVSRSGTLTYEAVKQTTDKGFGQST 175

Query: 180 AVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPI 239
            +GIGGDP+ GT FID L LF  D  T++I+MVGEIGGSAEEEAA+++K        KP+
Sbjct: 176 CIGIGGDPIPGTNFIDALALFEQDPQTQAIIMVGEIGGSAEEEAAEYIKSH----ISKPV 231

Query: 240 VGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           V ++AG TAP G+ MGHAGA+ISGGKG A +K  A++ AG+    SPA +G ++ E+ G
Sbjct: 232 VSYIAGVTAPAGKRMGHAGAIISGGKGTAAEKYAALEAAGVRTVRSPADLGDAIAEVTG 290


>gi|119945909|ref|YP_943589.1| succinyl-CoA synthetase, alpha subunit [Psychromonas ingrahamii 37]
 gi|119864513|gb|ABM03990.1| succinyl-CoA synthetase (ADP-forming) alpha subunit [Psychromonas
           ingrahamii 37]
          Length = 290

 Score =  343 bits (879), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 177/298 (59%), Positives = 223/298 (74%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL++K+TKV+ QG TG  GTFH+EQA+ Y  TQ+VGG+ P KG     G    +PVF 
Sbjct: 1   MSILINKDTKVICQGFTGGQGTFHSEQALEY-GTQMVGGVSPGKGGQTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E+T A ASVIYVP     DAI+E+I+A I LIV ITEGIP LD+V VK +L+++
Sbjct: 56  TVREAVEKTGATASVIYVPAPFCKDAILEAIDAGIKLIVTITEGIPTLDLVSVKVKLDQA 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
              +IGPNCPG++TPD CKIGIMPG I  KG VGI+SRSGTLTYEAV QT+ EG GQST 
Sbjct: 116 GVVMIGPNCPGVITPDECKIGIMPGHIHLKGKVGIVSRSGTLTYEAVKQTTDEGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L+LF  D  TE+IVM+GEIGG+AEEEAA F+K        KP+V
Sbjct: 176 VGIGGDPIPGSSFIDILKLFQEDPETEAIVMIGEIGGTAEEEAAAFIKAN----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            ++AG TAP G+ MGHAGA+I+GGKG A+DK  A+++AG+    S A+IG++L E+ G
Sbjct: 232 SYIAGVTAPAGKRMGHAGAIIAGGKGTADDKFKALEDAGVKTTKSLAQIGQALREVTG 289


>gi|170717676|ref|YP_001784751.1| succinyl-CoA synthetase, subunit alpha [Haemophilus somnus 2336]
 gi|168825805|gb|ACA31176.1| succinyl-CoA synthetase, alpha subunit [Haemophilus somnus 2336]
          Length = 290

 Score =  343 bits (879), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 174/297 (58%), Positives = 222/297 (74%), Gaps = 9/297 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           M+IL++KNTKV+ QG TGK GTFH EQA+ Y  TQ+VGG+ P K  +   G    +PVF 
Sbjct: 1   MAILINKNTKVICQGFTGKQGTFHCEQALAY-GTQLVGGVSPGKSGSLHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E+T A A++IYVP     DAI+E+I+  I  IVCITEGIP LDM+ VK +L++S
Sbjct: 56  TVREAVEKTGATATMIYVPAPFCKDAILEAIDGGIKFIVCITEGIPTLDMLEVKKKLQQS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
              +IGPNCPG++TP+ CK+GIMPG+I +KG +GI+SRSGTLTYEAV QT+ EG GQST 
Sbjct: 116 DVVMIGPNCPGVITPEECKMGIMPGNIHKKGRIGIVSRSGTLTYEAVKQTTDEGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L+LF AD  T++IVM+GEIGGSAEEEAA F+         KP+V
Sbjct: 176 VGIGGDPIPGSSFIDILKLFQADPETDAIVMIGEIGGSAEEEAADFIHKH----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELL 297
            ++AG TAP G+ MGHAGA+ISGGKG AE+KI A+++AG+    S A IG+ L  LL
Sbjct: 232 AYIAGVTAPKGKRMGHAGAIISGGKGTAEEKIVALEKAGVKTVRSLADIGKVLRTLL 288


>gi|85713705|ref|ZP_01044695.1| succinyl-CoA ligase, alpha subunit [Nitrobacter sp. Nb-311A]
 gi|85699609|gb|EAQ37476.1| succinyl-CoA ligase, alpha subunit [Nitrobacter sp. Nb-311A]
          Length = 294

 Score =  343 bits (879), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 215/299 (71%), Positives = 250/299 (83%), Gaps = 5/299 (1%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL+DKNT+V+ QG TGK GTFH+E AI Y  T++VGG  P KG        +++PVF 
Sbjct: 1   MSILIDKNTRVICQGFTGKNGTFHSEAAIAY-GTKMVGGTSPGKGGQTH----LDLPVFD 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA+E T A+ASV+YVPP+GA DAI E+I+AEIPLIVCITEGIPVLDMVRVK  L  S
Sbjct: 56  TVREAREATGADASVVYVPPAGAADAICEAIDAEIPLIVCITEGIPVLDMVRVKRSLSGS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            SRLIGPNCPG++T   CKIGIMP +IF+ G+VGI+SRSGTLTYEAVFQTSQEGLGQ+TA
Sbjct: 116 KSRLIGPNCPGVVTAGECKIGIMPANIFKTGNVGIVSRSGTLTYEAVFQTSQEGLGQTTA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPVKGTEFIDVLE+FLAD  T +IVM+GEIGGSAEE+AAQFL DEAKRGRKKP+V
Sbjct: 176 VGIGGDPVKGTEFIDVLEMFLADPKTSAIVMIGEIGGSAEEDAAQFLIDEAKRGRKKPVV 235

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
           GF+AG TAPPGR MGHAGA+ISGGKG A  K  AM+ AGI ++PSPAR+G++LVE L S
Sbjct: 236 GFIAGVTAPPGRRMGHAGAIISGGKGDAVSKTAAMEAAGIVVSPSPARLGKTLVEKLKS 294


>gi|255318879|ref|ZP_05360105.1| succinate-CoA ligase, alpha subunit family [Acinetobacter
           radioresistens SK82]
 gi|262378865|ref|ZP_06072022.1| succinyl-CoA synthetase subunit alpha [Acinetobacter radioresistens
           SH164]
 gi|255304135|gb|EET83326.1| succinate-CoA ligase, alpha subunit family [Acinetobacter
           radioresistens SK82]
 gi|262300150|gb|EEY88062.1| succinyl-CoA synthetase subunit alpha [Acinetobacter radioresistens
           SH164]
          Length = 296

 Score =  343 bits (879), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 169/301 (56%), Positives = 223/301 (74%), Gaps = 11/301 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+LV+K+TKVLVQG TGK GTFH+EQAI Y  T+VVGG+ P KG        +N+PVF 
Sbjct: 1   MSVLVNKDTKVLVQGFTGKNGTFHSEQAIAY-GTKVVGGVTPGKGGQSH----LNLPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARL--E 118
           T+ EA + T A+ASVIYVP     D+I+E+++A I LIV ITEG+P LDM++ K  L   
Sbjct: 56  TMREAVQETQADASVIYVPAPFVLDSIVEAVDAGIGLIVVITEGVPTLDMLKAKRYLETN 115

Query: 119 KSSSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQS 178
            + +RLIGPNCPGI+TP  CKIGIMPG I + G +GI+SRSGTLTYEAV QT++ GLGQS
Sbjct: 116 GNGTRLIGPNCPGIITPGECKIGIMPGHIHQPGRIGIISRSGTLTYEAVSQTTRLGLGQS 175

Query: 179 TAVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKP 238
           T +GIGGDP+ G   ID L+LF  D  T++I+M+GEIGG+AEEEAA++++        KP
Sbjct: 176 TCIGIGGDPIPGMNQIDALKLFQDDPETDAIIMIGEIGGTAEEEAAEYIQSN----VTKP 231

Query: 239 IVGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           +VG++AG TAP G+ MGHAGA+ISGGKG AE+K  A ++AG+    SPA +G +++++L 
Sbjct: 232 VVGYIAGVTAPKGKRMGHAGAIISGGKGTAEEKFAAFEKAGMAYTRSPAELGSTMLQVLK 291

Query: 299 S 299
            
Sbjct: 292 D 292


>gi|153835347|ref|ZP_01988014.1| succinyl-CoA ligase [ADP-forming] subunit alpha [Vibrio harveyi
           HY01]
 gi|148868138|gb|EDL67297.1| succinyl-CoA ligase [ADP-forming] subunit alpha [Vibrio harveyi
           HY01]
          Length = 290

 Score =  343 bits (879), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 179/298 (60%), Positives = 222/298 (74%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+TKV+ QG TG  GTFH+EQAI Y  TQ+VGG+ P KG     G    +PVF 
Sbjct: 1   MSVLINKDTKVICQGFTGGQGTFHSEQAIAY-GTQMVGGVSPGKGGQTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T A A+VIYVP     DAI+E+I+A I LIV ITEGIP  DM+ VK +LE++
Sbjct: 56  TVREAVEVTGATATVIYVPAPFCKDAILEAIDAGIELIVTITEGIPTTDMIDVKVKLEET 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TPD CKIGIMPG I +KG VGI+SRSGTLTYEAV QT+ EG GQST 
Sbjct: 116 GVRMIGPNCPGVITPDECKIGIMPGHIHKKGKVGIVSRSGTLTYEAVKQTTDEGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L+LF  D  TE+IVM+GEIGG+AEEEAA ++K+       KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILKLFQEDSETEAIVMIGEIGGTAEEEAAAYIKEN----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            ++AG TAPPG+ MGHAGA+ISGGKG AEDK  A++ AG+    S A IG+ L E+ G
Sbjct: 232 SYIAGVTAPPGKRMGHAGAIISGGKGTAEDKFAALEAAGVKTVKSLAEIGKGLREVTG 289


>gi|92116164|ref|YP_575893.1| succinyl-CoA synthetase, alpha subunit [Nitrobacter hamburgensis
           X14]
 gi|91799058|gb|ABE61433.1| succinyl-CoA synthetase (ADP-forming) alpha subunit [Nitrobacter
           hamburgensis X14]
          Length = 294

 Score =  343 bits (879), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 211/299 (70%), Positives = 249/299 (83%), Gaps = 5/299 (1%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL+D+NT+V+ QG TGK GTFH+E AI Y  T++VGG  P KG       ++++PVF 
Sbjct: 1   MSILIDRNTRVICQGFTGKNGTFHSEAAIAY-GTKMVGGTSPGKGG----NKHLDLPVFD 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV +A+E T A+ASVIYVPP GA DAI E+I+AEIPLIVCITEGIPVLDMVRV+  L  S
Sbjct: 56  TVRDAREATGADASVIYVPPPGAADAICEAIDAEIPLIVCITEGIPVLDMVRVRRALSGS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            SRLIGPNCPG++T   CKIGIMP +IF+ G+VGI+SRSGTLTYEAVFQTSQEGLGQ+TA
Sbjct: 116 KSRLIGPNCPGVVTAGECKIGIMPANIFKPGNVGIVSRSGTLTYEAVFQTSQEGLGQTTA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPVKGTEFID+LE+FLAD  T SIVM+GEIGGSAEE+AAQFL DEA+RGR KP+V
Sbjct: 176 VGIGGDPVKGTEFIDILEMFLADPKTNSIVMIGEIGGSAEEDAAQFLIDEARRGRSKPVV 235

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
           GF+AG TAPPGR MGHAGA+ISGGKG A  K  AM+ AGI ++PSPAR+G++LVE L S
Sbjct: 236 GFIAGVTAPPGRRMGHAGAIISGGKGDAASKTAAMEAAGITVSPSPARLGKTLVEKLKS 294


>gi|146337551|ref|YP_001202599.1| succinyl-CoA synthetase subunit alpha, NAD(P)-binding
           [Bradyrhizobium sp. ORS278]
 gi|146190357|emb|CAL74353.1| succinyl-CoA synthetase, alpha subunit, NAD(P)-binding
           [Bradyrhizobium sp. ORS278]
          Length = 294

 Score =  343 bits (879), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 216/299 (72%), Positives = 250/299 (83%), Gaps = 5/299 (1%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL+DKNTKV+ QG TGK GTFH+E AI Y  T++VGG  P KG +   G    +PVF 
Sbjct: 1   MSILIDKNTKVICQGFTGKNGTFHSEAAIAY-GTKMVGGTSPGKGGSTHLG----LPVFD 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA+E T A+ASVIYVPP GA DAI E+I+AE+PLIVCITEGIPVLDMVRVK  L  S
Sbjct: 56  TVKEAREATGADASVIYVPPPGAADAICEAIDAEVPLIVCITEGIPVLDMVRVKRSLVGS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            SRLIGPNCPG++T   CKIGIMP +IF+ GSVGI+SRSGTLTYEAVFQT+ EGLGQ+TA
Sbjct: 116 KSRLIGPNCPGVMTAGECKIGIMPANIFKPGSVGIVSRSGTLTYEAVFQTTSEGLGQTTA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPVKGTEFID+LE+FLAD  TESI+M+GEIGGSAEE+AAQF+KDEAKRGRKKP+V
Sbjct: 176 VGIGGDPVKGTEFIDMLEMFLADPKTESIIMIGEIGGSAEEDAAQFIKDEAKRGRKKPMV 235

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
           GF+AG TAPPGR MGHAGA+ISGGKG A  K  AM+ AGI ++PSPAR+G++LVE L S
Sbjct: 236 GFIAGVTAPPGRRMGHAGAIISGGKGDAGSKTAAMEAAGITVSPSPARLGKTLVEKLKS 294


>gi|240851387|ref|YP_002972790.1| succinyl-CoA synthetase subunit alpha [Bartonella grahamii as4aup]
 gi|240268510|gb|ACS52098.1| succinyl-CoA synthetase subunit alpha [Bartonella grahamii as4aup]
          Length = 300

 Score =  343 bits (879), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 232/299 (77%), Positives = 270/299 (90%), Gaps = 1/299 (0%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTG-GNVNVPVF 59
           MSILV+K TKVLVQGLTGK GTFHTEQA+ Y  TQ+VGG++PKKG   W G     +P+F
Sbjct: 1   MSILVNKETKVLVQGLTGKTGTFHTEQALAYHGTQMVGGVNPKKGGEIWEGSKGEALPIF 60

Query: 60  TTVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEK 119
             VAEAKE+T A+ASVIYVPP+GA  AIIE+IEAE+ LI+CITEGIPV+DMV+VKARLE 
Sbjct: 61  ANVAEAKEKTGADASVIYVPPAGAAAAIIEAIEAEVRLIICITEGIPVMDMVKVKARLEN 120

Query: 120 SSSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQST 179
           S SRLIGPNCPGILTP+ CKIGIMPGSIFRKGSVG++SRSGTLTYEAVFQTSQEGLGQ+T
Sbjct: 121 SKSRLIGPNCPGILTPNECKIGIMPGSIFRKGSVGVVSRSGTLTYEAVFQTSQEGLGQTT 180

Query: 180 AVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPI 239
           A+GIGGDPVKGTEFIDVLE+FLAD+ T+SIVM+GEIGGSAEEEAAQFL+DEAK+GRKKP+
Sbjct: 181 AIGIGGDPVKGTEFIDVLEMFLADDETQSIVMIGEIGGSAEEEAAQFLQDEAKKGRKKPV 240

Query: 240 VGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           VGF+AG+TAPPGRTMGHAGAVISGGKGGAEDKI AM+ AGI ++PSP++IG++L+ +L 
Sbjct: 241 VGFIAGRTAPPGRTMGHAGAVISGGKGGAEDKIAAMESAGIRVSPSPSQIGKTLMSVLK 299


>gi|158425638|ref|YP_001526930.1| succinyl-CoA ligase alpha subunit [Azorhizobium caulinodans ORS
           571]
 gi|158332527|dbj|BAF90012.1| succinyl-CoA ligase alpha subunit [Azorhizobium caulinodans ORS
           571]
          Length = 295

 Score =  343 bits (879), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 224/298 (75%), Positives = 258/298 (86%), Gaps = 5/298 (1%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L+D NTKV+ QG TGK GTFH+EQAI Y  T+VVGG  P KG +   G    +PVF 
Sbjct: 2   MSVLIDANTKVITQGFTGKNGTFHSEQAIAY-GTKVVGGTSPGKGGSTHLG----LPVFD 56

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA+E+T A+ASVIYVPP GA DAI+E+I+AEIPLIVCITEGIPVLDMV+VK  L  S
Sbjct: 57  TVIEAREKTGADASVIYVPPPGAADAILEAIDAEIPLIVCITEGIPVLDMVKVKRALSGS 116

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            SRLIGPNCPG++T    KIGIMP +IF+ GSVGI+SRSGTLTYEAVFQTSQEGLGQ++A
Sbjct: 117 KSRLIGPNCPGVVTAGQSKIGIMPANIFKTGSVGIVSRSGTLTYEAVFQTSQEGLGQTSA 176

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPVKGTEFIDVLELFLAD  TESIVM+GEIGGSAEE+AAQFLKDEAKRGRKKP+V
Sbjct: 177 VGIGGDPVKGTEFIDVLELFLADPKTESIVMIGEIGGSAEEDAAQFLKDEAKRGRKKPMV 236

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           GF+AG+TAPPGR MGHAGA+ISGGKGGAEDKI AM+EAGI ++PSPAR+G++LVE+L 
Sbjct: 237 GFIAGRTAPPGRRMGHAGAIISGGKGGAEDKIAAMEEAGIRVSPSPARLGKTLVEVLK 294


>gi|82775997|ref|YP_402344.1| succinyl-CoA synthetase subunit alpha [Shigella dysenteriae Sd197]
 gi|309786392|ref|ZP_07681018.1| succinyl-CoA ligase [ADP-forming] subunit alpha [Shigella
           dysenteriae 1617]
 gi|81240145|gb|ABB60855.1| succinyl-CoA synthetase, alpha subunit [Shigella dysenteriae Sd197]
 gi|308925786|gb|EFP71267.1| succinyl-CoA ligase [ADP-forming] subunit alpha [Shigella
           dysenteriae 1617]
          Length = 289

 Score =  343 bits (879), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 173/298 (58%), Positives = 218/298 (73%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL+DKNTKV+ QG TG  GTFH+EQAI Y  T++VGG+ P KG T   G    +PVF 
Sbjct: 1   MSILIDKNTKVICQGFTGSQGTFHSEQAIAY-GTKMVGGVTPGKGCTTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA   T A ASVIYVP     D+I+E+I+A I LI+ ITEGIP LDM+ VK +L+++
Sbjct: 56  TVREAVAATGATASVIYVPAPFCKDSILEAIDAGIKLIITITEGIPTLDMLTVKVKLDEA 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TP  CKIGI PG I + G VGI+SRSGTLTYEAV QT+  G GQST 
Sbjct: 116 GVRMIGPNCPGVITPGECKIGIQPGHIHKPGKVGIVSRSGTLTYEAVKQTTDYGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+LE+F  D  TE+IVM+GEIGGSAEEEAA ++K+       KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILEMFEKDPQTEAIVMIGEIGGSAEEEAAAYIKEH----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           G++AG TAP G+ MGHAGA+I+GGKG A++K  A++ AG+    S A IG +L  +L 
Sbjct: 232 GYIAGVTAPKGKRMGHAGAIIAGGKGTADEKFAALEAAGVKTVHSLADIGEALKTVLK 289


>gi|229019030|ref|ZP_04175871.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Bacillus cereus
           AH1273]
 gi|229025276|ref|ZP_04181696.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Bacillus cereus
           AH1272]
 gi|229061438|ref|ZP_04198783.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Bacillus cereus
           AH603]
 gi|229168574|ref|ZP_04296297.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Bacillus cereus
           AH621]
 gi|228614980|gb|EEK72082.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Bacillus cereus
           AH621]
 gi|228717861|gb|EEL69509.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Bacillus cereus
           AH603]
 gi|228736029|gb|EEL86604.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Bacillus cereus
           AH1272]
 gi|228742270|gb|EEL92429.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Bacillus cereus
           AH1273]
          Length = 300

 Score =  343 bits (879), Expect = 3e-92,   Method: Composition-based stats.
 Identities = 178/299 (59%), Positives = 230/299 (76%), Gaps = 9/299 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+LV+K+TKV+VQG+TG  G FHT+Q I Y  T++VGG+ P KG T   G    VPVF 
Sbjct: 1   MSVLVNKDTKVIVQGITGSQGLFHTKQMIEY-GTKIVGGVTPGKGGTDIEG----VPVFD 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV +A + T ANASV+YVPP+ A DAI+E+++A+I L+VCITEGIPVLDMV VK  +   
Sbjct: 56  TVEDAVKATGANASVVYVPPAFAADAIMEAVDAKIDLVVCITEGIPVLDMVNVKRYMAGK 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            +RL+GPNCPG++TPD CKIGIMPG I +KG VGI+SRSGTLTYEAV Q +QEG+GQSTA
Sbjct: 116 HTRLLGPNCPGVITPDECKIGIMPGYIHKKGHVGIVSRSGTLTYEAVHQLTQEGIGQSTA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPV GT+FID L+ F  DE T +++M+GEIGG+AEEEAA++++        KP+V
Sbjct: 176 VGIGGDPVNGTDFIDALKAFNEDEETHAVIMIGEIGGTAEEEAAEWVQANM----TKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
           GF+ G+TAP G+ MGHAGA+ISGGKG A +KI  M+  GI +A +PA +G +L+ +L  
Sbjct: 232 GFIGGQTAPEGKRMGHAGAIISGGKGTAAEKIKTMEACGIKVAETPAVMGETLISVLKE 290


>gi|209885675|ref|YP_002289532.1| succinyl-CoA ligase [Oligotropha carboxidovorans OM5]
 gi|209873871|gb|ACI93667.1| succinyl-CoA ligase [Oligotropha carboxidovorans OM5]
          Length = 302

 Score =  343 bits (879), Expect = 3e-92,   Method: Composition-based stats.
 Identities = 207/298 (69%), Positives = 249/298 (83%), Gaps = 5/298 (1%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+++DKNTKV+ QG TGK GTFH+E AI Y  T++VGG  P KG     G    +PVF 
Sbjct: 1   MSVMIDKNTKVICQGFTGKNGTFHSEAAIAY-GTKMVGGTSPGKGGQTHLG----LPVFD 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           +V+EA+ +T A+ASV+YVPP GA DAI E+I+AEIPLIVCITEGIPVLDMVRVK  L  S
Sbjct: 56  SVSEARAKTGADASVVYVPPPGAADAICEAIDAEIPLIVCITEGIPVLDMVRVKRALSGS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            SRL+GPNCPG++T   CKIGIMP +IF+ G+VGI+SRSGTLTYEAVFQT+Q G GQ+TA
Sbjct: 116 KSRLLGPNCPGVVTAGECKIGIMPTNIFKPGNVGIVSRSGTLTYEAVFQTTQAGFGQTTA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPVKGTEFIDVLE+FLAD+ TESI+M+GEIGGSAEE+AAQFLKDEAKRGRKKP+ 
Sbjct: 176 VGIGGDPVKGTEFIDVLEMFLADDKTESIIMIGEIGGSAEEDAAQFLKDEAKRGRKKPVA 235

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           GF+AG+TAPPGR MGHAGA+++GGKG AE KI AM+ AGI ++ SPAR+G +L +LL 
Sbjct: 236 GFIAGRTAPPGRRMGHAGAIVAGGKGDAESKIAAMEAAGIAVSASPARLGSTLADLLK 293


>gi|317047348|ref|YP_004114996.1| succinyl-CoA synthetase subunit alpha [Pantoea sp. At-9b]
 gi|316948965|gb|ADU68440.1| succinyl-CoA synthetase, alpha subunit [Pantoea sp. At-9b]
          Length = 291

 Score =  343 bits (879), Expect = 3e-92,   Method: Composition-based stats.
 Identities = 172/297 (57%), Positives = 217/297 (73%), Gaps = 9/297 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL+DKNTKV+ QG TG  GTFH+EQA+ Y  TQ+VGG+ P KG T   G    +PVF 
Sbjct: 1   MSILIDKNTKVICQGFTGGQGTFHSEQALAY-GTQLVGGVTPGKGGTTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T A A+VIYVP     D I+E+I+A I LI+ ITEGIP LDM+ VK +L+++
Sbjct: 56  TVREAVEATGATATVIYVPAPFCKDGILEAIDAGIKLIITITEGIPTLDMLTVKVKLDEA 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TP  CKIGIMPG I   G VGI+SRSGTLTYEAV QT+  G GQST 
Sbjct: 116 GVRMIGPNCPGVITPGECKIGIMPGHIHLPGRVGIVSRSGTLTYEAVKQTTDIGYGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L++F  D  TE+IVM+GEIGGSAEEEAA ++K        KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILKMFQEDPQTEAIVMIGEIGGSAEEEAAAYIKAH----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELL 297
           G++AG TAP G+ MGHAGA+I+GGKG A++K  A++ AG+    S A IG ++  +L
Sbjct: 232 GYIAGVTAPKGKRMGHAGAIIAGGKGTADEKFAALEAAGVKTVRSLADIGDAVKAVL 288


>gi|225848462|ref|YP_002728625.1| succinate-CoA ligase, subunit alpha subfamily [Sulfurihydrogenibium
           azorense Az-Fu1]
 gi|225643231|gb|ACN98281.1| succinate-CoA ligase, alpha subunit subfamily [Sulfurihydrogenibium
           azorense Az-Fu1]
          Length = 293

 Score =  343 bits (879), Expect = 3e-92,   Method: Composition-based stats.
 Identities = 167/301 (55%), Positives = 221/301 (73%), Gaps = 11/301 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+LV+KNTKV+VQG+TG+ G+FH  Q   Y  TQVV G+ P K      G    +PVF 
Sbjct: 1   MSVLVNKNTKVVVQGITGREGSFHAIQCKAY-GTQVVAGVTPGKKGENVEG----IPVFD 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T A+ S+I+VPP  A DAI+E+++A I  ++CITEGIPV DM+ VK  ++K 
Sbjct: 56  TVKEAVEETGADCSLIFVPPPFAADAILEAVDAGIKTVICITEGIPVNDMLPVKQYIKKY 115

Query: 121 --SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQS 178
              + LIGPNCPG++TP+  KIGIMPG IF+KG+VGI+SRSGTLTYEA +Q +  G+GQS
Sbjct: 116 YPDTVLIGPNCPGVITPEEAKIGIMPGHIFKKGNVGIVSRSGTLTYEAAYQLTTRGIGQS 175

Query: 179 TAVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKP 238
           TAVGIGGDP+ GT F DVL+ F  D  TE+IVM+GEIGG+AEEEAA+F+K       KKP
Sbjct: 176 TAVGIGGDPIPGTVFADVLKWFQDDPETEAIVMIGEIGGTAEEEAAEFIKSY----VKKP 231

Query: 239 IVGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           +V ++AG TAPPG+ MGHAGA+I+GGKG A +K  A++ AG+    +P+ IG ++ ++L 
Sbjct: 232 VVAYIAGVTAPPGKRMGHAGAIIAGGKGTAAEKYKALESAGVVTVKNPSIIGETVEKVLK 291

Query: 299 S 299
           +
Sbjct: 292 N 292


>gi|315648146|ref|ZP_07901247.1| succinyl-CoA synthetase, alpha subunit [Paenibacillus vortex V453]
 gi|315276792|gb|EFU40135.1| succinyl-CoA synthetase, alpha subunit [Paenibacillus vortex V453]
          Length = 309

 Score =  342 bits (878), Expect = 3e-92,   Method: Composition-based stats.
 Identities = 178/304 (58%), Positives = 228/304 (75%), Gaps = 10/304 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWT-----GGNVN 55
           MSIL+DKNTKV+ QG+TGK   FH + A+ Y  TQ+VGG  P KG T        G  V 
Sbjct: 1   MSILIDKNTKVITQGITGKTALFHAKGALDY-GTQMVGGTSPGKGGTEVEITLENGETVK 59

Query: 56  VPVFTTVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKA 115
           +PV+ TV EAK +T A ASVIYVPP+ A D+I+E+++AE+ L++CITEGIPVLDMV+V  
Sbjct: 60  LPVYNTVEEAKAKTGATASVIYVPPAFAADSILEAVDAEMDLVICITEGIPVLDMVKVSR 119

Query: 116 RLEKSSSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGL 175
            LE   +RLIGPNCPG++TP  CKIGIMPG I   G VG++SRSGTLTYEAV Q +  G+
Sbjct: 120 YLEGKKTRLIGPNCPGVITPGECKIGIMPGYIHTPGHVGVVSRSGTLTYEAVHQLTARGI 179

Query: 176 GQSTAVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGR 235
           GQS+AVGIGGDPVKGTEFIDVL LF  D  T++++M+GEIGG+AEEEAA+++K       
Sbjct: 180 GQSSAVGIGGDPVKGTEFIDVLRLFNEDPNTKAVIMIGEIGGTAEEEAAEWIKANM---- 235

Query: 236 KKPIVGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVE 295
            KP+VGF+ G TAPPG+ MGHAGA+ISGGKG A++KI  ++  G+ +AP+PA +G +LV 
Sbjct: 236 NKPVVGFIGGATAPPGKRMGHAGAIISGGKGTAKEKIAVLEACGVKVAPTPAEMGSTLVS 295

Query: 296 LLGS 299
           +L  
Sbjct: 296 VLEE 299


>gi|220921133|ref|YP_002496434.1| succinyl-CoA synthetase subunit alpha [Methylobacterium nodulans
           ORS 2060]
 gi|219945739|gb|ACL56131.1| succinyl-CoA synthetase, alpha subunit [Methylobacterium nodulans
           ORS 2060]
          Length = 294

 Score =  342 bits (878), Expect = 3e-92,   Method: Composition-based stats.
 Identities = 220/297 (74%), Positives = 255/297 (85%), Gaps = 5/297 (1%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL+DKNTKV+ QG TGK GTFH+EQAI Y  T++VGG  P KG +   G    +PVF 
Sbjct: 1   MSILIDKNTKVICQGFTGKNGTFHSEQAIAY-GTKMVGGTSPGKGGSTHLG----LPVFD 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TVAEA+E T A+ASV+YVPP GA DAI E+I+AEIPLIVCITEGIPVLDMV+VK  L+ S
Sbjct: 56  TVAEAREATGADASVVYVPPPGAADAICEAIQAEIPLIVCITEGIPVLDMVKVKRALDGS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            SRL+GPNCPGI+T    KIGIMP +IF+ GSVGI+SRSGTLTYEAVFQT+  GLGQ+TA
Sbjct: 116 KSRLVGPNCPGIVTAGESKIGIMPANIFKPGSVGIVSRSGTLTYEAVFQTTSAGLGQTTA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPVKGTEFID+LE FLADE TESIVM+GEIGGSAEE+AAQF+ DEAKRGRKKP+V
Sbjct: 176 VGIGGDPVKGTEFIDMLEKFLADEKTESIVMIGEIGGSAEEDAAQFIADEAKRGRKKPMV 235

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELL 297
           GF+AG+TAPPGR MGHAGA+ISGGKGGAEDKI AM+ AGI ++PSPAR+G++LVELL
Sbjct: 236 GFIAGRTAPPGRRMGHAGAIISGGKGGAEDKIAAMEAAGIRVSPSPARLGKTLVELL 292


>gi|154686026|ref|YP_001421187.1| succinyl-CoA synthetase subunit alpha [Bacillus amyloliquefaciens
           FZB42]
 gi|154351877|gb|ABS73956.1| SucD [Bacillus amyloliquefaciens FZB42]
 gi|328553495|gb|AEB23987.1| succinyl-CoA synthetase subunit alpha [Bacillus amyloliquefaciens
           TA208]
 gi|328911713|gb|AEB63309.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Bacillus
           amyloliquefaciens LL3]
          Length = 300

 Score =  342 bits (878), Expect = 3e-92,   Method: Composition-based stats.
 Identities = 174/299 (58%), Positives = 226/299 (75%), Gaps = 9/299 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+ ++K+T+V+VQG+TG    FHT+Q + Y  T +VGG+ P KG T   G    VPVF 
Sbjct: 1   MSVFINKDTRVIVQGITGSTALFHTKQMLEY-GTNIVGGVTPGKGGTEAEG----VPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TVAEA   T A+ASVIYVP   A DAI+E+++AEI L++CITE IPVLDMV+VK  +E  
Sbjct: 56  TVAEAVHTTGADASVIYVPAPFAADAIMEAVDAEIDLVICITEHIPVLDMVKVKRFMEGK 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            +RLIGPNCPG++TP+ CKIGIMPG I +KG VG++SRSGTLTYEAV Q S+ G+GQSTA
Sbjct: 116 KTRLIGPNCPGVITPEECKIGIMPGYIHKKGHVGVVSRSGTLTYEAVHQLSEAGVGQSTA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPV GT FIDVL+ F  D  T +++M+GEIGG+AEEEAA+++K        KP+V
Sbjct: 176 VGIGGDPVNGTNFIDVLKAFNEDPETHAVIMIGEIGGTAEEEAAEWVKANM----TKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
           GF+ GKTAPPG+ MGHAGA+ISGGKG AE+K+  M   GI +A +P+ +G +L+++L  
Sbjct: 232 GFIGGKTAPPGKRMGHAGAIISGGKGTAEEKVKTMNACGIEVAETPSVMGETLIKVLKE 290


>gi|254369721|ref|ZP_04985731.1| hypothetical protein FTAG_01047 [Francisella tularensis subsp.
           holarctica FSC022]
 gi|157122680|gb|EDO66809.1| hypothetical protein FTAG_01047 [Francisella tularensis subsp.
           holarctica FSC022]
          Length = 290

 Score =  342 bits (878), Expect = 3e-92,   Method: Composition-based stats.
 Identities = 172/298 (57%), Positives = 216/298 (72%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+LVDKNTKVLVQG TGK GTFH+EQAI Y  T +VGG+ P KG T      ++ PVF 
Sbjct: 1   MSVLVDKNTKVLVQGFTGKNGTFHSEQAIAY-GTNIVGGVTPGKGGTTH----LDRPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           T+AEA   T A+ASVIYVP     D+ IE+I++ + L+V ITEG+P LDM+ VK  L+  
Sbjct: 56  TMAEAVAATDADASVIYVPAPFVKDSAIEAIDSGVKLVVIITEGVPTLDMLVVKEYLKDK 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPGI+TP  CKIGIMPG I  KG VGI+SRSGTLTYEAV QT++   GQST 
Sbjct: 116 DVRVIGPNCPGIITPGECKIGIMPGHIHMKGKVGIISRSGTLTYEAVAQTTKLSFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           +GIGGDP+ G   I+ L+L   D  TE+I+++GEIGG+AEEEAA+++K        KP++
Sbjct: 176 IGIGGDPIPGMNQIEALKLLENDPQTEAIILIGEIGGTAEEEAAEYIKHN----VTKPVI 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           G++AG TAPPG+ MGHAGA+ISGGKG AE+K  A + AGI    SPA IG+ L E+ G
Sbjct: 232 GYIAGVTAPPGKRMGHAGAIISGGKGTAEEKFAAFEAAGIAYTRSPAEIGKKLKEVTG 289


>gi|307942803|ref|ZP_07658148.1| succinyl-CoA ligase, alpha subunit [Roseibium sp. TrichSKD4]
 gi|307773599|gb|EFO32815.1| succinyl-CoA ligase, alpha subunit [Roseibium sp. TrichSKD4]
          Length = 302

 Score =  342 bits (878), Expect = 3e-92,   Method: Composition-based stats.
 Identities = 223/301 (74%), Positives = 267/301 (88%), Gaps = 3/301 (0%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGG---NVNVP 57
           MSILV+K+TK++VQGLTGK G+FHTEQA+ Y  TQ+V G+HPKKG   WT     +  +P
Sbjct: 1   MSILVNKDTKIIVQGLTGKTGSFHTEQALQYYGTQMVAGVHPKKGGESWTSNLDADAKLP 60

Query: 58  VFTTVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARL 117
           ++ +V EAKE T A+ASVIYVPP+GAG AIIE+I+AEIP I CITEGIPV DMV+VK RL
Sbjct: 61  IYASVGEAKEATGADASVIYVPPAGAGAAIIEAIDAEIPFISCITEGIPVADMVKVKRRL 120

Query: 118 EKSSSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQ 177
           EKS+SRL+GPNCPGILTP+ CKIGIMPGSIF+KGSVG++SRSGTLTYEAVFQTS  GLGQ
Sbjct: 121 EKSNSRLLGPNCPGILTPEECKIGIMPGSIFKKGSVGVVSRSGTLTYEAVFQTSNAGLGQ 180

Query: 178 STAVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKK 237
           +TAVGIGGDPVKGTEFIDVLE+FLAD+ T+SI+M+GEIGGSAEEEAAQF+KDEAK+GR K
Sbjct: 181 TTAVGIGGDPVKGTEFIDVLEMFLADDETQSIIMIGEIGGSAEEEAAQFIKDEAKKGRNK 240

Query: 238 PIVGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELL 297
           P+ GF+AG+TAPPGRTMGHAGAVISGGKGGAEDKI AM++AGI ++PSPA++G +L+E+L
Sbjct: 241 PMAGFIAGRTAPPGRTMGHAGAVISGGKGGAEDKIAAMEDAGIKVSPSPAKLGETLLEVL 300

Query: 298 G 298
            
Sbjct: 301 K 301


>gi|331004889|ref|ZP_08328306.1| Succinyl-CoA ligase (ADP-forming) alpha chain [gamma
           proteobacterium IMCC1989]
 gi|330421343|gb|EGG95592.1| Succinyl-CoA ligase (ADP-forming) alpha chain [gamma
           proteobacterium IMCC1989]
          Length = 290

 Score =  342 bits (878), Expect = 3e-92,   Method: Composition-based stats.
 Identities = 172/298 (57%), Positives = 218/298 (73%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL++K+TKV+ QG TG  GTFH+EQAI Y  TQ+VGG+ P KG +   G    +PVF 
Sbjct: 1   MSILINKDTKVICQGFTGSNGTFHSEQAIAY-GTQMVGGVTPGKGGSTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T A A+VIYVP +   D+IIE+ +A I LI+ ITEGIP LDM+ VK  +EK 
Sbjct: 56  TVKEAVEATGATATVIYVPAAFCKDSIIEAADAGIELIITITEGIPTLDMLVVKEYVEKK 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TP  CKIGIMPG I   G VG++SRSGTLTYEAV QT+  G GQST 
Sbjct: 116 GVRMIGPNCPGVITPGECKIGIMPGHIHLPGKVGVVSRSGTLTYEAVKQTTDYGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L++F  D ATE+IVM+GEIGG+AEEEAA F+K        KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILQMFQDDPATEAIVMIGEIGGTAEEEAAAFIKAN----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            ++AG TAP G+ MGHAGA++SGGKG A++K  A+++AG+    S A IG +L E+ G
Sbjct: 232 SYIAGVTAPEGKRMGHAGAIVSGGKGTADEKFAALEDAGVKTVRSLADIGSALKEITG 289


>gi|157835426|pdb|2NU7|A Chain A, C123as Mutant Of E. Coli Succinyl-Coa Synthetase
 gi|157835428|pdb|2NU7|D Chain D, C123as Mutant Of E. Coli Succinyl-Coa Synthetase
          Length = 288

 Score =  342 bits (878), Expect = 3e-92,   Method: Composition-based stats.
 Identities = 171/297 (57%), Positives = 216/297 (72%), Gaps = 9/297 (3%)

Query: 2   SILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFTT 61
           SIL+DKNTKV+ QG TG  GTFH+EQAI Y  T++VGG+ P KG T   G    +PVF T
Sbjct: 1   SILIDKNTKVICQGFTGSQGTFHSEQAIAY-GTKMVGGVTPGKGGTTHLG----LPVFNT 55

Query: 62  VAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKSS 121
           V EA   T A ASVIYVP     D+I+E+I+A I LI+ ITEGIP LDM+ VK +L+++ 
Sbjct: 56  VREAVAATGATASVIYVPAPFCKDSILEAIDAGIKLIITITEGIPTLDMLTVKVKLDEAG 115

Query: 122 SRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTAV 181
            R+IGPN PG++TP  CKIGI PG I + G VGI+SRSGTLTYEAV QT+  G GQST V
Sbjct: 116 VRMIGPNSPGVITPGECKIGIQPGHIHKPGKVGIVSRSGTLTYEAVKQTTDYGFGQSTCV 175

Query: 182 GIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIVG 241
           GIGGDP+ G+ FID+LE+F  D  TE+IVM+GEIGGSAEEEAA ++K+       KP+VG
Sbjct: 176 GIGGDPIPGSNFIDILEMFEKDPQTEAIVMIGEIGGSAEEEAAAYIKEH----VTKPVVG 231

Query: 242 FVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           ++AG TAP G+ MGHAGA+I+GGKG A++K  A++ AG+    S A IG +L  +L 
Sbjct: 232 YIAGVTAPKGKRMGHAGAIIAGGKGTADEKFAALEAAGVKTVRSLADIGEALKTVLK 288


>gi|75150501|sp|Q8GTQ9|SUCA1_SOLLC RecName: Full=Succinyl-CoA ligase [ADP-forming] subunit alpha-1,
           mitochondrial; Short=SlSCoALalpha1; Flags: Precursor
 gi|27357175|gb|AAN86619.1| succinyl-CoA ligase alpha 1 subunit [Solanum lycopersicum]
          Length = 332

 Score =  342 bits (878), Expect = 3e-92,   Method: Composition-based stats.
 Identities = 191/298 (64%), Positives = 231/298 (77%), Gaps = 9/298 (3%)

Query: 2   SILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFTT 61
           ++ VDKNT+V+ QG+TGK GTFHTEQAI Y  T++VGG+ PKKG T   G    +PVF T
Sbjct: 38  AVFVDKNTRVICQGITGKNGTFHTEQAIEY-GTKMVGGVTPKKGGTEHLG----LPVFNT 92

Query: 62  VAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEK-S 120
           V EAK  T ANASVIYVPP  A  AI+E +EAE+ LIVCITEGIP  DMVRVKA L+K S
Sbjct: 93  VEEAKAETKANASVIYVPPPFAAAAIMEGLEAELDLIVCITEGIPQHDMVRVKAALKKQS 152

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            +RLIGPNCPGI+ P  CKIGIMPG I + G +GI+SRSGTLTYEAVFQT+  GLGQST 
Sbjct: 153 RTRLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTC 212

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP  GT F+D LE F+AD  TE IV++GEIGG+AEE+AA  +K+    G +KP+V
Sbjct: 213 VGIGGDPFNGTNFVDCLEKFIADPQTEGIVLIGEIGGTAEEDAAALIKE---SGTQKPVV 269

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            F+AG TAPPGR MGHAGA++SGGKG A+DKI A+KEAG+ +  SPA+IG S++E+  
Sbjct: 270 AFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKALKEAGVTVCESPAKIGVSMLEVFK 327


>gi|62290779|ref|YP_222572.1| succinyl-CoA synthetase subunit alpha [Brucella abortus bv. 1 str.
           9-941]
 gi|82700690|ref|YP_415264.1| succinyl-CoA synthetase subunit alpha [Brucella melitensis biovar
           Abortus 2308]
 gi|189024994|ref|YP_001935762.1| succinyl-CoA synthetase subunit alpha [Brucella abortus S19]
 gi|237816287|ref|ZP_04595280.1| succinyl-CoA synthetase, alpha subunit [Brucella abortus str. 2308
           A]
 gi|254690068|ref|ZP_05153322.1| succinyl-CoA synthetase subunit alpha [Brucella abortus bv. 6 str.
           870]
 gi|254694556|ref|ZP_05156384.1| succinyl-CoA synthetase subunit alpha [Brucella abortus bv. 3 str.
           Tulya]
 gi|254696181|ref|ZP_05158009.1| succinyl-CoA synthetase subunit alpha [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254731099|ref|ZP_05189677.1| succinyl-CoA synthetase subunit alpha [Brucella abortus bv. 4 str.
           292]
 gi|256258321|ref|ZP_05463857.1| succinyl-CoA synthetase subunit alpha [Brucella abortus bv. 9 str.
           C68]
 gi|260546045|ref|ZP_05821785.1| succinyl-CoA ligase [Brucella abortus NCTC 8038]
 gi|260755604|ref|ZP_05867952.1| succinyl-CoA synthetase subunit alpha [Brucella abortus bv. 6 str.
           870]
 gi|260758829|ref|ZP_05871177.1| succinyl-CoA synthetase subunit alpha [Brucella abortus bv. 4 str.
           292]
 gi|260760553|ref|ZP_05872896.1| succinyl-CoA synthetase subunit alpha [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260884630|ref|ZP_05896244.1| succinyl-CoA synthetase subunit alpha [Brucella abortus bv. 9 str.
           C68]
 gi|261214878|ref|ZP_05929159.1| succinyl-CoA synthetase subunit alpha [Brucella abortus bv. 3 str.
           Tulya]
 gi|297247166|ref|ZP_06930884.1| succinyl-CoA ligase subunit alpha [Brucella abortus bv. 5 str.
           B3196]
 gi|62196911|gb|AAX75211.1| SucD, succinyl-CoA synthetase, alpha subunit [Brucella abortus bv.
           1 str. 9-941]
 gi|82616791|emb|CAJ11881.1| CoA Binding Domain:Succinyl-CoA ligase, alpha subunit:ATP-citrate
           lyase/succinyl-CoA ligase [Brucella melitensis biovar
           Abortus 2308]
 gi|189020566|gb|ACD73288.1| Succinyl-CoA ligase [Brucella abortus S19]
 gi|237788354|gb|EEP62569.1| succinyl-CoA synthetase, alpha subunit [Brucella abortus str. 2308
           A]
 gi|260096152|gb|EEW80028.1| succinyl-CoA ligase [Brucella abortus NCTC 8038]
 gi|260669147|gb|EEX56087.1| succinyl-CoA synthetase subunit alpha [Brucella abortus bv. 4 str.
           292]
 gi|260670985|gb|EEX57806.1| succinyl-CoA synthetase subunit alpha [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260675712|gb|EEX62533.1| succinyl-CoA synthetase subunit alpha [Brucella abortus bv. 6 str.
           870]
 gi|260874158|gb|EEX81227.1| succinyl-CoA synthetase subunit alpha [Brucella abortus bv. 9 str.
           C68]
 gi|260916485|gb|EEX83346.1| succinyl-CoA synthetase subunit alpha [Brucella abortus bv. 3 str.
           Tulya]
 gi|297174335|gb|EFH33682.1| succinyl-CoA ligase subunit alpha [Brucella abortus bv. 5 str.
           B3196]
          Length = 300

 Score =  342 bits (878), Expect = 3e-92,   Method: Composition-based stats.
 Identities = 235/299 (78%), Positives = 269/299 (89%), Gaps = 1/299 (0%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTG-GNVNVPVF 59
           MSILV+K+TKVLVQGLTGK GTFHTEQA+ Y  TQ+VGGIHPKKG   W G     +P+F
Sbjct: 1   MSILVNKDTKVLVQGLTGKTGTFHTEQALAYYGTQMVGGIHPKKGGETWEGSKGEKLPIF 60

Query: 60  TTVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEK 119
            TVAE KERT A+ASVIYVPP+GA DAIIE+IEAEI  IVCITEGIPV+DMVRVK RLE+
Sbjct: 61  ATVAEGKERTGADASVIYVPPAGAADAIIEAIEAEIGFIVCITEGIPVMDMVRVKERLER 120

Query: 120 SSSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQST 179
           S SRL+GPNCPGILTP+ CKIGIMPG+IF+KGSVG++SRSGTLTYEAVFQTS EGLGQ+T
Sbjct: 121 SKSRLLGPNCPGILTPEECKIGIMPGNIFKKGSVGVVSRSGTLTYEAVFQTSNEGLGQTT 180

Query: 180 AVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPI 239
           AVGIGGDPVKGTEFIDVLE+FLAD+ T+SIVM+GEIGGSAEE+AAQFLKDEAKRGRKKP+
Sbjct: 181 AVGIGGDPVKGTEFIDVLEMFLADDETKSIVMIGEIGGSAEEDAAQFLKDEAKRGRKKPM 240

Query: 240 VGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           VGF+AG+TA  GRTMGHAGAVISGGKGGAEDKI AM+ AGI ++PSPA++G++LVE+L 
Sbjct: 241 VGFIAGRTALAGRTMGHAGAVISGGKGGAEDKIAAMESAGIRVSPSPAQLGKTLVEVLK 299


>gi|240112778|ref|ZP_04727268.1| succinyl-CoA synthetase subunit alpha [Neisseria gonorrhoeae MS11]
 gi|254493638|ref|ZP_05106809.1| succinyl-CoA synthetase alpha subunit [Neisseria gonorrhoeae 1291]
 gi|268598846|ref|ZP_06133013.1| succinyl-CoA synthetase alpha subunit [Neisseria gonorrhoeae MS11]
 gi|226512678|gb|EEH62023.1| succinyl-CoA synthetase alpha subunit [Neisseria gonorrhoeae 1291]
 gi|268582977|gb|EEZ47653.1| succinyl-CoA synthetase alpha subunit [Neisseria gonorrhoeae MS11]
          Length = 296

 Score =  342 bits (878), Expect = 3e-92,   Method: Composition-based stats.
 Identities = 162/301 (53%), Positives = 221/301 (73%), Gaps = 11/301 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+TKVLVQG TGK GTFH+EQA+ Y  T+VVGG+ P KG        +++PVF 
Sbjct: 1   MSVLINKDTKVLVQGFTGKNGTFHSEQALAY-GTKVVGGVTPGKGGQTH----LDLPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARL--E 118
           T+ EA + T A+ASVIYVP     D+I+E++++ + L+V ITEG+P LDM++ K  L   
Sbjct: 56  TMKEAVKETGADASVIYVPAPFVLDSIVEAVDSGVGLVVVITEGVPTLDMLKAKRYLETN 115

Query: 119 KSSSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQS 178
            + +RL+GPNCPG++TP  CKIGIMPG I   G +GI+SRSGTLTYEAV QT+  GLGQS
Sbjct: 116 GNGTRLVGPNCPGVITPGECKIGIMPGHIHTPGRIGIISRSGTLTYEAVAQTTNLGLGQS 175

Query: 179 TAVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKP 238
           T +GIGGDP+ G   ID L+LF  D  T++I+M+GEIGG+AEEEAA++++        KP
Sbjct: 176 TCIGIGGDPIPGMNQIDALKLFQEDPDTDAIIMIGEIGGTAEEEAAEYIQSN----VTKP 231

Query: 239 IVGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           +VG++ G TAP G+ MGHAGA+ISGGKG AE+K  A ++AGI    SPA +G +++E+L 
Sbjct: 232 VVGYITGVTAPKGKRMGHAGAIISGGKGTAEEKFAAFEKAGIAYTRSPAELGTTMLEVLK 291

Query: 299 S 299
           +
Sbjct: 292 A 292


>gi|83944770|ref|ZP_00957136.1| succinyl-CoA synthetase alpha subunit [Oceanicaulis alexandrii
           HTCC2633]
 gi|83851552|gb|EAP89407.1| succinyl-CoA synthetase alpha subunit [Oceanicaulis alexandrii
           HTCC2633]
          Length = 302

 Score =  342 bits (878), Expect = 3e-92,   Method: Composition-based stats.
 Identities = 225/301 (74%), Positives = 267/301 (88%), Gaps = 3/301 (0%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVN---VP 57
           MS+LV+K+TKV+VQGLTGK GTFHTEQA+ Y  T++V G+HPKKG   WT G      +P
Sbjct: 1   MSVLVNKDTKVIVQGLTGKTGTFHTEQALNYYGTKMVAGVHPKKGGESWTSGLDGSATLP 60

Query: 58  VFTTVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARL 117
           ++ TV +AKE T A ASVIYVPP+GAG AIIE+I+A I LI CITEGIPV+DMV+VKARL
Sbjct: 61  IYATVGDAKEATGATASVIYVPPAGAGAAIIEAIDAGIELITCITEGIPVMDMVKVKARL 120

Query: 118 EKSSSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQ 177
           EKS+SRL+GPNCPG+LTP+ CKIGIMPGSIF+KGSVG++SRSGTLTYEAVFQTS  GLGQ
Sbjct: 121 EKSNSRLLGPNCPGVLTPEECKIGIMPGSIFKKGSVGVVSRSGTLTYEAVFQTSNAGLGQ 180

Query: 178 STAVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKK 237
           +TAVGIGGDPVKGTEFIDVLE+FLAD+ T+SI+M+GEIGGSAEE+AAQFLKDEAK+GRKK
Sbjct: 181 TTAVGIGGDPVKGTEFIDVLEMFLADDETKSIIMIGEIGGSAEEDAAQFLKDEAKKGRKK 240

Query: 238 PIVGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELL 297
           P+VGF+AG+TAPPGRTMGHAGA++SGGKGGAEDKI AMK AGI ++ SPAR+G +LVE+L
Sbjct: 241 PMVGFIAGRTAPPGRTMGHAGAIVSGGKGGAEDKIEAMKAAGIVVSDSPARLGDTLVEVL 300

Query: 298 G 298
            
Sbjct: 301 K 301


>gi|127512587|ref|YP_001093784.1| succinyl-CoA synthetase, alpha subunit [Shewanella loihica PV-4]
 gi|126637882|gb|ABO23525.1| succinyl-CoA synthetase (ADP-forming) alpha subunit [Shewanella
           loihica PV-4]
          Length = 290

 Score =  342 bits (877), Expect = 4e-92,   Method: Composition-based stats.
 Identities = 175/298 (58%), Positives = 216/298 (72%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+TKV+ QG TG  GTFH+EQAI Y  TQ+VGG+ P KG     G    +PVF 
Sbjct: 1   MSVLINKDTKVICQGFTGGQGTFHSEQAIAY-GTQMVGGVSPGKGGQVHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV +A   T A A+VIYVP     DAI+E+I+  I LIVCITEGIP LDM+ VK +LE++
Sbjct: 56  TVKDAVAETGATATVIYVPAPFCKDAILEAIDGGIELIVCITEGIPTLDMLEVKVKLEET 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TP  CKIGIMPG I + G VGI+SRSGTLTYEAV QT+ EG GQST 
Sbjct: 116 GVRMIGPNCPGVITPGECKIGIMPGHIHKPGKVGIVSRSGTLTYEAVKQTTDEGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ GT FIDVLE+F  D  TE+IVM+GEIGG+AEEEAA ++K        KP+V
Sbjct: 176 VGIGGDPIPGTNFIDVLEMFQNDPQTEAIVMIGEIGGTAEEEAAAYIKAN----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            ++AG TAP G+ MGHAGA+I+GGKG AEDK  A++ AG+    S A IG +L    G
Sbjct: 232 SYIAGVTAPAGKRMGHAGAIIAGGKGTAEDKFAALEAAGVTTVRSLADIGSALRAKTG 289


>gi|78485717|ref|YP_391642.1| succinyl-CoA synthetase, alpha subunit [Thiomicrospira crunogena
           XCL-2]
 gi|78364003|gb|ABB41968.1| succinyl-CoA synthetase (ADP-forming) alpha subunit [Thiomicrospira
           crunogena XCL-2]
          Length = 293

 Score =  342 bits (877), Expect = 4e-92,   Method: Composition-based stats.
 Identities = 179/302 (59%), Positives = 229/302 (75%), Gaps = 13/302 (4%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL+D+NTKV+ QG TGK GTFH+EQAI Y  T++VGG+ P KG T   G    +PVF 
Sbjct: 1   MSILIDQNTKVICQGFTGKQGTFHSEQAIAY-GTKMVGGVTPGKGGTEHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA  +T A AS+IYVPP+ A D+IIE+I+A I +I CITEGIPV DM++V+A LEKS
Sbjct: 56  TVKEAVTQTGAEASMIYVPPAFAADSIIEAIDAGIKVITCITEGIPVNDMLKVRAVLEKS 115

Query: 121 SSRLIGPNCPGILTPDS----CKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLG 176
            + LIGPNCPG++TP +    CKIGIMPG I   G VGI+SRSGTLTYEAV QT+Q GLG
Sbjct: 116 DAFLIGPNCPGLITPGNDKKGCKIGIMPGHIHLPGKVGIVSRSGTLTYEAVHQTTQNGLG 175

Query: 177 QSTAVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRK 236
           QST VGIGGDP++G +FID L LF ADE T+ I++VGEIGG AEE+AA+++K        
Sbjct: 176 QSTCVGIGGDPIQGMDFIDCLRLFQADEQTQGIILVGEIGGQAEEDAAEYIKQH----VT 231

Query: 237 KPIVGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVEL 296
           KP+V ++AG TAP G+ MGHAGA++SGGKG AE K  A++ AG+ +  SPA +G ++++L
Sbjct: 232 KPVVAYIAGVTAPAGKRMGHAGAIVSGGKGTAEAKFTALESAGVTVVRSPADLGAAMLDL 291

Query: 297 LG 298
           +G
Sbjct: 292 IG 293


>gi|301121760|ref|XP_002908607.1| succinyl-CoA ligase subunit alpha, mitochondrial precursor
           [Phytophthora infestans T30-4]
 gi|262103638|gb|EEY61690.1| succinyl-CoA ligase subunit alpha, mitochondrial precursor
           [Phytophthora infestans T30-4]
          Length = 339

 Score =  342 bits (877), Expect = 4e-92,   Method: Composition-based stats.
 Identities = 178/304 (58%), Positives = 220/304 (72%), Gaps = 12/304 (3%)

Query: 1   MS----ILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNV 56
           MS    + ++K+TKV+ QG TGK GTFH++QAI Y  T +VGG+ PKKG +   G    +
Sbjct: 41  MSASAKVWINKDTKVICQGFTGKQGTFHSQQAIEY-GTNMVGGVTPKKGGSTHLG----L 95

Query: 57  PVFTTVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRV-KA 115
           PVF TVAEAK+ T A+ASVIYVPP     +IIE+IEA+IPL+V ITEGIP  DMV+V   
Sbjct: 96  PVFNTVAEAKKETGADASVIYVPPPFCAASIIEAIEAKIPLVVAITEGIPQQDMVKVKWH 155

Query: 116 RLEKSSSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGL 175
              +S++RLIGPNCPGI+ P  CK+GIMPG I +KG +GI+SRSGTLTYEAV QT+  GL
Sbjct: 156 LRNQSTTRLIGPNCPGIIKPGECKMGIMPGYIHQKGKIGIVSRSGTLTYEAVAQTTALGL 215

Query: 176 GQSTAVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGR 235
           GQST +GIGGDP  GT FID LE F  D  TE I+MVGEIGGSAEEEAA++L        
Sbjct: 216 GQSTVIGIGGDPFNGTNFIDCLERFTNDPETEGIIMVGEIGGSAEEEAAEWLMAH--GDP 273

Query: 236 KKPIVGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVE 295
            KP+V F+AG TAPPGR MGHAGA++SGGKG A  K  A++ AG+ +  SPAR+G +L E
Sbjct: 274 NKPVVSFIAGTTAPPGRRMGHAGAIVSGGKGTAAGKFAALEAAGVAVTRSPARLGVTLYE 333

Query: 296 LLGS 299
            +  
Sbjct: 334 EMQK 337


>gi|167626464|ref|YP_001676964.1| succinyl-CoA synthetase subunit alpha [Francisella philomiragia
           subsp. philomiragia ATCC 25017]
 gi|167596465|gb|ABZ86463.1| succinyl-CoA synthetase, alpha subunit [Francisella philomiragia
           subsp. philomiragia ATCC 25017]
          Length = 290

 Score =  342 bits (877), Expect = 4e-92,   Method: Composition-based stats.
 Identities = 167/298 (56%), Positives = 216/298 (72%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+LVDKNTKVLVQG TGK GTFH+EQAI Y  T +VGG+ P KG T      ++ PVF 
Sbjct: 1   MSVLVDKNTKVLVQGFTGKNGTFHSEQAIAY-GTNIVGGVTPGKGGTTH----LDRPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           T+AEA   T A+ASVIYVP     D+ IE+I++ + L+V ITEG+P LDM+ VK  L+  
Sbjct: 56  TMAEAVAATGADASVIYVPAPFVKDSAIEAIDSGVKLVVIITEGVPTLDMLVVKEYLKGK 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             +++GPNCPG++TP  CKIGIMPG I + G VGI+SRSGTLTYEAV QT++ G GQST 
Sbjct: 116 DVQVVGPNCPGVITPGQCKIGIMPGHIHQPGKVGIISRSGTLTYEAVAQTTKLGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           +GIGGDP+ G   I+ L+L   D  TE+I+++GEIGG+AEEEAA+++K        KP++
Sbjct: 176 IGIGGDPIPGMNQIEALKLLENDPQTEAIILIGEIGGTAEEEAAEYIKHN----VTKPVI 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           G++AG TAPPG+ MGHAGA+ISGGKG A++K  A + AGI    SPA +G  L E+ G
Sbjct: 232 GYIAGVTAPPGKRMGHAGAIISGGKGTADEKFAAFEAAGIAYTRSPAELGSKLKEVTG 289


>gi|168020790|ref|XP_001762925.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162685737|gb|EDQ72130.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 324

 Score =  342 bits (877), Expect = 4e-92,   Method: Composition-based stats.
 Identities = 185/299 (61%), Positives = 231/299 (77%), Gaps = 9/299 (3%)

Query: 2   SILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFTT 61
           ++ VDK T+V+ QG+TGK GTFHTEQAI Y  T +VGG+ PKKG T   G    +PVF T
Sbjct: 30  AVFVDKTTRVICQGITGKNGTFHTEQAIDY-GTNMVGGVTPKKGGTEHLG----LPVFNT 84

Query: 62  VAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARL-EKS 120
           VAEAK+ T ANASVIYVP S A +AI+E+++AE+ L+VCITEGIP  DMV+VK+ L ++S
Sbjct: 85  VAEAKKETRANASVIYVPASLAANAILEALDAELDLVVCITEGIPQHDMVKVKSALLQQS 144

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            +RLIGPNCPGI+ P  CKIGIMPG I + G +GI+SRSGTLTYEAVFQT+  GLGQST 
Sbjct: 145 KTRLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTC 204

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP  GT F+D LE F+ D  TE IV++GEIGGSAEE+AA F+K+    G +KP+V
Sbjct: 205 VGIGGDPFNGTNFVDCLEKFVNDPQTEGIVLIGEIGGSAEEDAAAFIKE---SGTQKPVV 261

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
            F+AG TAPPGR MGHAGA+ISGGKG A DKINA++ AG+ +  SPA+IG +++ +   
Sbjct: 262 SFIAGLTAPPGRRMGHAGAIISGGKGTATDKINALRAAGVTVCESPAQIGSTMLRVFQE 320


>gi|308173572|ref|YP_003920277.1| succinyl-CoA synthetase subunit alpha [Bacillus amyloliquefaciens
           DSM 7]
 gi|307606436|emb|CBI42807.1| succinyl-CoA synthetase (alpha subunit) [Bacillus amyloliquefaciens
           DSM 7]
          Length = 300

 Score =  342 bits (877), Expect = 4e-92,   Method: Composition-based stats.
 Identities = 173/299 (57%), Positives = 226/299 (75%), Gaps = 9/299 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+ ++K+T+V+VQG+TG    FHT+Q + Y  T +VGG+ P KG T   G    VPVF 
Sbjct: 1   MSVFINKDTRVIVQGITGSTALFHTKQMLEY-GTNIVGGVTPGKGGTEAEG----VPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TVAEA   T A+ASVIYVP   A DAI+E+++A+I L++CITE IPVLDMV+VK  +E  
Sbjct: 56  TVAEAVHTTGADASVIYVPAPFAADAIMEAVDAKIDLVICITEHIPVLDMVKVKRFMEGK 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            +RLIGPNCPG++TP+ CKIGIMPG I +KG VG++SRSGTLTYEAV Q S+ G+GQSTA
Sbjct: 116 KTRLIGPNCPGVITPEECKIGIMPGYIHKKGHVGVVSRSGTLTYEAVHQLSEAGVGQSTA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPV GT FIDVL+ F  D  T +++M+GEIGG+AEEEAA+++K        KP+V
Sbjct: 176 VGIGGDPVNGTNFIDVLKAFNEDPETHAVIMIGEIGGTAEEEAAEWVKANM----TKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
           GF+ GKTAPPG+ MGHAGA+ISGGKG AE+K+  M   GI +A +P+ +G +L+++L  
Sbjct: 232 GFIGGKTAPPGKRMGHAGAIISGGKGTAEEKVKTMNACGIEVAETPSVMGETLIKVLKE 290


>gi|91762633|ref|ZP_01264598.1| Succinyl-CoA synthetase alpha chain (SCS-alpha) [Candidatus
           Pelagibacter ubique HTCC1002]
 gi|91718435|gb|EAS85085.1| Succinyl-CoA synthetase alpha chain (SCS-alpha) [Candidatus
           Pelagibacter ubique HTCC1002]
          Length = 291

 Score =  342 bits (877), Expect = 4e-92,   Method: Composition-based stats.
 Identities = 195/299 (65%), Positives = 237/299 (79%), Gaps = 8/299 (2%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++KNTKV+ QG TG  GTFH+EQA+ Y  T +VGG+ PKKG        ++ PVF 
Sbjct: 1   MSVLINKNTKVICQGFTGTHGTFHSEQALKY-GTNLVGGVTPKKGGQKH----LDRPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TVAEAK+   A+A++IYVP   A  AIIE+I+A I LIVCITEG+P+ DM+RVK +L  S
Sbjct: 56  TVAEAKQEVGADATMIYVPAKFAAAAIIEAIDASIELIVCITEGVPIQDMLRVKQKLNNS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            SRLIGPNCPGI+TPD CKIGIMPG+I +KGSVGI+SRSGTLTYEAV QT++ GLGQST 
Sbjct: 116 KSRLIGPNCPGIITPDECKIGIMPGNIHKKGSVGIVSRSGTLTYEAVAQTTENGLGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           +GIGGDP+ GT FID L+LFL D  TESI+M+GEIGGSAEEEAA+F+K+      KKP+V
Sbjct: 176 IGIGGDPINGTNFIDCLDLFLNDAETESILMIGEIGGSAEEEAAEFVKNH---KIKKPMV 232

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
           GFVAG TAPPGRTMGHAGA+ISGGKGGAEDKI  M+E GI IA SP+ +G++L   L +
Sbjct: 233 GFVAGITAPPGRTMGHAGAIISGGKGGAEDKIKKMEECGITIAKSPSELGKTLFNKLSN 291


>gi|319404898|emb|CBI78499.1| succinyl-CoA synthetase, alpha chain [Bartonella rochalimae ATCC
           BAA-1498]
          Length = 300

 Score =  342 bits (877), Expect = 4e-92,   Method: Composition-based stats.
 Identities = 235/299 (78%), Positives = 270/299 (90%), Gaps = 1/299 (0%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTG-GNVNVPVF 59
           MSIL++K+TKVLVQGLTGK GTFHTEQA+ Y  TQ+VGGI+PKKG   W G     +P+F
Sbjct: 1   MSILINKDTKVLVQGLTGKTGTFHTEQALAYHGTQMVGGINPKKGGETWKGSKGETLPIF 60

Query: 60  TTVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEK 119
            +V E KE+T A+ASVIYVPP+GA DAIIE+IEAEI LIVCITEGIPV+DMV+VKA+LE+
Sbjct: 61  ASVVEGKEKTGADASVIYVPPAGAADAIIEAIEAEIGLIVCITEGIPVMDMVKVKAKLEQ 120

Query: 120 SSSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQST 179
           S SRL GPNCPGILTPD CKIGIMPGSIFRKGSVG++SRSGTLTYEAVFQTS EGLGQ+T
Sbjct: 121 SKSRLTGPNCPGILTPDECKIGIMPGSIFRKGSVGVVSRSGTLTYEAVFQTSHEGLGQTT 180

Query: 180 AVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPI 239
           A+GIGGDPVKGTEFIDVLE+FLAD  TESIVM+GEIGGSAEEEAAQFLKDEAK+GRKKP+
Sbjct: 181 AIGIGGDPVKGTEFIDVLEMFLADNETESIVMIGEIGGSAEEEAAQFLKDEAKKGRKKPM 240

Query: 240 VGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           VGF+AG+TAPPGRTMGHAGAVISGGKGGAEDKI AM+ AGI ++PSP++IG++LVE+L 
Sbjct: 241 VGFIAGRTAPPGRTMGHAGAVISGGKGGAEDKIAAMEAAGIRVSPSPSQIGKTLVEVLK 299


>gi|163941573|ref|YP_001646457.1| succinyl-CoA synthetase subunit alpha [Bacillus weihenstephanensis
           KBAB4]
 gi|229013018|ref|ZP_04170183.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Bacillus mycoides
           DSM 2048]
 gi|229134643|ref|ZP_04263452.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Bacillus cereus
           BDRD-ST196]
 gi|163863770|gb|ABY44829.1| succinyl-CoA synthetase, alpha subunit [Bacillus weihenstephanensis
           KBAB4]
 gi|228648689|gb|EEL04715.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Bacillus cereus
           BDRD-ST196]
 gi|228748272|gb|EEL98132.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Bacillus mycoides
           DSM 2048]
          Length = 300

 Score =  342 bits (877), Expect = 4e-92,   Method: Composition-based stats.
 Identities = 177/299 (59%), Positives = 230/299 (76%), Gaps = 9/299 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+LV+K+TKV+VQG+TG  G FHT+Q I Y  T++VGG+ P KG T   G    VPVF 
Sbjct: 1   MSVLVNKDTKVIVQGITGSQGLFHTKQMIEY-GTKIVGGVTPGKGGTDIEG----VPVFD 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV +A + T ANASV+YVPP+ A DAI+E+++A++ L+VCITEGIPVLDMV VK  +   
Sbjct: 56  TVEDAVKATGANASVVYVPPAFAADAIMEAVDAKVDLVVCITEGIPVLDMVNVKRYMAGK 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            +RL+GPNCPG++TPD CKIGIMPG I +KG VGI+SRSGTLTYEAV Q +QEG+GQSTA
Sbjct: 116 HTRLLGPNCPGVITPDECKIGIMPGYIHKKGHVGIVSRSGTLTYEAVHQLTQEGIGQSTA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPV GT+FID L+ F  DE T +++M+GEIGG+AEEEAA++++        KP+V
Sbjct: 176 VGIGGDPVNGTDFIDALKAFNEDEETHAVIMIGEIGGTAEEEAAEWVQANM----TKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
           GF+ G+TAP G+ MGHAGA+ISGGKG A +KI  M+  GI +A +PA +G +L+ +L  
Sbjct: 232 GFIGGQTAPEGKRMGHAGAIISGGKGTAAEKIKTMEACGIKVAETPAVMGETLISVLKE 290


>gi|256080484|ref|XP_002576511.1| succinyl-CoA synthetase-related [Schistosoma mansoni]
 gi|238661780|emb|CAZ32748.1| succinyl-CoA synthetase-related [Schistosoma mansoni]
          Length = 347

 Score =  342 bits (877), Expect = 4e-92,   Method: Composition-based stats.
 Identities = 180/299 (60%), Positives = 231/299 (77%), Gaps = 6/299 (2%)

Query: 3   ILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFTTV 62
           IL+D  TK++ QG TGK GTFH++Q + Y  T++VGG+ P KG +   G    +PVF +V
Sbjct: 51  ILLDDKTKLICQGFTGKQGTFHSQQTLAY-GTKLVGGVSPGKGGSSHLG----LPVFNSV 105

Query: 63  AEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARL-EKSS 121
            EAKE T A A+VIYVPP  A  AI E+I+A+IPLIVCITEGIP  DM+RV+ RL E+S+
Sbjct: 106 NEAKEATGATATVIYVPPPHAAAAIHEAIDAQIPLIVCITEGIPQHDMIRVRKRLSEQSA 165

Query: 122 SRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTAV 181
           SRLIGPNCPGI+ PD CKIGIMP  I + G+VGI+SRSGTLTYEAVFQT+Q GLGQS  V
Sbjct: 166 SRLIGPNCPGIIKPDVCKIGIMPAHIHKPGTVGIVSRSGTLTYEAVFQTTQVGLGQSLCV 225

Query: 182 GIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIVG 241
           GIGGDP  GT F D LE+FL D  T+SI+++GEIGG +EE+AA+FLK+      +KP+V 
Sbjct: 226 GIGGDPFNGTNFTDCLEVFLEDPNTKSIILLGEIGGDSEEQAAEFLKEHNTGPNRKPVVS 285

Query: 242 FVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGSL 300
           F+AG TAPPGR MGHAGA+IS GKGGA++K+ A++ AG+ + PSPA+IG++L++ +  L
Sbjct: 286 FIAGVTAPPGRRMGHAGAIISLGKGGAKEKMAALESAGVVVTPSPAQIGKTLLQAIADL 344


>gi|16759678|ref|NP_455295.1| succinyl-CoA synthetase subunit alpha [Salmonella enterica subsp.
           enterica serovar Typhi str. CT18]
 gi|29142549|ref|NP_805891.1| succinyl-CoA synthetase subunit alpha [Salmonella enterica subsp.
           enterica serovar Typhi str. Ty2]
 gi|213051756|ref|ZP_03344634.1| succinyl-CoA synthetase subunit alpha [Salmonella enterica subsp.
           enterica serovar Typhi str. E00-7866]
 gi|213425387|ref|ZP_03358137.1| succinyl-CoA synthetase subunit alpha [Salmonella enterica subsp.
           enterica serovar Typhi str. E02-1180]
 gi|213579891|ref|ZP_03361717.1| succinyl-CoA synthetase subunit alpha [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-0664]
 gi|289824374|ref|ZP_06543967.1| succinyl-CoA synthetase subunit alpha [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-3139]
 gi|25293455|pir||AG0591 succinyl-CoA synthetase alpha chain [imported] - Salmonella
           enterica subsp. enterica serovar Typhi (strain CT18)
 gi|16501971|emb|CAD05201.1| succinyl-CoA synthetase alpha chain [Salmonella enterica subsp.
           enterica serovar Typhi]
 gi|29138180|gb|AAO69751.1| succinyl-CoA synthetase alpha chain [Salmonella enterica subsp.
           enterica serovar Typhi str. Ty2]
          Length = 289

 Score =  342 bits (877), Expect = 4e-92,   Method: Composition-based stats.
 Identities = 172/298 (57%), Positives = 219/298 (73%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+T V+ QG TG  GTFH+EQAI Y  TQ+VGG+ P KG T   G    +PVF 
Sbjct: 1   MSVLINKDTNVICQGFTGSQGTFHSEQAIAY-GTQMVGGVTPGKGGTTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T A ASVIYVP     D+I+E+I+A I LI+ ITEGIP LDM+ VK +L+++
Sbjct: 56  TVREAVEATGATASVIYVPAPFCKDSILEAIDAGIKLIITITEGIPTLDMLTVKVKLDEA 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TP  CKIGIMPG I + G VGI+SRSGTLTYEAV QT+  G GQST 
Sbjct: 116 GVRMIGPNCPGVITPGECKIGIMPGHIHKPGKVGIVSRSGTLTYEAVKQTTDYGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L+LF  D  TE+IVM+GEIGGSAEEEAA ++KD       KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILKLFQEDPQTEAIVMIGEIGGSAEEEAAAYIKDH----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           G++AG TAP G+ MGHAGA+I+GGKG A++K  A++ AG+    S A IG +L  ++ 
Sbjct: 232 GYIAGVTAPKGKRMGHAGAIIAGGKGTADEKFAALEAAGVKTVRSLADIGEALKAIIK 289


>gi|269103072|ref|ZP_06155769.1| succinyl-CoA ligase [ADP-forming] alpha chain [Photobacterium
           damselae subsp. damselae CIP 102761]
 gi|268162970|gb|EEZ41466.1| succinyl-CoA ligase [ADP-forming] alpha chain [Photobacterium
           damselae subsp. damselae CIP 102761]
          Length = 290

 Score =  342 bits (877), Expect = 4e-92,   Method: Composition-based stats.
 Identities = 177/299 (59%), Positives = 222/299 (74%), Gaps = 9/299 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL++K+TKV+ QG TG  GTFH+EQAI Y  TQ+VGG+ P KG +   G    +PVF 
Sbjct: 1   MSILINKDTKVICQGFTGGQGTFHSEQAIAY-GTQMVGGVSPGKGGSTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T A A+VIYVP     DAI+E+I+A I LIV ITEGIP LDM+ VK RL+++
Sbjct: 56  TVREAVEATGATATVIYVPAPFCKDAILEAIDAGIELIVTITEGIPTLDMLDVKVRLDQA 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TPD CKIGIMPG I + G+VGI+SRSGTLTYEAV QT+ EG GQST 
Sbjct: 116 GVRMIGPNCPGVITPDECKIGIMPGHIHKAGNVGIVSRSGTLTYEAVKQTTDEGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L +F  D AT++IVM+GEIGG+AEE+AA ++K        KP+V
Sbjct: 176 VGIGGDPIPGSSFIDILAMFEQDPATDAIVMIGEIGGTAEEDAAAYIKQH----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
            ++AG TAPPG+ MGHAGA+ISGGKG AEDK  A++ AG+    S A IG  L E++  
Sbjct: 232 SYIAGVTAPPGKRMGHAGAIISGGKGTAEDKFAALEAAGVRTVKSLADIGLVLREVMPK 290


>gi|290474108|ref|YP_003466985.1| succinyl-CoA synthetase subunit alpha [Xenorhabdus bovienii
           SS-2004]
 gi|289173418|emb|CBJ80195.1| succinyl-CoA synthetase, alpha subunit, NAD(P)-binding [Xenorhabdus
           bovienii SS-2004]
          Length = 291

 Score =  342 bits (876), Expect = 5e-92,   Method: Composition-based stats.
 Identities = 176/298 (59%), Positives = 222/298 (74%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL+DKNTKV+ QG TG  GTFH+EQAI Y  TQ+VGG+ P KG T   G    +PVF 
Sbjct: 1   MSILIDKNTKVICQGFTGSQGTFHSEQAIAY-GTQMVGGVTPGKGGTEHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T A ASVIYVP     D+I+E+I+A I LI+ ITEGIP LDM+ VK +L+++
Sbjct: 56  TVREAVEATGATASVIYVPAPFCKDSILEAIDAGIKLIITITEGIPTLDMLTVKVKLDQA 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TPD+CKIGIMPG I + G VGI+SRSGTLTYEAV QT+  GLGQST 
Sbjct: 116 GVRMIGPNCPGVITPDACKIGIMPGHIHKAGKVGIVSRSGTLTYEAVKQTTDAGLGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L+LF  D  TE+IVM+GEIGG+AEEEAA ++K+       KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILKLFQEDPQTEAIVMIGEIGGTAEEEAAAYIKEH----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            ++AG TAP G+ MGHAGA+I+GGKG A++K  A++ AG+    S A IG ++  LL 
Sbjct: 232 AYIAGVTAPKGKRMGHAGAIIAGGKGTADEKFAALEAAGVKTVRSLADIGDAVKVLLA 289


>gi|284007865|emb|CBA73775.1| succinyl-CoA synthetase alpha chain [Arsenophonus nasoniae]
          Length = 291

 Score =  342 bits (876), Expect = 5e-92,   Method: Composition-based stats.
 Identities = 174/299 (58%), Positives = 221/299 (73%), Gaps = 9/299 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL+DKNTKV+ QG TG  GTFH+EQAI Y  T++VGG+ P KG T   G    +PVF 
Sbjct: 1   MSILIDKNTKVICQGFTGSQGTFHSEQAIAY-GTKMVGGVTPGKGGTTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA + T A ASVIYVP     D+I+E+I + I LI+ ITEGIP LDM+ VKA+L+++
Sbjct: 56  TVREAVKATGATASVIYVPARFCKDSILEAINSGIKLIITITEGIPTLDMLIVKAKLDET 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPGI+TP  CKIGI PG I + G VGI+SRSGTLTYEAV QT+  GLGQST 
Sbjct: 116 GVRMIGPNCPGIITPGECKIGIQPGHIHKAGKVGIVSRSGTLTYEAVKQTTDAGLGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L+LF AD  TE+IVM+GEIGG+AEEEAA ++K        KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILKLFQADPQTEAIVMIGEIGGTAEEEAAAYIKQH----ITKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
            ++AG TAP G+ MGHAGA+I+GGKG A++K  A++ AG+    S A IG ++ +L+ S
Sbjct: 232 AYIAGVTAPKGKRMGHAGAIIAGGKGTADEKFAALEAAGVKTVRSLAEIGAAVKQLVTS 290


>gi|291279314|ref|YP_003496149.1| succinyl-CoA synthase subunit alpha [Deferribacter desulfuricans
           SSM1]
 gi|290754016|dbj|BAI80393.1| succinyl-CoA synthase, alpha subunit [Deferribacter desulfuricans
           SSM1]
          Length = 290

 Score =  342 bits (876), Expect = 5e-92,   Method: Composition-based stats.
 Identities = 157/299 (52%), Positives = 219/299 (73%), Gaps = 9/299 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSILV+K+TKV+VQG+TG+ G+FH EQ + Y  T++VGG+ P KG T   G    VPVF 
Sbjct: 1   MSILVNKDTKVIVQGITGREGSFHAEQCMAY-GTKIVGGVTPGKGGTEHLG----VPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA + T A  S+++VPP+   DAI+E+ +A I LIV ITEG PV DM+  K  L+  
Sbjct: 56  TVEEAVKTTGATVSLVFVPPAFVADAIMEAADAGIELIVAITEGTPVKDMMYAKEYLKHR 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             ++IGPNCPGI+TP+ CKIGIMPG IF+KG VG++S+SGTLTYEA  Q  ++GLG STA
Sbjct: 116 KVKMIGPNCPGIITPEECKIGIMPGFIFKKGPVGLISKSGTLTYEASNQIVKQGLGISTA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G  + ++L++F  D  T++IVM+GEIGG  E +AA+++K+       KP+V
Sbjct: 176 VGIGGDPIIGLSYKELLQMFEEDPETKAIVMIGEIGGDLEIQAAEYIKEN----ISKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
            F+AG+TAP G+ MGHAGA++SG KG A++K++A+  AG+ +  SPA IG ++ ++L +
Sbjct: 232 AFIAGQTAPKGKRMGHAGAIVSGSKGTAKEKMDALSAAGVHVVVSPAEIGETVAKVLSN 290


>gi|325578256|ref|ZP_08148391.1| succinyl-CoA synthetase subunit alpha [Haemophilus parainfluenzae
           ATCC 33392]
 gi|325159992|gb|EGC72121.1| succinyl-CoA synthetase subunit alpha [Haemophilus parainfluenzae
           ATCC 33392]
          Length = 289

 Score =  342 bits (876), Expect = 5e-92,   Method: Composition-based stats.
 Identities = 174/298 (58%), Positives = 218/298 (73%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           M+IL++K TKV+ QG TG  GTFH+EQA+ Y  T++VGG+ P KG T   G    +PVF 
Sbjct: 1   MAILINKETKVICQGFTGAQGTFHSEQALAY-GTKLVGGVSPNKGGTTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA + T A A++IYVP     DAI+E+I+A I L+VCITEGIP LDM+ VK +L ++
Sbjct: 56  TVREAVQVTGATATMIYVPAPFCKDAILEAIDAGIQLVVCITEGIPTLDMLLVKQKLIET 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
              +IGPNCPG++TPD CKIGIMPG+I +KG VGI+SRSGTLTYE V QT+ EG GQST 
Sbjct: 116 GVVMIGPNCPGVITPDECKIGIMPGNIHKKGRVGIVSRSGTLTYEVVKQTTDEGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L+ F  D  TE+IVM+GEIGGSAEEEAA F+         KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILKRFQEDPETEAIVMIGEIGGSAEEEAAAFITAH----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            ++AG TAP G+ MGHAGA+ISGGKG A DKI A++ AG+    S A IG +L ELL 
Sbjct: 232 AYIAGVTAPKGKRMGHAGAIISGGKGTAADKIAALEAAGVKTVRSLAEIGSALHELLK 289


>gi|253701391|ref|YP_003022580.1| succinyl-CoA synthetase, subunit alpha [Geobacter sp. M21]
 gi|251776241|gb|ACT18822.1| succinyl-CoA synthetase, alpha subunit [Geobacter sp. M21]
          Length = 308

 Score =  342 bits (876), Expect = 5e-92,   Method: Composition-based stats.
 Identities = 172/297 (57%), Positives = 221/297 (74%), Gaps = 9/297 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSILVDKNTKV+ QG+TG  G FH + A  Y  TQ+VGG+ P KG T   G     PVF 
Sbjct: 1   MSILVDKNTKVITQGITGSTGLFHAQGAREY-GTQMVGGVTPGKGGTSVDG----FPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TVAEA E+T A ASVIYVPP  A D+I+E+I+A + L+ CITEGIPVLDMV+VK  ++  
Sbjct: 56  TVAEAVEQTGATASVIYVPPPFAADSIMEAIDAGLDLVCCITEGIPVLDMVKVKQYMQGK 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            +RLIGPNCPG++TP  CKIGIMPG I R G VG++SRSGTLTYEAV+Q +  GLGQST 
Sbjct: 116 KTRLIGPNCPGVITPGQCKIGIMPGYIHRPGKVGVVSRSGTLTYEAVWQLTGYGLGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPV GT  +D L +F  D  TE+++M+GEIGGSAEEEAA F+++       KP+ 
Sbjct: 176 VGIGGDPVNGTSHLDCLRMFEEDPDTEAVIMIGEIGGSAEEEAAYFVREHM----TKPVA 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELL 297
           G++AG+TAPPG+ MGHAGA+ISGGKG A +K+  ++  GI +A +PA + ++L+++ 
Sbjct: 232 GYIAGRTAPPGKRMGHAGAIISGGKGTAAEKVAILESCGISVAATPAEMAQALMKVY 288


>gi|241668897|ref|ZP_04756475.1| succinyl-CoA synthetase, alpha subunit [Francisella philomiragia
           subsp. philomiragia ATCC 25015]
 gi|254877429|ref|ZP_05250139.1| succinyl-CoA synthetase subunit alpha [Francisella philomiragia
           subsp. philomiragia ATCC 25015]
 gi|254843450|gb|EET21864.1| succinyl-CoA synthetase subunit alpha [Francisella philomiragia
           subsp. philomiragia ATCC 25015]
          Length = 290

 Score =  342 bits (876), Expect = 5e-92,   Method: Composition-based stats.
 Identities = 169/298 (56%), Positives = 216/298 (72%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+LVDKNTKVLVQG TGK GTFH+EQAI Y  T +VGG+ P KG T      +N PVF 
Sbjct: 1   MSVLVDKNTKVLVQGFTGKNGTFHSEQAIAY-GTNIVGGVTPGKGGTTH----LNRPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           T+AEA   T A+ASVIYVP     D+ IE+I++ + L+V ITEG+P LDM+ VK  L+  
Sbjct: 56  TMAEAVAATGADASVIYVPAPFVKDSAIEAIDSGVKLVVIITEGVPTLDMLVVKEYLKGK 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             +++GPNCPG++TP  CKIGIMPG I + G VGI+SRSGTLTYEAV QT++ G GQST 
Sbjct: 116 DVQVVGPNCPGVITPGQCKIGIMPGHIHQPGKVGIISRSGTLTYEAVAQTTKLGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           +GIGGDP+ G   I+ L+L   D  TE+I+++GEIGG+AEEEAA+++K        KP++
Sbjct: 176 IGIGGDPIPGMNQIEALKLLENDPQTEAIILIGEIGGTAEEEAAEYIKHN----VTKPVI 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           G++AG TAPPG+ MGHAGA+ISGGKG AE+K  A + AGI    SPA +G  L E+ G
Sbjct: 232 GYIAGVTAPPGKRMGHAGAIISGGKGTAEEKFAAFEAAGIAYTRSPAELGSKLKEVTG 289


>gi|71082943|ref|YP_265662.1| succinyl-CoA synthetase subunit alpha (SCS-alpha) [Candidatus
           Pelagibacter ubique HTCC1062]
 gi|71062056|gb|AAZ21059.1| Succinyl-CoA synthetase alpha chain (SCS-alpha) [Candidatus
           Pelagibacter ubique HTCC1062]
          Length = 291

 Score =  342 bits (876), Expect = 5e-92,   Method: Composition-based stats.
 Identities = 196/299 (65%), Positives = 237/299 (79%), Gaps = 8/299 (2%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L+DKNTKV+ QG TG  GTFH+EQA+ Y  T +VGG+ PKKG        ++ PVF 
Sbjct: 1   MSVLIDKNTKVICQGFTGTHGTFHSEQALKY-GTNLVGGVTPKKGGQKH----LDRPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TVAEAK+   A+A++IYVP   A  AIIE+I+A I LIVCITEG+P+ DM+RVK +L  S
Sbjct: 56  TVAEAKQEVGADATMIYVPAKFAAAAIIEAIDASIELIVCITEGVPIQDMLRVKQKLNNS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            SRLIGPNCPGI+TPD CKIGIMPG+I +KGSVGI+SRSGTLTYEAV QT++ GLGQST 
Sbjct: 116 KSRLIGPNCPGIITPDECKIGIMPGNIHKKGSVGIVSRSGTLTYEAVAQTTENGLGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           +GIGGDP+ GT FID L+LFL D  TESI+M+GEIGGSAEEEAA+F+K+      KKP+V
Sbjct: 176 IGIGGDPINGTNFIDCLDLFLNDAETESILMIGEIGGSAEEEAAEFVKNH---KIKKPMV 232

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
           GFVAG TAPPGRTMGHAGA+ISGGKGGAEDKI  M+E GI IA SP+ +G++L   L +
Sbjct: 233 GFVAGITAPPGRTMGHAGAIISGGKGGAEDKIKKMEECGITIAKSPSELGKTLFNKLSN 291


>gi|39933267|ref|NP_945543.1| succinyl-CoA synthetase subunit alpha [Rhodopseudomonas palustris
           CGA009]
 gi|39652892|emb|CAE25634.1| succinyl-CoA synthetase alpha-subunit [Rhodopseudomonas palustris
           CGA009]
          Length = 294

 Score =  342 bits (876), Expect = 5e-92,   Method: Composition-based stats.
 Identities = 215/299 (71%), Positives = 249/299 (83%), Gaps = 5/299 (1%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL+D NT+V+ QG TGK GTFH+E AI Y  T++VGG  P KG +   G    +PVF 
Sbjct: 1   MSILIDSNTRVICQGFTGKNGTFHSEAAIAY-GTKMVGGTSPGKGGSTHLG----LPVFD 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA+++T A+ASVIYVPP GA DAI E+I+AEIPLIVCITEGIPVLDMVRVK  L  S
Sbjct: 56  TVREARDKTGADASVIYVPPPGAADAICEAIDAEIPLIVCITEGIPVLDMVRVKRSLNGS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            SRLIGPNCPG++T   CKIGIMP +IF+ GSVGI+SRSGTLTYEAVFQTS EGLGQ+TA
Sbjct: 116 KSRLIGPNCPGVMTAGECKIGIMPANIFKPGSVGIVSRSGTLTYEAVFQTSAEGLGQTTA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPVKGTEFIDVLE+FLAD+ TESI+M+GEIGGSAEE+AAQFL DEAKRGRKKP+V
Sbjct: 176 VGIGGDPVKGTEFIDVLEMFLADDNTESIIMIGEIGGSAEEDAAQFLIDEAKRGRKKPMV 235

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
           GF+AG TAPPGR MGHAGA+ISGGKG A  K  AM+ AGI ++PSPAR+G++L E L S
Sbjct: 236 GFIAGVTAPPGRRMGHAGAIISGGKGDAASKTAAMEAAGITVSPSPARLGKTLAEKLKS 294


>gi|113969978|ref|YP_733771.1| succinyl-CoA synthetase (ADP-forming) subunit alpha [Shewanella sp.
           MR-4]
 gi|114047213|ref|YP_737763.1| succinyl-CoA synthetase (ADP-forming) subunit alpha [Shewanella sp.
           MR-7]
 gi|117920160|ref|YP_869352.1| succinyl-CoA synthetase (ADP-forming) subunit alpha [Shewanella sp.
           ANA-3]
 gi|113884662|gb|ABI38714.1| succinyl-CoA synthetase (ADP-forming) alpha subunit [Shewanella sp.
           MR-4]
 gi|113888655|gb|ABI42706.1| succinyl-CoA synthetase (ADP-forming) alpha subunit [Shewanella sp.
           MR-7]
 gi|117612492|gb|ABK47946.1| succinyl-CoA synthetase (ADP-forming) alpha subunit [Shewanella sp.
           ANA-3]
          Length = 290

 Score =  342 bits (876), Expect = 5e-92,   Method: Composition-based stats.
 Identities = 176/298 (59%), Positives = 217/298 (72%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+TKV+ QG TG  GTFH++QAI Y  TQ+VGG+ P KG T   G    +PVF 
Sbjct: 1   MSVLINKDTKVICQGFTGGQGTFHSQQAIDY-GTQMVGGVSPGKGGTEHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV +A   T A ASVIYVP     DAI+E+I+  I LIVCITEGIP LDM+ VK +LE++
Sbjct: 56  TVKDAVAATGATASVIYVPAPFCKDAILEAIDGGIELIVCITEGIPTLDMLEVKVKLEET 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TP  CKIGIMPG I  KG VGI+SRSGTLTYEAV QT+ EG GQST 
Sbjct: 116 GVRMIGPNCPGVITPGECKIGIMPGHIHLKGKVGIVSRSGTLTYEAVKQTTDEGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ GT FIDVLE+F  D  TE+IVM+GEIGG+AEEEAA ++K        KP+V
Sbjct: 176 VGIGGDPIPGTNFIDVLEMFQNDPQTEAIVMIGEIGGTAEEEAAAYIKAN----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            ++AG TAP G+ MGHAGA+I+GGKG A DK  A++ AG+    S A IG++L    G
Sbjct: 232 SYIAGVTAPAGKRMGHAGAIIAGGKGTAADKFAALEAAGVTTVRSLADIGKALRAKTG 289


>gi|329898830|ref|ZP_08272492.1| Succinyl-CoA ligase [ADP-forming] alpha chain [gamma
           proteobacterium IMCC3088]
 gi|328920730|gb|EGG28199.1| Succinyl-CoA ligase [ADP-forming] alpha chain [gamma
           proteobacterium IMCC3088]
          Length = 290

 Score =  342 bits (876), Expect = 5e-92,   Method: Composition-based stats.
 Identities = 171/295 (57%), Positives = 213/295 (72%), Gaps = 9/295 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL++  TKV+ QG TG  GTFH+EQAI Y  T++VGG+ P KG     G    +PVF 
Sbjct: 1   MSILINSETKVICQGFTGSQGTFHSEQAIAY-GTKMVGGVTPGKGGQEHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TVA+A E T A ASVIYVP +   D+I+E+  A I LIVCITEGIP LDM+  K + ++ 
Sbjct: 56  TVADAVEATGAEASVIYVPAAFCKDSILEAAFAGIKLIVCITEGIPTLDMLDAKVKCDEL 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             RLIGPNCPG++TP  CKIGIMPG I   G VGI+SRSGTLTYEAV QT+  G GQST 
Sbjct: 116 GVRLIGPNCPGVITPGECKIGIMPGHIHLPGKVGIVSRSGTLTYEAVKQTTDAGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+LE+F  D ATE+IVM+GEIGG+AEEEAA ++K        KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILEMFEKDPATEAIVMIGEIGGTAEEEAAAYIKAN----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVE 295
            ++AG TAP G+ MGHAGA+ISGGKG A++K  A+++AG+    S A IG +L E
Sbjct: 232 SYIAGVTAPKGKRMGHAGAIISGGKGTADEKFAALEDAGVTTVRSLADIGVALKE 286


>gi|50085912|ref|YP_047422.1| succinyl-CoA synthetase subunit alpha [Acinetobacter sp. ADP1]
 gi|49531888|emb|CAG69600.1| succinyl-CoA synthetase alpha chain [Acinetobacter sp. ADP1]
          Length = 296

 Score =  342 bits (876), Expect = 6e-92,   Method: Composition-based stats.
 Identities = 161/301 (53%), Positives = 221/301 (73%), Gaps = 11/301 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+TKVLVQG TGK GTFH+ QA+ Y  T+VVGG+ P KG T      +++PVF 
Sbjct: 1   MSVLINKDTKVLVQGFTGKNGTFHSAQALDY-GTKVVGGVTPGKGGTTH----LDLPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARL--E 118
           T+ +A   T A+ASVIYVP     D+I+E++++ + LIV ITEG+P LDM++ K  L   
Sbjct: 56  TMKDAVRETGADASVIYVPAPFVLDSIVEAVDSGVGLIVVITEGVPTLDMLKAKRYLETN 115

Query: 119 KSSSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQS 178
            + +RL+GPNCPG++TP  CKIGIMPG I + G +GI+SRSGTLTYEAV QT++ GLGQS
Sbjct: 116 GNGTRLVGPNCPGVITPGECKIGIMPGHIHQPGRIGIISRSGTLTYEAVAQTTKLGLGQS 175

Query: 179 TAVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKP 238
           T +GIGGDP+ G   ID L+LF  D  T++I+M+GEIGG+AEEEAA++++        KP
Sbjct: 176 TCIGIGGDPIPGMNQIDALKLFQDDPDTDAIIMIGEIGGTAEEEAAEYIQSN----VTKP 231

Query: 239 IVGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           +VG++AG TAP G+ MGHAGA+ISGGKG AE+K  A + AG+    SPA +G +++++L 
Sbjct: 232 VVGYIAGVTAPKGKRMGHAGAIISGGKGTAEEKFAAFERAGMAYTRSPAELGSTMLQVLK 291

Query: 299 S 299
            
Sbjct: 292 E 292


>gi|15237260|ref|NP_197716.1| succinyl-CoA ligase (GDP-forming) alpha-chain, mitochondrial,
           putative / succinyl-CoA synthetase, alpha chain,
           putative / SCS-alpha, putative [Arabidopsis thaliana]
 gi|56754629|sp|Q8LAD2|SUCA2_ARATH RecName: Full=Succinyl-CoA ligase [ADP-forming] subunit alpha-2,
           mitochondrial; AltName: Full=Succinyl-CoA synthetase
           subunit alpha-2; Short=SCS-alpha-2; Flags: Precursor
 gi|10177814|dbj|BAB11180.1| succinyl-CoA synthetase, alpha subunit [Arabidopsis thaliana]
 gi|20260190|gb|AAM12993.1| succinyl-CoA synthetase, alpha subunit [Arabidopsis thaliana]
 gi|21387045|gb|AAM47926.1| succinyl-CoA synthetase alpha subunit [Arabidopsis thaliana]
 gi|332005758|gb|AED93141.1| Succinyl-CoA ligase [GDP-forming] subunit alpha-2 [Arabidopsis
           thaliana]
          Length = 341

 Score =  342 bits (876), Expect = 6e-92,   Method: Composition-based stats.
 Identities = 184/299 (61%), Positives = 224/299 (74%), Gaps = 9/299 (3%)

Query: 2   SILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFTT 61
           ++ VDKNT+V+ QG+TGK GTFHTEQAI Y  T++V G+ PKKG T   G    +PVF T
Sbjct: 46  AVFVDKNTRVICQGITGKNGTFHTEQAIEY-GTKMVAGVTPKKGGTEHLG----LPVFNT 100

Query: 62  VAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLE-KS 120
           VAEAK  T ANASVIYVP   A  AI+E + AE+ LIVCITEGIP  DMVRVKA L  +S
Sbjct: 101 VAEAKAETKANASVIYVPAPFAAAAIMEGLAAELDLIVCITEGIPQHDMVRVKAALNSQS 160

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            +RLIGPNCPGI+ P  CKIGIMPG I + G +GI+SRSGTLTYEAVFQT+  GLGQST 
Sbjct: 161 KTRLIGPNCPGIIKPGECKIGIMPGYIHKPGKIGIVSRSGTLTYEAVFQTTAVGLGQSTC 220

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP  GT F+D LE F  D  TE IV++GEIGG+AEE+AA  +K+    G  KP+V
Sbjct: 221 VGIGGDPFNGTNFVDCLEKFFVDPQTEGIVLIGEIGGTAEEDAAALIKEN---GTDKPVV 277

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
            F+AG TAPPGR MGHAGA++SGGKG A+DKI ++++AG+ +  SPA+IG ++ EL   
Sbjct: 278 AFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKSLRDAGVKVVESPAKIGAAMFELFQE 336


>gi|307545698|ref|YP_003898177.1| succinyl-CoA synthetase subunit alpha [Halomonas elongata DSM 2581]
 gi|307217722|emb|CBV42992.1| succinyl-CoA synthetase, subunit alpha [Halomonas elongata DSM
           2581]
          Length = 290

 Score =  342 bits (876), Expect = 6e-92,   Method: Composition-based stats.
 Identities = 176/296 (59%), Positives = 217/296 (73%), Gaps = 9/296 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL+DKNTKV+ QG TG  GTFH+EQAI Y  TQ+VGG+ P KG     G    +PVF 
Sbjct: 1   MSILIDKNTKVICQGFTGGQGTFHSEQAIAY-GTQMVGGVTPGKGGQEHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TVAEA E T A ASVIYVP     D+I+E+  A I LIVCITEGIP LDM+ VK + ++ 
Sbjct: 56  TVAEAVEATGAEASVIYVPAPFCKDSILEAANAGIKLIVCITEGIPTLDMLDVKVKCDEL 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            +RLIGPNCPG++TPD CKIGIMPG I + G VGI+SRSGTLTYEAV QT+  G GQS+ 
Sbjct: 116 GARLIGPNCPGVITPDECKIGIMPGHIHKAGKVGIVSRSGTLTYEAVKQTTDHGFGQSSC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L  F  D ATE+IVM+GEIGG+AEEEAA ++K+       KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILAEFEKDPATEAIVMIGEIGGTAEEEAAAYIKEN----VSKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVEL 296
            ++AG TAPPG+ MGHAGA+I+GGKG A++K  A++ AG+    S A IG +L E 
Sbjct: 232 AYIAGVTAPPGKRMGHAGAIIAGGKGTADEKFGALEAAGVKTVRSLAEIGDALKEA 287


>gi|157835430|pdb|2NU8|A Chain A, C123at Mutant Of E. Coli Succinyl-Coa Synthetase
 gi|157835432|pdb|2NU8|D Chain D, C123at Mutant Of E. Coli Succinyl-Coa Synthetase
          Length = 288

 Score =  341 bits (875), Expect = 6e-92,   Method: Composition-based stats.
 Identities = 171/297 (57%), Positives = 216/297 (72%), Gaps = 9/297 (3%)

Query: 2   SILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFTT 61
           SIL+DKNTKV+ QG TG  GTFH+EQAI Y  T++VGG+ P KG T   G    +PVF T
Sbjct: 1   SILIDKNTKVICQGFTGSQGTFHSEQAIAY-GTKMVGGVTPGKGGTTHLG----LPVFNT 55

Query: 62  VAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKSS 121
           V EA   T A ASVIYVP     D+I+E+I+A I LI+ ITEGIP LDM+ VK +L+++ 
Sbjct: 56  VREAVAATGATASVIYVPAPFCKDSILEAIDAGIKLIITITEGIPTLDMLTVKVKLDEAG 115

Query: 122 SRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTAV 181
            R+IGPN PG++TP  CKIGI PG I + G VGI+SRSGTLTYEAV QT+  G GQST V
Sbjct: 116 VRMIGPNTPGVITPGECKIGIQPGHIHKPGKVGIVSRSGTLTYEAVKQTTDYGFGQSTCV 175

Query: 182 GIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIVG 241
           GIGGDP+ G+ FID+LE+F  D  TE+IVM+GEIGGSAEEEAA ++K+       KP+VG
Sbjct: 176 GIGGDPIPGSNFIDILEMFEKDPQTEAIVMIGEIGGSAEEEAAAYIKEH----VTKPVVG 231

Query: 242 FVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           ++AG TAP G+ MGHAGA+I+GGKG A++K  A++ AG+    S A IG +L  +L 
Sbjct: 232 YIAGVTAPKGKRMGHAGAIIAGGKGTADEKFAALEAAGVKTVRSLADIGEALKTVLK 288


>gi|311068131|ref|YP_003973054.1| succinyl-CoA synthetase subunit alpha [Bacillus atrophaeus 1942]
 gi|310868648|gb|ADP32123.1| succinyl-CoA synthetase subunit alpha [Bacillus atrophaeus 1942]
          Length = 300

 Score =  341 bits (875), Expect = 7e-92,   Method: Composition-based stats.
 Identities = 173/299 (57%), Positives = 227/299 (75%), Gaps = 9/299 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+ V+K+T+V+VQG+TG    FHT+Q + Y  T +VGG+ P KG T   G    VPVF 
Sbjct: 1   MSVFVNKDTRVIVQGITGSTALFHTKQMLEY-GTNIVGGVTPGKGGTEAEG----VPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TVA+A   T ANASVIYVP + A DAI+E+++AE+ L++CITE IPVLDMV+VK  +E  
Sbjct: 56  TVADAVHTTGANASVIYVPAAFAADAIMEAVDAELDLVICITEHIPVLDMVKVKRFMEGK 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            +RLIGPNCPG++TP+ CKIGIMPG I +KG VG++SRSGTLTYEAV Q S+ G+GQSTA
Sbjct: 116 KTRLIGPNCPGVITPEECKIGIMPGYIHKKGHVGVVSRSGTLTYEAVHQLSEAGVGQSTA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPV GT FIDVL+ F  D  T +++M+GEIGG+AEEEAA+++K        KP+V
Sbjct: 176 VGIGGDPVNGTNFIDVLKAFNEDPETHAVIMIGEIGGTAEEEAAEWVKANM----TKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
           GF+ GKTAPPG+ MGHAGA+ISGGKG A++KI  +   GI +A +P+ +G +L+++L  
Sbjct: 232 GFIGGKTAPPGKRMGHAGAIISGGKGTADEKIKTLNACGIEVAETPSVMGETLIKVLKE 290


>gi|311030143|ref|ZP_07708233.1| succinyl-CoA synthetase subunit alpha [Bacillus sp. m3-13]
          Length = 300

 Score =  341 bits (875), Expect = 7e-92,   Method: Composition-based stats.
 Identities = 176/299 (58%), Positives = 228/299 (76%), Gaps = 9/299 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+ ++K+TKV+VQG+TG    FHT+Q + Y  TQ+VGG+ P KG T   G    VPVF 
Sbjct: 1   MSVFINKDTKVIVQGITGSTALFHTKQMLEY-GTQIVGGVTPGKGGTEVEG----VPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA + T ANASVIYVP   A DAI+E+++AE+ L +CITE IPVLDMV+VK  +E  
Sbjct: 56  TVEEAVKATGANASVIYVPAPFAADAIMEAVDAELDLAICITEHIPVLDMVKVKRYMEGK 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            +RL+GPNCPG++TP  CKIGIMPG I  KG VG++SRSGTLTYEAV Q SQEG+GQSTA
Sbjct: 116 KTRLVGPNCPGVITPGECKIGIMPGYIHTKGHVGVVSRSGTLTYEAVHQLSQEGIGQSTA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPV GT+FIDVL+ F  DE T +++M+GEIGG+AEEEAA ++K+       KP+V
Sbjct: 176 VGIGGDPVNGTDFIDVLKAFNEDEDTFAVIMIGEIGGTAEEEAALWVKENM----TKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
           GF+ G+TAPPG+ MGHAGA+ISGGKG A++KI  M E GI +A +P+ +G +L++++  
Sbjct: 232 GFIGGRTAPPGKRMGHAGAIISGGKGTADEKIRVMNECGIEVADTPSVMGETLIKVIKE 290


>gi|294085400|ref|YP_003552160.1| succinyl-CoA synthetase subunit alpha [Candidatus Puniceispirillum
           marinum IMCC1322]
 gi|292664975|gb|ADE40076.1| succinyl-CoA synthetase, alpha subunit [Candidatus Puniceispirillum
           marinum IMCC1322]
          Length = 313

 Score =  341 bits (875), Expect = 8e-92,   Method: Composition-based stats.
 Identities = 188/299 (62%), Positives = 231/299 (77%), Gaps = 8/299 (2%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+LV+K+T+V+ QG TG  GTFH+EQAI Y  T++VGG+ P KG        +++PVF 
Sbjct: 20  MSVLVNKDTRVICQGFTGAQGTFHSEQAIAY-GTKMVGGVTPGKGGQTH----LDLPVFN 74

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           +V EA   T ANASVIYVPP  A D+I+E+I+A +PLIVCITEGIPVLDMV+VK  L+ S
Sbjct: 75  SVVEAMRETEANASVIYVPPPFAADSIMEAIDAGMPLIVCITEGIPVLDMVKVKRALDAS 134

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            SRLIGPNCPGI+TP  CKIGIMPG I + G VGI+SRSGTLTYEAV QT+  GLGQST 
Sbjct: 135 KSRLIGPNCPGIITPGECKIGIMPGHIHKPGKVGIVSRSGTLTYEAVAQTTAAGLGQSTC 194

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPV GT FID LE+FLAD+ TE+IVM+GEIGGSAEE+AA +   +  R   KPI 
Sbjct: 195 VGIGGDPVNGTNFIDCLEMFLADDQTEAIVMIGEIGGSAEEDAAAYYMAQPNR---KPIA 251

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
           GF+AG+TAPPGR MGHAGA++SGG G A DKI AM+ AG  +A SPA +G +++  +G+
Sbjct: 252 GFIAGQTAPPGRRMGHAGAIVSGGSGAAVDKIAAMETAGFVMASSPAALGDAVMTAIGN 310


>gi|75120763|sp|Q6DQL1|SUCA2_SOLLC RecName: Full=Succinyl-CoA ligase [ADP-forming] subunit alpha-2,
           mitochondrial; Short=SlSCoALalpha2; Flags: Precursor
 gi|49617539|gb|AAT67464.1| succinyl-CoA ligase alpha 2 subunit [Solanum lycopersicum]
          Length = 337

 Score =  341 bits (874), Expect = 8e-92,   Method: Composition-based stats.
 Identities = 187/298 (62%), Positives = 232/298 (77%), Gaps = 9/298 (3%)

Query: 2   SILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFTT 61
           ++ VDKNT+V+ QG+TGK GTFHTEQAI Y  T++VGG+ PKKG T   G    +PVF T
Sbjct: 43  AVFVDKNTRVICQGITGKNGTFHTEQAIEY-GTKMVGGVTPKKGGTEHLG----LPVFNT 97

Query: 62  VAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS- 120
           VAEAK  T ANASV+YVPP  A  AI+E++EAE+ L+VCITEGIP  DMVRVKA L+K  
Sbjct: 98  VAEAKVETKANASVVYVPPPFAAAAIMEAMEAELDLVVCITEGIPQHDMVRVKAALKKQL 157

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            +RLIGPNCPGI+ P  CKIGIMPG I + G +GI+SRSGTLTYEAVFQT+  GLGQST 
Sbjct: 158 RTRLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTC 217

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP  GT F+D LE F+AD  TE IV++GEIGG+AEE+AA  +K+    G +KP+V
Sbjct: 218 VGIGGDPFNGTNFVDCLERFIADPQTEGIVLIGEIGGTAEEDAAALIKE---SGTQKPVV 274

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            F+AG TAPPGR MGHAGA++SGGKG A+DKI A+KEAG+ +  SPA+IG +++++  
Sbjct: 275 AFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKALKEAGVTVCESPAKIGVTMLDVFK 332


>gi|6980727|pdb|1CQI|A Chain A, Crystal Structure Of The Complex Of Adp And Mg2+ With
           Dephosphorylated E. Coli Succinyl-Coa Synthetase
 gi|6980729|pdb|1CQI|D Chain D, Crystal Structure Of The Complex Of Adp And Mg2+ With
           Dephosphorylated E. Coli Succinyl-Coa Synthetase
 gi|6980731|pdb|1CQJ|A Chain A, Crystal Structure Of Dephosphorylated E. Coli Succinyl-Coa
           Synthetase
 gi|6980733|pdb|1CQJ|D Chain D, Crystal Structure Of Dephosphorylated E. Coli Succinyl-Coa
           Synthetase
          Length = 286

 Score =  341 bits (874), Expect = 8e-92,   Method: Composition-based stats.
 Identities = 171/295 (57%), Positives = 216/295 (73%), Gaps = 9/295 (3%)

Query: 2   SILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFTT 61
           SIL+DKNTKV+ QG TG  GTFH+EQAI Y  T++VGG+ P KG T   G    +PVF T
Sbjct: 1   SILIDKNTKVICQGFTGSQGTFHSEQAIAY-GTKMVGGVTPGKGGTTHLG----LPVFNT 55

Query: 62  VAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKSS 121
           V EA   T A ASVIYVP     D+I+E+I+A I LI+ ITEGIP LDM+ VK +L+++ 
Sbjct: 56  VREAVAATGATASVIYVPAPFCKDSILEAIDAGIKLIITITEGIPTLDMLTVKVKLDEAG 115

Query: 122 SRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTAV 181
            R+IGPNCPG++TP  CKIGI PG I + G VGI+SRSGTLTYEAV QT+  G GQST V
Sbjct: 116 VRMIGPNCPGVITPGECKIGIQPGHIHKPGKVGIVSRSGTLTYEAVKQTTDYGFGQSTCV 175

Query: 182 GIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIVG 241
           GIGGDP+ G+ FID+LE+F  D  TE+IVM+GEIGGSAEEEAA ++K+       KP+VG
Sbjct: 176 GIGGDPIPGSNFIDILEMFEKDPQTEAIVMIGEIGGSAEEEAAAYIKEH----VTKPVVG 231

Query: 242 FVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVEL 296
           ++AG TAP G+ MGHAGA+I+GGKG A++K  A++ AG+    S A IG +L  +
Sbjct: 232 YIAGVTAPKGKRMGHAGAIIAGGKGTADEKFAALEAAGVKTVRSLADIGEALKTV 286


>gi|110834353|ref|YP_693212.1| succinyl-CoA synthetase subunit alpha [Alcanivorax borkumensis SK2]
 gi|110647464|emb|CAL16940.1| succinyl-CoA synthetase, alpha subunit [Alcanivorax borkumensis
           SK2]
          Length = 291

 Score =  341 bits (874), Expect = 8e-92,   Method: Composition-based stats.
 Identities = 169/299 (56%), Positives = 213/299 (71%), Gaps = 10/299 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L+DKNTKV+ QG TG  GT H+EQAI Y  TQ+VGG+ P KG     G    +PVF 
Sbjct: 1   MSVLIDKNTKVICQGFTGSQGTLHSEQAIEY-GTQMVGGVTPGKGGQTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TVAEA   T A ASVIYVP     D+I+E+ +A I LIVCITEG+P LDM+ VK  + + 
Sbjct: 56  TVAEAVAETGATASVIYVPAPFCKDSILEAADAGIELIVCITEGVPALDMLFVKEYISRK 115

Query: 121 S-SRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQST 179
              RLIGPNCPG++TP  CKIGIMPG I   G VGI+SRSGTLTYEAV QT++ G GQS+
Sbjct: 116 DGIRLIGPNCPGVITPGECKIGIMPGHIHTPGKVGIVSRSGTLTYEAVNQTTKLGFGQSS 175

Query: 180 AVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPI 239
            +GIGGDP+ G  FID LELF  D  TE+IVMVGEIGG+AE+EAA ++K+       KP+
Sbjct: 176 CIGIGGDPIPGMTFIDALELFQNDPQTEAIVMVGEIGGTAEDEAAAYIKEH----VTKPV 231

Query: 240 VGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           V ++AG TAP G+ MGHAGA+I+GGKG A++K   ++ AG+    +PA IG+++ E  G
Sbjct: 232 VSYIAGVTAPAGKRMGHAGAIIAGGKGTADEKFAVLEAAGVKTVRNPAEIGKAVKEATG 290


>gi|197117852|ref|YP_002138279.1| succinyl-CoA synthetase subunit alpha [Geobacter bemidjiensis Bem]
 gi|197087212|gb|ACH38483.1| succinyl-CoA synthetase, alpha subunit [Geobacter bemidjiensis Bem]
          Length = 308

 Score =  341 bits (874), Expect = 8e-92,   Method: Composition-based stats.
 Identities = 173/297 (58%), Positives = 223/297 (75%), Gaps = 9/297 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSILVDKNTKV+ QG+TG  G FH + A  Y  TQ+VGG+ P KG +   G     PVF 
Sbjct: 1   MSILVDKNTKVITQGITGATGLFHAQGAREY-GTQMVGGVTPGKGGSNVDG----FPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TVAEA E+T ANASVIYVPP  A D+I+E+I+A + L+ CITEGIPVLDMV+VK  ++  
Sbjct: 56  TVAEAVEKTGANASVIYVPPPFAADSIMEAIDAGLDLVCCITEGIPVLDMVKVKQYMQGK 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            +RLIGPNCPG++TP  CKIGIMPG I R G VG++SRSGTLTYEAV+Q +  GLGQST 
Sbjct: 116 KTRLIGPNCPGVITPGQCKIGIMPGYIHRPGKVGVVSRSGTLTYEAVWQLTGYGLGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPV GT  +D L++F  D  TE+++M+GEIGGSAEEEAA F+K+       KP+ 
Sbjct: 176 VGIGGDPVNGTSHLDCLKMFEEDPDTEAVIMIGEIGGSAEEEAAYFVKEHM----TKPVA 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELL 297
           G++AG+TAPPG+ MGHAGA+ISGGKG A +K+  ++  GI +A +PA + ++L+++ 
Sbjct: 232 GYIAGRTAPPGKRMGHAGAIISGGKGTAAEKVAILESCGISVAATPAEMAQALMKVY 288


>gi|120598559|ref|YP_963133.1| succinyl-CoA synthetase subunit alpha [Shewanella sp. W3-18-1]
 gi|146293362|ref|YP_001183786.1| succinyl-CoA synthetase subunit alpha [Shewanella putrefaciens
           CN-32]
 gi|120558652|gb|ABM24579.1| succinyl-CoA synthetase (ADP-forming) alpha subunit [Shewanella sp.
           W3-18-1]
 gi|145565052|gb|ABP75987.1| succinyl-CoA synthetase (ADP-forming) alpha subunit [Shewanella
           putrefaciens CN-32]
 gi|319426664|gb|ADV54738.1| succinyl-CoA synthetase, alpha subunit [Shewanella putrefaciens
           200]
          Length = 290

 Score =  341 bits (874), Expect = 9e-92,   Method: Composition-based stats.
 Identities = 176/298 (59%), Positives = 218/298 (73%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+TKV+ QG TG  GTFH++QAI Y  TQ+VGG+ P KG T   G    +PVF 
Sbjct: 1   MSVLINKDTKVICQGFTGGQGTFHSQQAIDY-GTQMVGGVSPGKGGTEHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV +A   T A ASVIYVP     DAI+E+I+  I LIVCITEGIP LDM++VK +LE++
Sbjct: 56  TVKDAVAATGATASVIYVPAPFCKDAILEAIDGGIELIVCITEGIPTLDMLQVKVKLEET 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TP  CKIGIMPG I  KG VGI+SRSGTLTYEAV QT+ EG GQST 
Sbjct: 116 GVRMIGPNCPGVITPGECKIGIMPGHIHLKGKVGIVSRSGTLTYEAVKQTTDEGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ GT FIDVLE+F  D  TE+IVM+GEIGG+AEEEAA ++K        KP+V
Sbjct: 176 VGIGGDPIPGTNFIDVLEMFQNDPQTEAIVMIGEIGGTAEEEAAAYIKAH----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            ++AG TAP G+ MGHAGA+I+GGKG A DK  A++ AG+    S A IG++L    G
Sbjct: 232 SYIAGVTAPAGKRMGHAGAIIAGGKGTAADKFAALEAAGVTTVRSLADIGKALRAKTG 289


>gi|163784985|ref|ZP_02179728.1| succinyl-CoA ligase alpha subunit [Hydrogenivirga sp. 128-5-R1-1]
 gi|159879744|gb|EDP73505.1| succinyl-CoA ligase alpha subunit [Hydrogenivirga sp. 128-5-R1-1]
          Length = 292

 Score =  341 bits (874), Expect = 9e-92,   Method: Composition-based stats.
 Identities = 165/300 (55%), Positives = 220/300 (73%), Gaps = 11/300 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+LV+KNTKV+VQG+TG+ G+FH  Q   Y  TQVVGG+ P KG     G    +PVF 
Sbjct: 1   MSVLVNKNTKVIVQGITGREGSFHATQCKAY-GTQVVGGVTPGKGGQEVEG----IPVFD 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           +V EA + T A+ S+I+VPP  A DAI+E+++A +  ++CITEGIPV DM+ VK  ++  
Sbjct: 56  SVREAVDNTGADCSLIFVPPPFAADAIVEAVDAGVKTVICITEGIPVNDMIPVKNYIKTY 115

Query: 121 --SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQS 178
              + LIGPNCPG++TP+  KIGIMPG IF+KG+VG++SRSGTLTYEA +Q +Q G+GQS
Sbjct: 116 YPETVLIGPNCPGVITPEEAKIGIMPGHIFKKGNVGLVSRSGTLTYEAAYQLTQRGIGQS 175

Query: 179 TAVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKP 238
           TAVGIGGDPV GT F DVL+ F  D  TE+IVM+GEIGG+AEEEAA+F+K+       KP
Sbjct: 176 TAVGIGGDPVPGTVFADVLKWFQDDPETEAIVMIGEIGGTAEEEAAEFIKEY----VTKP 231

Query: 239 IVGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           +V ++AG TAPPG+ MGHAGA+I+GGKG AE+K  A++ AG     + + IG  + ++L 
Sbjct: 232 VVAYIAGVTAPPGKRMGHAGAIIAGGKGTAEEKYKALEAAGATTVKNISTIGEVVEKVLK 291


>gi|218692341|ref|YP_002400553.1| Succinyl-CoA synthetase subunit alpha (SCS-alpha) [Escherichia coli
           ED1a]
 gi|218429905|emb|CAR10879.2| Succinyl-CoA synthetase alpha chain (SCS-alpha) [Escherichia coli
           ED1a]
          Length = 290

 Score =  341 bits (874), Expect = 9e-92,   Method: Composition-based stats.
 Identities = 169/299 (56%), Positives = 221/299 (73%), Gaps = 10/299 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+T+VLVQG+TGK GTFHTEQAI Y  TQ+VGG+ P KG       +++ PVF 
Sbjct: 1   MSVLINKHTRVLVQGITGKNGTFHTEQAIAY-GTQIVGGVTPGKGGQ----RHLDRPVFD 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           ++ EA  +T A+ASVIYVP     D+++E+IEA + L+V ITEG+P LDMV+V+  L+  
Sbjct: 56  SMKEAMRQTEADASVIYVPAPFVLDSVVEAIEAGVKLVVVITEGVPTLDMVKVRRLLDCH 115

Query: 121 S-SRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQST 179
              RLIGPNCPG++TP  CKIGIMPG I R G +GI+SRSGTLTYEAV QT+  GLGQST
Sbjct: 116 PDVRLIGPNCPGVITPGECKIGIMPGEIHRPGRIGIVSRSGTLTYEAVAQTTALGLGQST 175

Query: 180 AVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPI 239
            +GIGGDPV GT FID L LF  D  T++++M+GEIGG+AEE AA+F++DE      KP+
Sbjct: 176 CIGIGGDPVPGTNFIDALRLFENDPQTDAVIMIGEIGGNAEERAAEFIRDEM----NKPV 231

Query: 240 VGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           VG++AG TAP G+ MGHAGA+ISGG G AEDK  A  +AG+    +PA +G +L  ++ 
Sbjct: 232 VGYIAGVTAPKGKRMGHAGAIISGGSGSAEDKFRAFDKAGMAWTRNPALLGETLWNVIK 290


>gi|192288618|ref|YP_001989223.1| succinyl-CoA synthetase, alpha subunit [Rhodopseudomonas palustris
           TIE-1]
 gi|192282367|gb|ACE98747.1| succinyl-CoA synthetase, alpha subunit [Rhodopseudomonas palustris
           TIE-1]
          Length = 294

 Score =  341 bits (874), Expect = 9e-92,   Method: Composition-based stats.
 Identities = 215/299 (71%), Positives = 249/299 (83%), Gaps = 5/299 (1%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL+D NT+V+ QG TGK GTFH+E AI Y  T++VGG  P KG +   G    +PVF 
Sbjct: 1   MSILIDSNTRVICQGFTGKNGTFHSEAAIAY-GTKMVGGTSPGKGGSTHLG----LPVFD 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA+++T A+ASVIYVPP GA DAI E+I+AEIPLIVCITEGIPVLDMVRVK  L  S
Sbjct: 56  TVREARDKTGADASVIYVPPPGAADAICEAIDAEIPLIVCITEGIPVLDMVRVKRSLNGS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            SRLIGPNCPG++T   CKIGIMP +IF+ GSVGI+SRSGTLTYEAVFQTS EGLGQ+TA
Sbjct: 116 KSRLIGPNCPGVMTAGECKIGIMPANIFKPGSVGIVSRSGTLTYEAVFQTSAEGLGQTTA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPVKGTEFIDVLE+FLAD+ TESI+M+GEIGGSAEE+AAQFL DEAKRGRKKP+V
Sbjct: 176 VGIGGDPVKGTEFIDVLEMFLADDKTESIIMIGEIGGSAEEDAAQFLIDEAKRGRKKPMV 235

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
           GF+AG TAPPGR MGHAGA+ISGGKG A  K  AM+ AGI ++PSPAR+G++L E L S
Sbjct: 236 GFIAGVTAPPGRRMGHAGAIISGGKGDAASKTAAMEAAGITVSPSPARLGKTLAEKLKS 294


>gi|157835442|pdb|2NUA|A Chain A, C123av Mutant Of E. Coli Succinyl-Coa Synthetase
 gi|157835444|pdb|2NUA|D Chain D, C123av Mutant Of E. Coli Succinyl-Coa Synthetase
          Length = 288

 Score =  341 bits (874), Expect = 1e-91,   Method: Composition-based stats.
 Identities = 171/297 (57%), Positives = 216/297 (72%), Gaps = 9/297 (3%)

Query: 2   SILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFTT 61
           SIL+DKNTKV+ QG TG  GTFH+EQAI Y  T++VGG+ P KG T   G    +PVF T
Sbjct: 1   SILIDKNTKVICQGFTGSQGTFHSEQAIAY-GTKMVGGVTPGKGGTTHLG----LPVFNT 55

Query: 62  VAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKSS 121
           V EA   T A ASVIYVP     D+I+E+I+A I LI+ ITEGIP LDM+ VK +L+++ 
Sbjct: 56  VREAVAATGATASVIYVPAPFCKDSILEAIDAGIKLIITITEGIPTLDMLTVKVKLDEAG 115

Query: 122 SRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTAV 181
            R+IGPN PG++TP  CKIGI PG I + G VGI+SRSGTLTYEAV QT+  G GQST V
Sbjct: 116 VRMIGPNVPGVITPGECKIGIQPGHIHKPGKVGIVSRSGTLTYEAVKQTTDYGFGQSTCV 175

Query: 182 GIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIVG 241
           GIGGDP+ G+ FID+LE+F  D  TE+IVM+GEIGGSAEEEAA ++K+       KP+VG
Sbjct: 176 GIGGDPIPGSNFIDILEMFEKDPQTEAIVMIGEIGGSAEEEAAAYIKEH----VTKPVVG 231

Query: 242 FVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           ++AG TAP G+ MGHAGA+I+GGKG A++K  A++ AG+    S A IG +L  +L 
Sbjct: 232 YIAGVTAPKGKRMGHAGAIIAGGKGTADEKFAALEAAGVKTVRSLADIGEALKTVLK 288


>gi|17986423|ref|NP_539057.1| succinyl-CoA synthetase subunit alpha [Brucella melitensis bv. 1
           str. 16M]
 gi|225853363|ref|YP_002733596.1| succinyl-CoA synthetase subunit alpha [Brucella melitensis ATCC
           23457]
 gi|256045531|ref|ZP_05448414.1| succinyl-CoA synthetase subunit alpha [Brucella melitensis bv. 1
           str. Rev.1]
 gi|256112258|ref|ZP_05453179.1| succinyl-CoA synthetase subunit alpha [Brucella melitensis bv. 3
           str. Ether]
 gi|256263153|ref|ZP_05465685.1| succinyl-CoA ligase [Brucella melitensis bv. 2 str. 63/9]
 gi|260562841|ref|ZP_05833327.1| succinyl-CoA ligase [Brucella melitensis bv. 1 str. 16M]
 gi|265991955|ref|ZP_06104512.1| succinyl-CoA synthetase subunit alpha [Brucella melitensis bv. 1
           str. Rev.1]
 gi|265993687|ref|ZP_06106244.1| succinyl-CoA synthetase subunit alpha [Brucella melitensis bv. 3
           str. Ether]
 gi|17982017|gb|AAL51321.1| succinyl-CoA synthetase alpha chain [Brucella melitensis bv. 1 str.
           16M]
 gi|225641728|gb|ACO01642.1| succinyl-CoA synthetase, alpha subunit [Brucella melitensis ATCC
           23457]
 gi|260152857|gb|EEW87949.1| succinyl-CoA ligase [Brucella melitensis bv. 1 str. 16M]
 gi|262764668|gb|EEZ10589.1| succinyl-CoA synthetase subunit alpha [Brucella melitensis bv. 3
           str. Ether]
 gi|263003021|gb|EEZ15314.1| succinyl-CoA synthetase subunit alpha [Brucella melitensis bv. 1
           str. Rev.1]
 gi|263093058|gb|EEZ17208.1| succinyl-CoA ligase [Brucella melitensis bv. 2 str. 63/9]
 gi|289467877|gb|ADC95623.1| succinyl-CoA synthetase subunit alpha [Brucella melitensis bv. 1
           str. M5]
 gi|326409927|gb|ADZ66992.1| succinyl-CoA synthetase subunit alpha [Brucella melitensis M28]
 gi|326539640|gb|ADZ87855.1| succinyl-CoA synthetase, alpha subunit [Brucella melitensis M5-90]
          Length = 300

 Score =  341 bits (874), Expect = 1e-91,   Method: Composition-based stats.
 Identities = 234/299 (78%), Positives = 269/299 (89%), Gaps = 1/299 (0%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTG-GNVNVPVF 59
           MSILV+K+TKVLVQGLTGK GTFHTEQA+ Y  TQ+VGGIHPKKG   W G     +P+F
Sbjct: 1   MSILVNKDTKVLVQGLTGKTGTFHTEQALAYYGTQMVGGIHPKKGGETWEGSKGEKLPIF 60

Query: 60  TTVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEK 119
            TVAE KERT A+ASVIYVPP+GA DAIIE+IEAEI  IVCITEGIPV+D+VRVK RLE+
Sbjct: 61  ATVAEGKERTGADASVIYVPPAGAADAIIEAIEAEIGFIVCITEGIPVMDIVRVKERLER 120

Query: 120 SSSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQST 179
           S SRL+GPNCPGILTP+ CKIGIMPG+IF+KGSVG++SRSGTLTYEAVFQTS EGLGQ+T
Sbjct: 121 SKSRLLGPNCPGILTPEECKIGIMPGNIFKKGSVGVVSRSGTLTYEAVFQTSNEGLGQTT 180

Query: 180 AVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPI 239
           AVGIGGDPVKGTEFIDVLE+FLAD+ T+SIVM+GEIGGSAEE+AAQFLKDEAKRGRKKP+
Sbjct: 181 AVGIGGDPVKGTEFIDVLEMFLADDETKSIVMIGEIGGSAEEDAAQFLKDEAKRGRKKPM 240

Query: 240 VGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           VGF+AG+TA  GRTMGHAGAVISGGKGGAEDKI AM+ AGI ++PSPA++G++LVE+L 
Sbjct: 241 VGFIAGRTALAGRTMGHAGAVISGGKGGAEDKIAAMESAGIRVSPSPAQLGKTLVEVLK 299


>gi|316931840|ref|YP_004106822.1| succinyl-CoA synthetase subunit alpha [Rhodopseudomonas palustris
           DX-1]
 gi|315599554|gb|ADU42089.1| succinyl-CoA synthetase, alpha subunit [Rhodopseudomonas palustris
           DX-1]
          Length = 294

 Score =  340 bits (873), Expect = 1e-91,   Method: Composition-based stats.
 Identities = 216/299 (72%), Positives = 248/299 (82%), Gaps = 5/299 (1%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL+D NT+V+ QG TGK GTFH+E AI Y  T++VGG  P KG +   G    +PVF 
Sbjct: 1   MSILIDSNTRVICQGFTGKNGTFHSEAAIAY-GTKMVGGTSPGKGGSTHLG----LPVFD 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA+E+T A+ASVIYVPP GA DAI E+I+AEIPLIVCITEGIPVLDMVRVK  L  S
Sbjct: 56  TVREAREKTGADASVIYVPPPGAADAICEAIDAEIPLIVCITEGIPVLDMVRVKRSLNGS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            SRLIGPNCPG++T   CKIGIMP +IF+ GSVGI+SRSGTLTYEAVFQTS EGLGQ+TA
Sbjct: 116 KSRLIGPNCPGVMTAGECKIGIMPANIFKPGSVGIVSRSGTLTYEAVFQTSAEGLGQTTA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPVKGTEFIDVLE+FLAD+ TESI+M+GEIGGSAEE+AAQFL DEAKRGRKKP V
Sbjct: 176 VGIGGDPVKGTEFIDVLEMFLADDKTESIIMIGEIGGSAEEDAAQFLIDEAKRGRKKPTV 235

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
           GF+AG TAPPGR MGHAGA+ISGGKG A  K  AM+ AGI ++PSPAR+G++L E L S
Sbjct: 236 GFIAGVTAPPGRRMGHAGAIISGGKGDAASKTAAMEAAGITVSPSPARLGKTLAEKLKS 294


>gi|299133569|ref|ZP_07026763.1| succinyl-CoA synthetase, alpha subunit [Afipia sp. 1NLS2]
 gi|298591405|gb|EFI51606.1| succinyl-CoA synthetase, alpha subunit [Afipia sp. 1NLS2]
          Length = 302

 Score =  340 bits (873), Expect = 1e-91,   Method: Composition-based stats.
 Identities = 211/298 (70%), Positives = 252/298 (84%), Gaps = 5/298 (1%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+++DKNTKV+ QG TGK GTFH+E AI Y  T++VGG  P KG +   G    +PVF 
Sbjct: 1   MSVMIDKNTKVICQGFTGKNGTFHSEAAIAY-GTKMVGGTSPGKGGSTHLG----LPVFD 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           +VAEA+ +T A+ASV+YVPP GA DAI E+I+AEIPLIVCITEGIPVLDMVRVK  L  S
Sbjct: 56  SVAEARAKTGADASVVYVPPPGAADAICEAIDAEIPLIVCITEGIPVLDMVRVKRALSGS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            SRL+GPNCPG++T   CKIGIMP +IF+ G+VGI+SRSGTLTYEAVFQT+Q G GQ+TA
Sbjct: 116 KSRLLGPNCPGVVTAGECKIGIMPTNIFKPGNVGIVSRSGTLTYEAVFQTTQVGFGQTTA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPVKGTEFIDVLE+FLAD+ TESI+M+GEIGGSAEE+AAQFLKDEAKRGRKKP+V
Sbjct: 176 VGIGGDPVKGTEFIDVLEMFLADDKTESIIMIGEIGGSAEEDAAQFLKDEAKRGRKKPMV 235

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           GF+AG+TAPPGR MGHAGA+++GGKG AE KI AM+ AGI ++ SPAR+G +LVELL 
Sbjct: 236 GFIAGRTAPPGRRMGHAGAIVAGGKGDAESKIAAMEAAGIAVSASPARLGSTLVELLK 293


>gi|229541103|ref|ZP_04430163.1| succinyl-CoA synthetase, alpha subunit [Bacillus coagulans 36D1]
 gi|229325523|gb|EEN91198.1| succinyl-CoA synthetase, alpha subunit [Bacillus coagulans 36D1]
          Length = 300

 Score =  340 bits (873), Expect = 1e-91,   Method: Composition-based stats.
 Identities = 178/299 (59%), Positives = 225/299 (75%), Gaps = 9/299 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSI V+K+TKV+VQG+TGK   FHT+Q + Y  T++VGG  P KG T   G    VPVF 
Sbjct: 1   MSIYVNKDTKVIVQGITGKTALFHTKQCLEY-GTKIVGGTSPGKGGTEVEG----VPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E+T A  SVIYVP   A DAI+E+++AE+ L++CITE IPVLDMV+VK  +E  
Sbjct: 56  TVKEAVEKTGATVSVIYVPAPFAADAIMEAVDAELDLVICITEHIPVLDMVKVKRYMEGK 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            +RLIGPNCPGI+TPD CKIGIMPG I +KG VG++SRSGTLTYEAV Q ++ G+GQ+ A
Sbjct: 116 KTRLIGPNCPGIITPDECKIGIMPGYIHKKGHVGVVSRSGTLTYEAVHQLTRAGIGQTGA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           +GIGGDPV GT FIDVL+ F  D  TE+++M+GEIGG+AEEEAA++++       KKP+V
Sbjct: 176 IGIGGDPVNGTNFIDVLKEFNNDPETEAVIMIGEIGGTAEEEAAKWVQANM----KKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
           GF+ G TAPPG+ MGHAGA+ISGGKG A +KI  M E GI +A +PA IG +LV +L  
Sbjct: 232 GFIGGVTAPPGKRMGHAGAIISGGKGTAAEKIRTMNECGIQVAETPAVIGETLVRVLKE 290


>gi|116749137|ref|YP_845824.1| succinyl-CoA synthetase subunit alpha [Syntrophobacter fumaroxidans
           MPOB]
 gi|116698201|gb|ABK17389.1| succinyl-CoA synthetase (ADP-forming) alpha subunit
           [Syntrophobacter fumaroxidans MPOB]
          Length = 293

 Score =  340 bits (873), Expect = 1e-91,   Method: Composition-based stats.
 Identities = 173/300 (57%), Positives = 213/300 (71%), Gaps = 9/300 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSI VDKNT++LVQG+TG+ G FHT     Y  T VV G+ P KG     G    +PVF 
Sbjct: 1   MSIWVDKNTRLLVQGITGREGQFHTINCKAY-GTNVVAGVTPGKGGQAVEG----IPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TVA+A + T ANA++++VPP    DAI+E+IEA IPLIV ITEGIPV+DM++VK  L+ S
Sbjct: 56  TVAKAVKETKANAAMVFVPPPFCADAILEAIEAGIPLIVAITEGIPVMDMMKVKNYLKSS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            SRLIGPNCPGI+TP  CKIGI PG I   G VGI+SRSGTLTYEAV Q  + G+GQST 
Sbjct: 116 KSRLIGPNCPGIITPGQCKIGIQPGHIHTPGPVGIVSRSGTLTYEAVHQIGKVGIGQSTV 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           +GIGGDPV GT FID L+ F  D  T++I+MVGEIGGSAEE+AA F+K    +   KP++
Sbjct: 176 IGIGGDPVNGTNFIDCLDAFQKDPQTKAIIMVGEIGGSAEEDAADFIK----KNVTKPVI 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGSL 300
           GF+AG TAPPGR MGHAGA+ISG  G A+ KI AM+ AGI +  S   +G+   E    +
Sbjct: 232 GFIAGLTAPPGRRMGHAGAIISGSSGTAQGKIKAMRAAGITVVESLGDMGQIAKEAFKKV 291


>gi|251792226|ref|YP_003006947.1| succinyl-CoA ligase [ADP-forming] subunit alpha [Aggregatibacter
           aphrophilus NJ8700]
 gi|247533614|gb|ACS96860.1| succinyl-CoA ligase [ADP-forming] subunit alpha [Aggregatibacter
           aphrophilus NJ8700]
          Length = 292

 Score =  340 bits (873), Expect = 1e-91,   Method: Composition-based stats.
 Identities = 175/299 (58%), Positives = 220/299 (73%), Gaps = 9/299 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL+D NTKV+ QG TG  GTFH++QA+ Y  T++VGG+ P KG T   G    +PVF 
Sbjct: 1   MSILIDNNTKVICQGFTGGQGTFHSQQALAY-GTKLVGGVSPGKGGTTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV +A     A A+VIYVP  G  DAI+E+I+A I LIVCITEGIP LDM+ VK RL ++
Sbjct: 56  TVRDAVRAIGATATVIYVPAPGCKDAILEAIDAGIQLIVCITEGIPTLDMLVVKQRLNQT 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TP+ CKIGIMPG I +KG +GI+SRSGTLTYEAV QT+ EG GQST 
Sbjct: 116 GVRMIGPNCPGVITPEECKIGIMPGDIHKKGKIGIVSRSGTLTYEAVKQTTDEGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ F+D+L+LF  D  TE+IVM+GEIGGSAEEEAA F+K        KP+V
Sbjct: 176 VGIGGDPIPGSNFVDILKLFQEDPQTEAIVMIGEIGGSAEEEAAVFIKQH----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
            ++AG TAP G+ MGHAGA+ISGGKG A++K  A++ AG+    S A+IG +L E L  
Sbjct: 232 SYIAGVTAPKGKRMGHAGAIISGGKGTADEKFVALEAAGVKTVRSLAQIGAALREALNK 290


>gi|262281283|ref|ZP_06059065.1| succinyl-CoA synthetase subunit alpha [Acinetobacter calcoaceticus
           RUH2202]
 gi|299768993|ref|YP_003731019.1| succinyl-CoA synthetase subunit alpha [Acinetobacter sp. DR1]
 gi|262257514|gb|EEY76250.1| succinyl-CoA synthetase subunit alpha [Acinetobacter calcoaceticus
           RUH2202]
 gi|298699081|gb|ADI89646.1| succinyl-CoA synthetase subunit alpha [Acinetobacter sp. DR1]
          Length = 296

 Score =  340 bits (873), Expect = 1e-91,   Method: Composition-based stats.
 Identities = 161/301 (53%), Positives = 221/301 (73%), Gaps = 11/301 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+TKVLVQG TGK GTFH+ QA+ Y  T+VVGG+ P KG T      +++PVF 
Sbjct: 1   MSVLINKDTKVLVQGFTGKNGTFHSAQALDY-GTKVVGGVTPGKGGTTH----LDLPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARL--E 118
           T+ EA   T A+ASVIYVP     D+I+E++++ + LIV ITEG+P +DM++ K  L   
Sbjct: 56  TMKEAVRETNADASVIYVPAPFVLDSIVEAVDSGVGLIVVITEGVPTIDMLKAKRYLETN 115

Query: 119 KSSSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQS 178
            + +RL+GPNCPG++TP  CKIGIMPG I + G +GI+SRSGTLTYEAV QT++ GLGQS
Sbjct: 116 GNGTRLVGPNCPGVITPGECKIGIMPGHIHQPGRIGIISRSGTLTYEAVAQTTKLGLGQS 175

Query: 179 TAVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKP 238
           T +GIGGDP+ G   I+ L+LF  D  T++I+M+GEIGG+AEEEAA+F+K        KP
Sbjct: 176 TCIGIGGDPIPGMNQIEALQLFQDDPDTDAIIMIGEIGGTAEEEAAEFIKSN----VTKP 231

Query: 239 IVGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           +VG++AG TAP G+ MGHAGA+ISGG+G AE+K  A + AG+    SPA +G +++++L 
Sbjct: 232 VVGYIAGVTAPKGKRMGHAGAIISGGQGTAEEKFAAFERAGMAYTRSPAELGSTMLQVLK 291

Query: 299 S 299
            
Sbjct: 292 E 292


>gi|218529902|ref|YP_002420718.1| succinyl-CoA synthetase, subunit alpha [Methylobacterium
           chloromethanicum CM4]
 gi|240138206|ref|YP_002962678.1| succinyl-CoA synthetase, alpha subunit [Methylobacterium extorquens
           AM1]
 gi|218522205|gb|ACK82790.1| succinyl-CoA synthetase, alpha subunit [Methylobacterium
           chloromethanicum CM4]
 gi|240008175|gb|ACS39401.1| succinyl-CoA synthetase, alpha subunit [Methylobacterium extorquens
           AM1]
          Length = 295

 Score =  340 bits (873), Expect = 1e-91,   Method: Composition-based stats.
 Identities = 222/299 (74%), Positives = 255/299 (85%), Gaps = 5/299 (1%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL+D+NTKV+ QG TGK GTFH+EQAI Y  T++VGG  P KG +   G    +PVF 
Sbjct: 1   MSILIDQNTKVICQGFTGKNGTFHSEQAIAY-GTKMVGGTSPGKGGSTHLG----LPVFD 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TVAEA+E T A+ASV+YVPP GA DAI E+I+AEIPLIVCITEGIPVLDMVRVK  LE S
Sbjct: 56  TVAEAREATGADASVVYVPPPGAADAICEAIQAEIPLIVCITEGIPVLDMVRVKRALEGS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            SRLIGPNCPG++T    KIGIMP +IF+ GSVGI+SRSGTLTYEAVFQT+ EGLGQ+TA
Sbjct: 116 KSRLIGPNCPGVVTAGQSKIGIMPANIFKPGSVGIVSRSGTLTYEAVFQTTVEGLGQTTA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPVKGTEFI +LELFLAD  TESIVM+GEIGGSAEEEAAQFL DEAKRGRKKP+V
Sbjct: 176 VGIGGDPVKGTEFISMLELFLADPKTESIVMIGEIGGSAEEEAAQFLADEAKRGRKKPMV 235

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
           GF+AG+TAPPGR MGHAGA+ISGGKGGAEDKI AM+ AGI ++PSPAR+G +LV++L S
Sbjct: 236 GFIAGRTAPPGRRMGHAGAIISGGKGGAEDKIAAMEAAGIRVSPSPARLGSTLVDVLKS 294


>gi|261407993|ref|YP_003244234.1| succinyl-CoA synthetase subunit alpha [Paenibacillus sp. Y412MC10]
 gi|329929342|ref|ZP_08283095.1| succinyl-CoA synthetase, alpha subunit [Paenibacillus sp. HGF5]
 gi|261284456|gb|ACX66427.1| succinyl-CoA synthetase, alpha subunit [Paenibacillus sp. Y412MC10]
 gi|328936711|gb|EGG33154.1| succinyl-CoA synthetase, alpha subunit [Paenibacillus sp. HGF5]
          Length = 309

 Score =  340 bits (873), Expect = 1e-91,   Method: Composition-based stats.
 Identities = 178/304 (58%), Positives = 228/304 (75%), Gaps = 10/304 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWT-----GGNVN 55
           MSIL+DKNTKV+ QG+TGK   FH + A+ Y  TQ+VGG  P KG T        G  V 
Sbjct: 1   MSILIDKNTKVITQGITGKTALFHAKGALDY-GTQMVGGTSPGKGGTEVEITLENGETVK 59

Query: 56  VPVFTTVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKA 115
           +PV+ TV EAK +T A ASVIYVPP+ A D+I+E+++AE+ L++CITEGIPVLDMV+V  
Sbjct: 60  LPVYNTVEEAKAKTGATASVIYVPPAFAADSILEAVDAEMDLVICITEGIPVLDMVKVSR 119

Query: 116 RLEKSSSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGL 175
            +E   +RLIGPNCPG++TP  CKIGIMPG I   G VG++SRSGTLTYEAV Q +  G+
Sbjct: 120 YMEGKKTRLIGPNCPGVITPGECKIGIMPGYIHTPGHVGVVSRSGTLTYEAVHQLTARGI 179

Query: 176 GQSTAVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGR 235
           GQS+AVGIGGDPVKGTEFIDVL LF  D  T++++M+GEIGG+AEEEAA+++K       
Sbjct: 180 GQSSAVGIGGDPVKGTEFIDVLRLFNEDPNTKAVIMIGEIGGTAEEEAAEWIKANM---- 235

Query: 236 KKPIVGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVE 295
            KP+VGF+ G TAPPG+ MGHAGA+ISGGKG A++KI  ++  GI +AP+PA +G +LV 
Sbjct: 236 TKPVVGFIGGATAPPGKRMGHAGAIISGGKGTAKEKIAVLEACGIKVAPTPAEMGSTLVS 295

Query: 296 LLGS 299
           +L  
Sbjct: 296 VLEE 299


>gi|329295939|ref|ZP_08253275.1| Succinyl-CoA synthetase, alpha subunit [Plautia stali symbiont]
          Length = 291

 Score =  340 bits (873), Expect = 1e-91,   Method: Composition-based stats.
 Identities = 171/297 (57%), Positives = 218/297 (73%), Gaps = 9/297 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSI++DKNTKV+ QG TG  GTFH+EQA+ Y  TQ+VGG+ P KG T   G    +PVF 
Sbjct: 1   MSIMIDKNTKVICQGFTGGQGTFHSEQALAY-GTQLVGGVTPGKGGTTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T A A+VIYVP     D I+E+I+A I LI+ ITEGIP LDM+ VK +L+++
Sbjct: 56  TVREAVEATGATATVIYVPAPFCKDGILEAIDAGIKLIITITEGIPTLDMLTVKVKLDEA 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TP  C IGIMPG I + G VGI+SRSGTLTYEAV QT+  G GQST 
Sbjct: 116 GVRMIGPNCPGVITPGECMIGIMPGHIHQPGRVGIVSRSGTLTYEAVKQTTDIGYGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L++F  D  TE+IVM+GEIGGSAEEEAA F+K+       KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILKMFQDDPQTEAIVMIGEIGGSAEEEAAAFIKEH----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELL 297
           G++AG TAP G+ MGHAGA+I+GGKG A++K  A++ AG+    S A IG ++  +L
Sbjct: 232 GYIAGVTAPKGKRMGHAGAIIAGGKGTADEKFAALEAAGVKTVRSLADIGDAVKAVL 288


>gi|152976201|ref|YP_001375718.1| succinyl-CoA synthetase subunit alpha [Bacillus cereus subsp.
           cytotoxis NVH 391-98]
 gi|152024953|gb|ABS22723.1| succinyl-CoA synthetase, alpha subunit [Bacillus cytotoxicus NVH
           391-98]
          Length = 300

 Score =  340 bits (873), Expect = 1e-91,   Method: Composition-based stats.
 Identities = 180/299 (60%), Positives = 230/299 (76%), Gaps = 9/299 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+LV+K+TKV+VQG+TG  G FHT+Q I Y  T++VGG+ P KG T   G    VPVF 
Sbjct: 1   MSVLVNKDTKVIVQGITGSQGIFHTKQMIEY-GTKIVGGVTPGKGGTEIEG----VPVFH 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV +A + T ANASVIYVPP+ A DAI+E+++AE+ L+VCITEGIPVLDMV+VK  +   
Sbjct: 56  TVEDAVKATGANASVIYVPPAFAADAIMEAVDAELDLVVCITEGIPVLDMVKVKKYMAGK 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            +RL+GPNCPGI+TPD CKIGIMPG I +KG VGI+SRSGTLTYEAV Q +Q G+GQSTA
Sbjct: 116 HTRLLGPNCPGIITPDECKIGIMPGYIHKKGHVGIVSRSGTLTYEAVHQLTQAGIGQSTA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPV GT+FID L+ F  DE T +++M+GEIGG+AEEEAA+++K        KP+V
Sbjct: 176 VGIGGDPVNGTDFIDALKAFNEDEETHAVIMIGEIGGTAEEEAAEWVKANM----TKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
           GF+ G+TAP G+ MGHAGA+ISGGKG A +KI  M+  GI +A +PA +G +L+ +L  
Sbjct: 232 GFIGGQTAPAGKRMGHAGAIISGGKGTAAEKIKTMEACGIKVAETPAVMGETLISVLKE 290


>gi|209965473|ref|YP_002298388.1| succinyl-CoA synthetase subunit alpha [Rhodospirillum centenum SW]
 gi|209958939|gb|ACI99575.1| succinyl-CoA synthetase, alpha subunit [Rhodospirillum centenum SW]
          Length = 290

 Score =  340 bits (873), Expect = 1e-91,   Method: Composition-based stats.
 Identities = 181/298 (60%), Positives = 235/298 (78%), Gaps = 8/298 (2%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           M++LV+K+TKV+ QG TG  GTFH+EQAI Y  T++VGG+ P KG T      +++PVF 
Sbjct: 1   MAVLVNKDTKVICQGFTGAQGTFHSEQAIAY-GTRMVGGVTPGKGGTTH----LDLPVFD 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TVA+A  +T ANASVIYVPP  A DAI+E+I+A IPL+VCITEGIPVLDMV+VK  L+ S
Sbjct: 56  TVADAVAKTGANASVIYVPPPFAADAILEAIDAGIPLVVCITEGIPVLDMVKVKRALQDS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            +RLIGPNCPG++TPD CKIGIMPG I R+G +GI+SRSGTLTYEAV QT+  GLGQST 
Sbjct: 116 GTRLIGPNCPGVITPDECKIGIMPGHIHRRGKIGIVSRSGTLTYEAVAQTTAAGLGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           +GIGGDPV GT F+D L++F  D  T+ I+M+GEIGG AE + A+F+K+    G KKP+V
Sbjct: 176 IGIGGDPVNGTSFVDALQMFAEDPETQGIIMIGEIGGDAEVKGAEFIKE---SGLKKPVV 232

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           GF+AG+TAPPGR MGHAGAVISGG   A+ K++A++ AG+ +A SPA +G ++++ +G
Sbjct: 233 GFIAGRTAPPGRRMGHAGAVISGGNDTADFKVDALRAAGVHVADSPASLGSTMLKAMG 290


>gi|254429340|ref|ZP_05043047.1| succinyl-CoA synthetase, alpha subunit subfamily [Alcanivorax sp.
           DG881]
 gi|196195509|gb|EDX90468.1| succinyl-CoA synthetase, alpha subunit subfamily [Alcanivorax sp.
           DG881]
          Length = 291

 Score =  340 bits (872), Expect = 1e-91,   Method: Composition-based stats.
 Identities = 169/299 (56%), Positives = 214/299 (71%), Gaps = 10/299 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L+DKNTKV+ QG TG  GT H+EQAI Y  TQ+VGG+ P KG     G    +PVF 
Sbjct: 1   MSVLIDKNTKVICQGFTGSQGTLHSEQAIEY-GTQMVGGVTPGKGGQTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TVAEA   T A ASVIYVP     D+I+E+ +A I LIVCITEG+P LDM+ VK  + + 
Sbjct: 56  TVAEAVAETGATASVIYVPAPFCKDSILEAADAGIELIVCITEGVPALDMLFVKEYISRM 115

Query: 121 S-SRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQST 179
              RLIGPNCPG++TP  CKIGIMPG I + G VGI+SRSGTLTYEAV QT++ G GQS+
Sbjct: 116 DGVRLIGPNCPGVITPGECKIGIMPGHIHKPGKVGIVSRSGTLTYEAVNQTTKLGFGQSS 175

Query: 180 AVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPI 239
            +GIGGDP+ G  FID LELF  D  TE+IVMVGEIGG+AE+EAA ++K+       KP+
Sbjct: 176 CIGIGGDPIPGMTFIDALELFQNDPQTEAIVMVGEIGGTAEDEAAAYIKEN----VTKPV 231

Query: 240 VGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           V ++AG TAP G+ MGHAGA+I+GGKG A++K   ++ AG+    +PA IG+++ E  G
Sbjct: 232 VSYIAGVTAPAGKRMGHAGAIIAGGKGTADEKFAVLEAAGVKTVRNPAEIGKAVKEATG 290


>gi|218781621|ref|YP_002432939.1| succinyl-CoA synthetase, alpha subunit [Desulfatibacillum
           alkenivorans AK-01]
 gi|218763005|gb|ACL05471.1| Succinyl co-A ligase (ADP-forming), alpha subunit
           [Desulfatibacillum alkenivorans AK-01]
          Length = 289

 Score =  340 bits (872), Expect = 1e-91,   Method: Composition-based stats.
 Identities = 174/298 (58%), Positives = 217/298 (72%), Gaps = 10/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSI V+K+TKV+VQG+TGK G FHT Q I Y  T++V G+ P KG         +VPVF 
Sbjct: 1   MSIFVNKDTKVVVQGITGKEGQFHTRQCIEY-GTKIVAGVTPGKGGQKMD----DVPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           +V EA E   AN S+I+VPP  A DAI+E+I+AE+ L+V ITEGIPVLDM++VK  L KS
Sbjct: 56  SVYEAVEGAGANCSMIFVPPPFAADAILEAIDAEVDLVVAITEGIPVLDMMKVKNHLAKS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRK-GSVGILSRSGTLTYEAVFQTSQEGLGQST 179
            +RLIGPNCPG++TP  CK+GIMPG I +  G +G++SRSGTLTYE V Q +Q+G+GQ+T
Sbjct: 116 KTRLIGPNCPGVITPGECKLGIMPGKIHKPGGPIGVVSRSGTLTYEVVHQLTQQGMGQTT 175

Query: 180 AVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPI 239
            +GIGGDPV GT FIDVL  F AD  T+ IVMVGEIGGSAEEEAA+F+K       K P+
Sbjct: 176 CIGIGGDPVNGTNFIDVLSAFEADPETKGIVMVGEIGGSAEEEAAEFIKAN----LKIPV 231

Query: 240 VGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELL 297
           VGF+AG TAPPGR MGHAGA+ISG  G A+ KI AMK+AGI +  +   +G    E+ 
Sbjct: 232 VGFIAGLTAPPGRRMGHAGAIISGSSGTAQAKIEAMKDAGIHVCENLGTLGELCKEVF 289


>gi|153006561|ref|YP_001380886.1| succinyl-CoA synthetase subunit alpha [Anaeromyxobacter sp.
           Fw109-5]
 gi|152030134|gb|ABS27902.1| succinyl-CoA synthetase, alpha subunit [Anaeromyxobacter sp.
           Fw109-5]
          Length = 329

 Score =  340 bits (872), Expect = 1e-91,   Method: Composition-based stats.
 Identities = 177/299 (59%), Positives = 220/299 (73%), Gaps = 9/299 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSI VD+NTKVLVQG+TG AG+FH EQ + Y  T+VV G+ P +G T +      VP+F 
Sbjct: 1   MSIFVDRNTKVLVQGITGAAGSFHAEQMLAY-GTRVVAGVTPGRGGTRF---EQRVPIFD 56

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLE-K 119
           TV EA   T ANASVI+VPP  A DAI+E+  A +PL+V ITEGIPVLDMV VK  L+ +
Sbjct: 57  TVGEAVRETGANASVIFVPPPFAADAIMEAAGAGVPLVVAITEGIPVLDMVTVKRFLQDR 116

Query: 120 SSSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQST 179
              RL+GPNCPG++TP  CKIGIMPG I R G +GI+SRSGTLTYEAV Q +  GLGQST
Sbjct: 117 PGVRLLGPNCPGVITPGQCKIGIMPGHIHRPGPIGIVSRSGTLTYEAVKQLTDLGLGQST 176

Query: 180 AVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPI 239
           AVGIGGDPV GT+F+D L  F +D  TE+IV++GEIGGS EE AA+++     +   KP+
Sbjct: 177 AVGIGGDPVNGTDFVDCLSRFESDPETEAIVLIGEIGGSGEEWAARYI----GKNVTKPV 232

Query: 240 VGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           VGF+AG++APPGR MGHAGAVISG  G AE KI A++EAG+ +  SPA IG ++  +L 
Sbjct: 233 VGFIAGRSAPPGRRMGHAGAVISGSSGTAEAKIAALREAGVVVCESPAGIGEAVRHVLS 291


>gi|254455553|ref|ZP_05068982.1| succinyl-CoA synthetase alpha chain [Candidatus Pelagibacter sp.
           HTCC7211]
 gi|207082555|gb|EDZ59981.1| succinyl-CoA synthetase alpha chain [Candidatus Pelagibacter sp.
           HTCC7211]
          Length = 291

 Score =  340 bits (872), Expect = 1e-91,   Method: Composition-based stats.
 Identities = 194/299 (64%), Positives = 236/299 (78%), Gaps = 8/299 (2%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSILV+KNTKV+ QG TG  GTFH+EQAI Y  T +VGG+ PKKG        +  PVF 
Sbjct: 1   MSILVNKNTKVICQGFTGAHGTFHSEQAIKY-GTNLVGGVTPKKGGQKH----LYRPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           +V EAK+   A+A++IYVP   A  AIIE+I+A I LIVCITEGIPV DM++V+ +L  S
Sbjct: 56  SVIEAKDSVGADATMIYVPAKFAAAAIIEAIDASIELIVCITEGIPVQDMLKVRQKLNGS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            SRLIGPNCPGI+TPD CKIGIMPG+I ++GSVGI+SRSGTLTYEAV QT++ GLGQST 
Sbjct: 116 KSRLIGPNCPGIITPDECKIGIMPGNIHKRGSVGIVSRSGTLTYEAVAQTTENGLGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           +GIGGDPV GT FID L+LFL DE T+SI+M+GEIGG+AEEEAA+F+K+      KKPIV
Sbjct: 176 IGIGGDPVNGTNFIDCLDLFLNDEETKSILMIGEIGGTAEEEAAEFVKNH---KIKKPIV 232

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
           GF+AG TAPPGR MGHAGA+ISGGKGGAEDKI  M+E+GI +A SP+ IG++L   L +
Sbjct: 233 GFIAGITAPPGRRMGHAGAIISGGKGGAEDKIKKMEESGITVAKSPSIIGKTLFNKLSN 291


>gi|21593483|gb|AAM65450.1| succinyl-CoA synthetase, alpha subunit [Arabidopsis thaliana]
          Length = 341

 Score =  340 bits (872), Expect = 1e-91,   Method: Composition-based stats.
 Identities = 183/299 (61%), Positives = 223/299 (74%), Gaps = 9/299 (3%)

Query: 2   SILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFTT 61
           ++ VDKNT+V+ QG+TGK GTFHTEQAI Y  T++V G+ PKKG T   G    +PVF T
Sbjct: 46  AVFVDKNTRVICQGITGKNGTFHTEQAIEY-GTKMVAGVTPKKGGTEHLG----LPVFNT 100

Query: 62  VAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLE-KS 120
           VAEAK  T ANASVIYVP   A  AI+E + AE+ LIVCITEGIP  DMVRVKA L  +S
Sbjct: 101 VAEAKAETKANASVIYVPAPFAAAAIMEGLAAELDLIVCITEGIPQHDMVRVKAALNSQS 160

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            +RLIGPNCPGI+ P  CKIGIMPG I + G +GI+SRSGTLTYEAVFQT+  GLGQST 
Sbjct: 161 KTRLIGPNCPGIIKPGECKIGIMPGYIHKPGKIGIVSRSGTLTYEAVFQTTAVGLGQSTC 220

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP  GT F+D LE F  D  TE IV++GEIGG+AEE+AA  +K+    G  KP+V
Sbjct: 221 VGIGGDPFNGTNFVDCLEKFFVDPQTEGIVLIGEIGGTAEEDAAALIKEN---GTDKPVV 277

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
            F+AG TAPPGR MGHAGA++SGGKG A+DK  ++++AG+ +  SPA+IG ++ EL   
Sbjct: 278 AFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKTKSLRDAGVKVVESPAKIGAAMFELFQE 336


>gi|223044245|ref|ZP_03614282.1| succinate-CoA ligase, alpha subunit subfamily [Staphylococcus
           capitis SK14]
 gi|222442395|gb|EEE48503.1| succinate-CoA ligase, alpha subunit subfamily [Staphylococcus
           capitis SK14]
          Length = 302

 Score =  340 bits (872), Expect = 2e-91,   Method: Composition-based stats.
 Identities = 170/299 (56%), Positives = 223/299 (74%), Gaps = 9/299 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+ +DKNTKV+VQG+TG    FHT+Q + Y  TQ+V G+ P KG     G    VPV+ 
Sbjct: 1   MSVFIDKNTKVMVQGITGSTALFHTKQMLDY-GTQIVAGVTPGKGGQVVEG----VPVYN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EAK  T AN SV+YVP   A D+I+E+ EAE+ +++CITE IPV+DMV+VK  L+  
Sbjct: 56  TVEEAKNETGANVSVVYVPAPFAADSILEAAEAELDMVICITEHIPVVDMVKVKRYLQGR 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            +RL+GPNCPG++T D CKIGIMPG I +KG VG++SRSGTLTYEAV Q ++EG+GQ+TA
Sbjct: 116 KTRLVGPNCPGVITADECKIGIMPGYIHKKGHVGVVSRSGTLTYEAVHQLTEEGIGQTTA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPV GT FIDVL+ F  D  T+++VM+GEIGG+AEEEAAQ++KD       KP+V
Sbjct: 176 VGIGGDPVNGTNFIDVLKEFNEDPETKAVVMIGEIGGTAEEEAAQWIKDNM----NKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
           GF+ G+TAPPG+ MGHAGA+ISGGKG A++KI  + + G+  A +P+ IG +L+E    
Sbjct: 232 GFIGGQTAPPGKRMGHAGAIISGGKGTADEKIKTLNDCGVETADTPSEIGTTLIEAAKK 290


>gi|260549009|ref|ZP_05823231.1| succinyl-CoA synthetase subunit alpha [Acinetobacter sp. RUH2624]
 gi|260408177|gb|EEX01648.1| succinyl-CoA synthetase subunit alpha [Acinetobacter sp. RUH2624]
          Length = 296

 Score =  340 bits (872), Expect = 2e-91,   Method: Composition-based stats.
 Identities = 161/301 (53%), Positives = 222/301 (73%), Gaps = 11/301 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+TKVLVQG TGK GTFH+ QA+ Y  T+VVGG+ P KG T      +++PVF 
Sbjct: 1   MSVLINKDTKVLVQGFTGKNGTFHSAQALDY-GTKVVGGVTPGKGGTTH----LDLPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARL--E 118
           T+ EA   T A+ASVIYVP     D+I+E++++ + LIV ITEG+P +DM++ K  L   
Sbjct: 56  TMKEAVRETNADASVIYVPAPFVLDSIVEAVDSGVGLIVVITEGVPTIDMLKAKRYLETN 115

Query: 119 KSSSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQS 178
            + +RL+GPNCPG++TP  CKIGIMPG I + G +GI+SRSGTLTYEAV QT++ GLGQS
Sbjct: 116 GNGTRLVGPNCPGVITPGECKIGIMPGHIHQPGRIGIISRSGTLTYEAVAQTTKLGLGQS 175

Query: 179 TAVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKP 238
           T +GIGGDP+ G   I+ L+LF  D  T++I+M+GEIGG+AEEEAA+F+K        KP
Sbjct: 176 TCIGIGGDPIPGMNQIEALQLFQDDPDTDAIIMIGEIGGTAEEEAAEFIKSN----VTKP 231

Query: 239 IVGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           +VG++AG TAP G+ MGHAGA+ISGG+G AE+K  A ++AG+    SPA +G +++++L 
Sbjct: 232 VVGYIAGVTAPKGKRMGHAGAIISGGQGTAEEKFAAFEKAGMAYTRSPAELGSTMLQVLK 291

Query: 299 S 299
            
Sbjct: 292 E 292


>gi|24373497|ref|NP_717540.1| succinyl-CoA synthase, alpha subunit [Shewanella oneidensis MR-1]
 gi|24347797|gb|AAN54984.1|AE015636_8 succinyl-CoA synthase, alpha subunit [Shewanella oneidensis MR-1]
          Length = 290

 Score =  340 bits (872), Expect = 2e-91,   Method: Composition-based stats.
 Identities = 175/298 (58%), Positives = 218/298 (73%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+TKV+ QG TG  GTFH++QAI Y  TQ+VGG+ P KG +   G    +PVF 
Sbjct: 1   MSVLINKDTKVICQGFTGGQGTFHSQQAIDY-GTQMVGGVSPGKGGSEHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV +A   T A ASVIYVP     DAI+E+I+  I LIVCITEGIP LDM++VK +LE++
Sbjct: 56  TVKDAVAATGATASVIYVPAPFCKDAILEAIDGGIELIVCITEGIPTLDMLQVKVKLEET 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TP  CKIGIMPG I  KG VGI+SRSGTLTYEAV QT+ EG GQST 
Sbjct: 116 GVRMIGPNCPGVITPGECKIGIMPGHIHLKGKVGIVSRSGTLTYEAVKQTTDEGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ GT FIDVLE+F  D  TE+IVM+GEIGG+AEEEAA ++K        KP+V
Sbjct: 176 VGIGGDPIPGTNFIDVLEMFQNDPQTEAIVMIGEIGGTAEEEAAAYIKAH----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            ++AG TAP G+ MGHAGA+I+GGKG A DK  A++ AG+    S A IG++L    G
Sbjct: 232 SYIAGVTAPAGKRMGHAGAIIAGGKGTAADKFAALEAAGVTTVRSLADIGKALRAKTG 289


>gi|52425406|ref|YP_088543.1| SucD protein [Mannheimia succiniciproducens MBEL55E]
 gi|52307458|gb|AAU37958.1| SucD protein [Mannheimia succiniciproducens MBEL55E]
          Length = 289

 Score =  340 bits (872), Expect = 2e-91,   Method: Composition-based stats.
 Identities = 176/298 (59%), Positives = 222/298 (74%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           M+IL++K TKV+ QG TG  GTFH+EQA+ Y  T++VGG+ P KG +   G    +PVF 
Sbjct: 1   MAILINKETKVICQGFTGGQGTFHSEQALAY-GTKLVGGVSPGKGGSIHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E+T A A+VIYVP     DAI+E+I A + LIVCITEGIP LDM++VK +L++S
Sbjct: 56  TVKEAVEQTGATATVIYVPAPFCKDAILEAIAAGLKLIVCITEGIPTLDMLQVKQKLDES 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
              +IGPNCPGI+ PD CKIGIMPG I +KG VGI+SRSGTLTYEAV QT+ EG GQS  
Sbjct: 116 GVVMIGPNCPGIIVPDECKIGIMPGYIHKKGRVGIVSRSGTLTYEAVKQTTDEGFGQSAC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L+L+ AD  TE+IVM+GEIGGSAEEEAA+F+K        KP+V
Sbjct: 176 VGIGGDPIPGSNFIDILKLYQADPKTEAIVMIGEIGGSAEEEAAEFIKAH----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            ++AG TAP G+ MGHAGA+ISGGKG A+DKI A++ AG+    S A IG +L  +L 
Sbjct: 232 SYIAGITAPKGKRMGHAGAIISGGKGTADDKIAALQSAGVICVKSLADIGAALKTVLK 289


>gi|153873563|ref|ZP_02002105.1| succinyl-CoA synthetase alpha chain [Beggiatoa sp. PS]
 gi|152069972|gb|EDN67896.1| succinyl-CoA synthetase alpha chain [Beggiatoa sp. PS]
          Length = 291

 Score =  340 bits (872), Expect = 2e-91,   Method: Composition-based stats.
 Identities = 172/300 (57%), Positives = 222/300 (74%), Gaps = 11/300 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSILVD +TKV+ QG TGK GTFH+EQ I Y  T++VGG+ P +G        +++PVF 
Sbjct: 1   MSILVDADTKVICQGFTGKQGTFHSEQCIAY-GTKLVGGVTPGRGGQTH----LDLPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E+T A  S+IYVP + A DAI+E+  + I LIVCITEGIPVLDM++VK  L   
Sbjct: 56  TVREAVEKTGATVSMIYVPAAFAADAILEAANSGIQLIVCITEGIPVLDMLKVKTALTDH 115

Query: 121 --SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQS 178
               RLIGPNCPGI+TP+ CKIGIMPG I ++G +GI+SRSGTLTYEAV QT+Q GLGQS
Sbjct: 116 YPQVRLIGPNCPGIITPNGCKIGIMPGFIHQRGRIGIVSRSGTLTYEAVAQTTQNGLGQS 175

Query: 179 TAVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKP 238
           T +G+GGDP+ G +FID L+LF  D  TE IVMVGEIGG+ EE AA ++K        KP
Sbjct: 176 TCIGMGGDPIHGMDFIDCLKLFEQDPQTEGIVMVGEIGGTDEEAAASYIKSA----ITKP 231

Query: 239 IVGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           +V ++AG TAPPG+ MGHAGA+I+GGKG A++KI A++ AG+ +A +PA IG+ +++ L 
Sbjct: 232 VVAYIAGVTAPPGKRMGHAGAIIAGGKGTAQEKIAALEAAGVSVARNPAEIGQRILKHLS 291


>gi|118590557|ref|ZP_01547959.1| succinyl-CoA synthetase subunit alpha [Stappia aggregata IAM 12614]
 gi|118437020|gb|EAV43659.1| succinyl-CoA synthetase subunit alpha [Stappia aggregata IAM 12614]
          Length = 302

 Score =  340 bits (872), Expect = 2e-91,   Method: Composition-based stats.
 Identities = 222/301 (73%), Positives = 267/301 (88%), Gaps = 3/301 (0%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWT---GGNVNVP 57
           MSILV+K+TK++VQGLTGK GTFHTEQA+ Y  T++V G+HPKKG   W+       ++P
Sbjct: 1   MSILVNKDTKIIVQGLTGKTGTFHTEQALEYYGTKMVAGVHPKKGGETWSSGVDSAASLP 60

Query: 58  VFTTVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARL 117
           ++ +V EA+E T A+ASVIYVPP+GAG AIIE+IEAE+P IVCITEGIPV DMV+VKA+L
Sbjct: 61  IYASVGEAREATGADASVIYVPPAGAGAAIIEAIEAEVPFIVCITEGIPVADMVKVKAKL 120

Query: 118 EKSSSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQ 177
           EKS SRL+GPNCPGILTP+ CKIGIMPGSIF+KGSVG++SRSGTLTYEAVFQT+  GLGQ
Sbjct: 121 EKSKSRLLGPNCPGILTPEECKIGIMPGSIFKKGSVGVVSRSGTLTYEAVFQTTNAGLGQ 180

Query: 178 STAVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKK 237
           +TAVGIGGDPVKGTEFIDVLE+FLAD+ T+SI+M+GEIGGSAEE+AAQFLKDEAKRGR K
Sbjct: 181 TTAVGIGGDPVKGTEFIDVLEMFLADDETQSIIMIGEIGGSAEEDAAQFLKDEAKRGRSK 240

Query: 238 PIVGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELL 297
           P+ GF+AG+TAPPGRTMGHAGAVISGGKGGAEDKI AM+ AGI ++PSPA++G +L+E+L
Sbjct: 241 PMAGFIAGRTAPPGRTMGHAGAVISGGKGGAEDKIAAMEAAGIKVSPSPAKLGETLLEVL 300

Query: 298 G 298
            
Sbjct: 301 K 301


>gi|282891424|ref|ZP_06299923.1| hypothetical protein pah_c161o041 [Parachlamydia acanthamoebae str.
           Hall's coccus]
 gi|281498709|gb|EFB41029.1| hypothetical protein pah_c161o041 [Parachlamydia acanthamoebae str.
           Hall's coccus]
          Length = 292

 Score =  340 bits (871), Expect = 2e-91,   Method: Composition-based stats.
 Identities = 173/300 (57%), Positives = 226/300 (75%), Gaps = 10/300 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSILV++ TKV+ QG+TGKAG FHTEQ + Y  +  VGG+ P KG     G    +PVF 
Sbjct: 1   MSILVNRKTKVITQGITGKAGNFHTEQCLQY-GSHFVGGVTPGKGGQETLG----LPVFE 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EAK+ T  +AS+I+VPP  A DAI+E+ +A IPLI+CITEGIP+ DM+ V + +  S
Sbjct: 56  TVYEAKKATQCDASMIFVPPPFAADAILEAEDAGIPLIICITEGIPIRDMLEVSSVMRTS 115

Query: 121 SS-RLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQST 179
            + RLIGPNCPGI+TP+ CKIGIMPG I RKG++GI+SRSGTLTYEAV+QT+Q GLGQS+
Sbjct: 116 KTSRLIGPNCPGIITPEECKIGIMPGYIHRKGNIGIVSRSGTLTYEAVWQTTQLGLGQSS 175

Query: 180 AVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPI 239
            VGIGGDP+ GT FID+LELF  D  T +I+++GEIGG AEE+AA+++K+       KP+
Sbjct: 176 CVGIGGDPLNGTNFIDILELFEKDSETNAILLIGEIGGEAEEQAAEWIKEHC----TKPV 231

Query: 240 VGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
             F+AG  APPGR MGHAGA++SGGKG A+ KI A+K+AG+ +  SPA +G ++ + L S
Sbjct: 232 AAFIAGTMAPPGRRMGHAGAIVSGGKGTAQGKIEALKKAGVHVTTSPAEMGSTIHKALRS 291


>gi|90421716|ref|YP_530086.1| succinyl-CoA synthetase, alpha subunit [Rhodopseudomonas palustris
           BisB18]
 gi|90103730|gb|ABD85767.1| succinyl-CoA synthetase (ADP-forming) alpha subunit
           [Rhodopseudomonas palustris BisB18]
          Length = 294

 Score =  340 bits (871), Expect = 2e-91,   Method: Composition-based stats.
 Identities = 210/299 (70%), Positives = 245/299 (81%), Gaps = 5/299 (1%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L+D NTKV+ QG TGK GTFH+E A+ Y  T++VGG  P KG +   G    +PVF 
Sbjct: 1   MSVLIDSNTKVICQGFTGKNGTFHSEAAMAY-GTKMVGGTSPGKGGSTHLG----LPVFD 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA ++T A+ASVIYVPP GA DAI E+I+AEIPLIVCITEGIPVLDMVRV+  L  S
Sbjct: 56  TVREAVDKTGADASVIYVPPPGAADAICEAIDAEIPLIVCITEGIPVLDMVRVRRSLIGS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            SRLIGPNCPG++T   CKIGIMP +IF+ GSVGI+SRSGTLTYEAVFQT++EGLGQ+TA
Sbjct: 116 KSRLIGPNCPGVMTAGECKIGIMPANIFKPGSVGIVSRSGTLTYEAVFQTTREGLGQTTA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPVKGTEFIDVLE+FLAD  T SI+M+GEIGGSAEE+AAQFL DEAKRGR KP V
Sbjct: 176 VGIGGDPVKGTEFIDVLEMFLADPKTTSIIMIGEIGGSAEEDAAQFLIDEAKRGRSKPTV 235

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
           GF+AG TAPPGR MGHAGA+ISGGKG A  K  AM+ AGI ++PSPAR+G++L E L S
Sbjct: 236 GFIAGVTAPPGRRMGHAGAIISGGKGDAASKTAAMEAAGIAVSPSPARLGKTLAEKLKS 294


>gi|89256838|ref|YP_514200.1| succinyl-CoA synthetase, alpha subunit [Francisella tularensis
           subsp. holarctica LVS]
 gi|115315225|ref|YP_763948.1| succinate--CoA ligase (ADP-forming) [Francisella tularensis subsp.
           holarctica OSU18]
 gi|156503006|ref|YP_001429071.1| succinyl-CoA synthetase alpha chain [Francisella tularensis subsp.
           holarctica FTNF002-00]
 gi|167009269|ref|ZP_02274200.1| succinyl-CoA synthetase alpha chain [Francisella tularensis subsp.
           holarctica FSC200]
 gi|254368117|ref|ZP_04984137.1| succinyl-CoA synthetase, alpha subunit [Francisella tularensis
           subsp. holarctica 257]
 gi|290954374|ref|ZP_06558995.1| succinyl-CoA synthetase, alpha subunit [Francisella tularensis
           subsp. holarctica URFT1]
 gi|295312195|ref|ZP_06802997.1| succinyl-CoA synthetase, alpha subunit [Francisella tularensis
           subsp. holarctica URFT1]
 gi|89144669|emb|CAJ79993.1| Succinyl-CoA synthetase, alpha subunit [Francisella tularensis
           subsp. holarctica LVS]
 gi|115130124|gb|ABI83311.1| succinate--CoA ligase (ADP-forming) [Francisella tularensis subsp.
           holarctica OSU18]
 gi|134253927|gb|EBA53021.1| succinyl-CoA synthetase, alpha subunit [Francisella tularensis
           subsp. holarctica 257]
 gi|156253609|gb|ABU62115.1| succinyl-CoA synthetase alpha chain [Francisella tularensis subsp.
           holarctica FTNF002-00]
          Length = 290

 Score =  340 bits (871), Expect = 2e-91,   Method: Composition-based stats.
 Identities = 173/298 (58%), Positives = 217/298 (72%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+LV KNTKVLVQG TGK GTFH+EQAI Y  T +VGG+ P KG T     N++ PVF 
Sbjct: 1   MSVLVYKNTKVLVQGFTGKNGTFHSEQAIAY-GTNIVGGVTPGKGGTT----NLDRPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           T+AEA   T A+ASVIYVP     D+ IE+I++ + L+V ITEG+P LDM+ VK  L+  
Sbjct: 56  TMAEAVAATGADASVIYVPAPFVKDSAIEAIDSGVKLVVIITEGVPTLDMLVVKEYLKDK 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPGI+TP  CKIGIMPG I  KG VGI+SRSGTLTYEAV QT++ G GQST 
Sbjct: 116 DVRVIGPNCPGIITPGECKIGIMPGHIHMKGKVGIISRSGTLTYEAVAQTTKLGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           +GIGGDP+ G   I+ L+L   D  TE+I+++GEIGG+AEEEAA+++K        KP++
Sbjct: 176 IGIGGDPIPGMNQIEALKLLENDPQTEAIILIGEIGGTAEEEAAEYIKHN----VTKPVI 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           G++AG TAPPG+ MGHAGA+ISGGKG AE+K  A + AGI    SPA IG+ L E+ G
Sbjct: 232 GYIAGVTAPPGKRMGHAGAIISGGKGTAEEKFAAFEAAGIAYTRSPAEIGKKLKEVTG 289


>gi|93004946|ref|YP_579383.1| succinyl-CoA synthetase, alpha subunit [Psychrobacter
           cryohalolentis K5]
 gi|92392624|gb|ABE73899.1| succinyl-CoA synthetase (ADP-forming) alpha subunit [Psychrobacter
           cryohalolentis K5]
          Length = 291

 Score =  340 bits (871), Expect = 2e-91,   Method: Composition-based stats.
 Identities = 173/299 (57%), Positives = 216/299 (72%), Gaps = 10/299 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L+DK+TKVLVQG TGK GTFH+EQAI Y  T+VVGG+ P KG     G    +PVF 
Sbjct: 1   MSVLIDKDTKVLVQGFTGKNGTFHSEQAIEY-GTKVVGGVTPGKGGQTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLE-K 119
           T++EA   T A+ASVIYVP     D+IIE+I+A + LIV ITEG+P LDM++ K  LE  
Sbjct: 56  TMSEAMAATQADASVIYVPAPFVLDSIIEAIDAGVKLIVVITEGVPTLDMLKAKRYLETA 115

Query: 120 SSSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQST 179
              RLIGPNCPG++TP  CKIGIMPG I   G VGI+SRSGTLTYEAV QT++ G GQST
Sbjct: 116 GDVRLIGPNCPGVITPGQCKIGIMPGHIHLPGKVGIISRSGTLTYEAVAQTTKLGFGQST 175

Query: 180 AVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPI 239
            +GIGGDP+ G   ID L+LF  D  TE+I+++GEIGG+AEEEAA ++KD       KP+
Sbjct: 176 CIGIGGDPIPGMNQIDALKLFQEDPQTEAIILIGEIGGTAEEEAAAYIKDH----VTKPV 231

Query: 240 VGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           VG++AG TAP G+ MGHAGA+ISGG+G AEDK  A + AGI     P+++G  L E+ G
Sbjct: 232 VGYIAGVTAPEGKRMGHAGAIISGGQGTAEDKFKAFEAAGIAYTRDPSKLGEKLKEVTG 290


>gi|254560766|ref|YP_003067861.1| succinyl-CoA synthetase subunit alpha [Methylobacterium extorquens
           DM4]
 gi|254268044|emb|CAX23915.1| succinyl-CoA synthetase, alpha subunit [Methylobacterium extorquens
           DM4]
          Length = 295

 Score =  340 bits (871), Expect = 2e-91,   Method: Composition-based stats.
 Identities = 221/299 (73%), Positives = 255/299 (85%), Gaps = 5/299 (1%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL+D+NTKV+ QG TGK GTFH+EQAI Y  T++VGG  P KG +   G    +PVF 
Sbjct: 1   MSILIDQNTKVICQGFTGKNGTFHSEQAIAY-GTKMVGGTSPGKGGSTHLG----LPVFD 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TVAEA++ T A+ASV+YVPP GA DAI E+I+AEIPLIVCITEGIPVLDMVRVK  LE S
Sbjct: 56  TVAEARDATGADASVVYVPPPGAADAICEAIQAEIPLIVCITEGIPVLDMVRVKRALEGS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            SRLIGPNCPG++T    KIGIMP +IF+ GSVGI+SRSGTLTYEAVFQT+ EGLGQ+TA
Sbjct: 116 KSRLIGPNCPGVVTAGQSKIGIMPANIFKPGSVGIVSRSGTLTYEAVFQTTVEGLGQTTA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPVKGTEFI +LELFLAD  TESIVM+GEIGGSAEEEAAQFL DEAKRGRKKP+V
Sbjct: 176 VGIGGDPVKGTEFIAMLELFLADPKTESIVMIGEIGGSAEEEAAQFLADEAKRGRKKPMV 235

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
           GF+AG+TAPPGR MGHAGA+ISGGKGGAEDKI AM+ AGI ++PSPAR+G +LV++L S
Sbjct: 236 GFIAGRTAPPGRRMGHAGAIISGGKGGAEDKIAAMEAAGIRVSPSPARLGSTLVDVLKS 294


>gi|195620062|gb|ACG31861.1| succinyl-CoA ligase alpha-chain 2 [Zea mays]
          Length = 320

 Score =  340 bits (871), Expect = 2e-91,   Method: Composition-based stats.
 Identities = 183/297 (61%), Positives = 228/297 (76%), Gaps = 9/297 (3%)

Query: 3   ILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFTTV 62
           + VDK+T+V+ QG+TGK GTFHTEQAI Y  T +VGG+ PKKG T   G    +PVF +V
Sbjct: 26  VFVDKSTRVICQGITGKNGTFHTEQAIEY-GTNMVGGVTPKKGGTEHLG----LPVFNSV 80

Query: 63  AEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEK-SS 121
           AEAK  T ANASVIYVPP  A  AI+ES+EAE+ L+VCITEGIP  DMV+VKA L + S 
Sbjct: 81  AEAKAETKANASVIYVPPPFAAAAIMESMEAELDLVVCITEGIPQHDMVKVKAALNRQSK 140

Query: 122 SRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTAV 181
           +RLIGPNCPGI+ P  CKIGIMPG I + G +GI+SRSGTLTYEAVFQT+  GLGQST V
Sbjct: 141 TRLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCV 200

Query: 182 GIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIVG 241
           GIGGDP  GT F+D LE F+ D  TE IV++GEIGG+AEE+AA F+++      +KP+V 
Sbjct: 201 GIGGDPFNGTNFVDCLEKFVDDPQTEGIVLIGEIGGTAEEDAATFIQE---SKTQKPVVA 257

Query: 242 FVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           F+AG TAPPGR MGHAGA+++GGKG A+DKI A++EAG+ +  SPA+IG ++ E+  
Sbjct: 258 FIAGLTAPPGRRMGHAGAIVAGGKGTAQDKIKALREAGVTVVESPAKIGSTMFEIFK 314


>gi|188996559|ref|YP_001930810.1| succinyl-CoA synthetase, alpha subunit [Sulfurihydrogenibium sp.
           YO3AOP1]
 gi|188931626|gb|ACD66256.1| succinyl-CoA synthetase, alpha subunit [Sulfurihydrogenibium sp.
           YO3AOP1]
          Length = 293

 Score =  340 bits (871), Expect = 2e-91,   Method: Composition-based stats.
 Identities = 167/300 (55%), Positives = 218/300 (72%), Gaps = 11/300 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+LV+KNTKV+VQG+TG+ G+FH  Q   Y  TQVVGG+ P K      G    +PVF 
Sbjct: 1   MSVLVNKNTKVIVQGITGREGSFHATQCKAY-GTQVVGGVTPGKKGENVEG----IPVFD 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA +   A+ S+I+VPP  A DAI+E+++A I  ++CITEGIPV DM+ VK  ++K 
Sbjct: 56  TVNEAVKEAGADCSLIFVPPPFAADAILEAVDAGIKTVICITEGIPVNDMLPVKQYIKKY 115

Query: 121 --SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQS 178
              + LIGPNCPG++TP   KIGIMPG IF+KG+VGI+SRSGTLTYEA +Q +  G+GQS
Sbjct: 116 YPDTVLIGPNCPGVITPGEAKIGIMPGHIFKKGNVGIVSRSGTLTYEAAYQLTTRGIGQS 175

Query: 179 TAVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKP 238
           TAVGIGGDP+ GT F DVL+ F  D  TE+IVM+GEIGG+AEEEAA+F+K       KKP
Sbjct: 176 TAVGIGGDPIPGTVFADVLKWFQDDPETEAIVMIGEIGGTAEEEAAEFIKSY----VKKP 231

Query: 239 IVGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           +V ++AG TAPPG+ MGHAGA+ISGGKG A +K  A++ AG     +P+ IG ++ ++L 
Sbjct: 232 VVAYIAGVTAPPGKRMGHAGAIISGGKGTAAEKYKALESAGAITVKNPSIIGETVEKILK 291


>gi|270157990|ref|ZP_06186647.1| succinyl-CoA ligase (ADP-forming) subunit alpha [Legionella
           longbeachae D-4968]
 gi|289163744|ref|YP_003453882.1| succinyl-CoA synthetase, alpha subunit [Legionella longbeachae
           NSW150]
 gi|269990015|gb|EEZ96269.1| succinyl-CoA ligase (ADP-forming) subunit alpha [Legionella
           longbeachae D-4968]
 gi|288856917|emb|CBJ10731.1| succinyl-CoA synthetase, alpha subunit [Legionella longbeachae
           NSW150]
          Length = 292

 Score =  340 bits (871), Expect = 2e-91,   Method: Composition-based stats.
 Identities = 176/299 (58%), Positives = 219/299 (73%), Gaps = 10/299 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+LV+K TKVL QG TGK GT+H+EQAI Y  TQ+VGG+ P KG     G    +PVF 
Sbjct: 1   MSVLVNKQTKVLCQGFTGKQGTYHSEQAIAY-GTQMVGGVTPGKGGQMHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           T+ EA + T A ASVIYVP     D+I+E+ +A I LIVCITEG+PVLDM++VK  LE +
Sbjct: 56  TMREAVQETKAEASVIYVPAPFCKDSILEAADAGIQLIVCITEGVPVLDMLQVKVYLENN 115

Query: 121 -SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQST 179
             +RLIGPNCPGI+TP  CKIGIMPGSI   G VGI+SRSGTLTYEAV QT+ +G GQST
Sbjct: 116 TQARLIGPNCPGIITPGECKIGIMPGSIHLPGKVGIVSRSGTLTYEAVKQTTDKGFGQST 175

Query: 180 AVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPI 239
            +GIGGDP+ GT FID L LF  D  T++I+MVGEIGGSAEEEAA+++K        KP+
Sbjct: 176 CIGIGGDPIPGTNFIDALALFEQDSQTQAIIMVGEIGGSAEEEAAEYIKSH----VSKPV 231

Query: 240 VGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           V ++AG TAP G+ MGHAGA+ISGGKG A +K  A++ AG+    SPA +G ++ E+ G
Sbjct: 232 VSYIAGVTAPAGKRMGHAGAIISGGKGTAAEKYAALEAAGVRTVRSPADLGDAVAEVTG 290


>gi|163761407|ref|ZP_02168481.1| succinyl-CoA synthetase subunit alpha [Hoeflea phototrophica
           DFL-43]
 gi|162281402|gb|EDQ31699.1| succinyl-CoA synthetase subunit alpha [Hoeflea phototrophica
           DFL-43]
          Length = 300

 Score =  340 bits (871), Expect = 2e-91,   Method: Composition-based stats.
 Identities = 224/299 (74%), Positives = 264/299 (88%), Gaps = 1/299 (0%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTG-GNVNVPVF 59
           MSIL++K+TKVLVQGLTGK GTFHTEQA+ Y  TQ+VGGIHPKKG + W G G   +P+F
Sbjct: 1   MSILINKDTKVLVQGLTGKTGTFHTEQALAYHGTQMVGGIHPKKGGSTWEGSGGEKLPIF 60

Query: 60  TTVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEK 119
            +VAE K  T ANASVIYVPP+GA  AIIE+IEAEI LIVCITEGIPV DM+R K  L+K
Sbjct: 61  ASVAEGKSATGANASVIYVPPAGAAAAIIEAIEAEIELIVCITEGIPVADMIRAKDVLDK 120

Query: 120 SSSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQST 179
           S SRLIGPNCPG++TPD CKIGIMPG+IF+KGSVGILSRSGTLTYEAVFQT+ EGLGQS+
Sbjct: 121 SKSRLIGPNCPGVMTPDECKIGIMPGNIFKKGSVGILSRSGTLTYEAVFQTTNEGLGQSS 180

Query: 180 AVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPI 239
           AVGIGGDPVKGTEFID+L+L+L D  TESI+M+GEIGGSAEE+AA++L ++AK+GRKKP+
Sbjct: 181 AVGIGGDPVKGTEFIDILDLYLDDPETESIIMIGEIGGSAEEDAAEWLIEQAKKGRKKPM 240

Query: 240 VGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            GF+AG+TAPPGRTMGHAGAVISGGKGGAEDKI AM+ AGI ++PSPAR+G++LVE+L 
Sbjct: 241 AGFIAGRTAPPGRTMGHAGAVISGGKGGAEDKIKAMEAAGIRVSPSPARLGKTLVEVLK 299


>gi|169632628|ref|YP_001706364.1| succinyl-CoA synthetase subunit alpha [Acinetobacter baumannii SDF]
 gi|169794950|ref|YP_001712743.1| succinyl-CoA synthetase subunit alpha [Acinetobacter baumannii AYE]
 gi|184159271|ref|YP_001847610.1| succinyl-CoA synthetase subunit alpha [Acinetobacter baumannii
           ACICU]
 gi|213157645|ref|YP_002320443.1| succinyl-CoA synthetase, alpha subunit [Acinetobacter baumannii
           AB0057]
 gi|215482498|ref|YP_002324684.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Acinetobacter
           baumannii AB307-0294]
 gi|239502281|ref|ZP_04661591.1| succinyl-CoA synthetase subunit alpha [Acinetobacter baumannii
           AB900]
 gi|260557317|ref|ZP_05829533.1| succinyl-CoA synthetase subunit alpha [Acinetobacter baumannii ATCC
           19606]
 gi|301346631|ref|ZP_07227372.1| succinyl-CoA synthetase subunit alpha [Acinetobacter baumannii
           AB056]
 gi|301510303|ref|ZP_07235540.1| succinyl-CoA synthetase subunit alpha [Acinetobacter baumannii
           AB058]
 gi|301596859|ref|ZP_07241867.1| succinyl-CoA synthetase subunit alpha [Acinetobacter baumannii
           AB059]
 gi|332854240|ref|ZP_08435260.1| succinyl-CoA synthetase, alpha subunit [Acinetobacter baumannii
           6013150]
 gi|332866317|ref|ZP_08436922.1| succinyl-CoA synthetase, alpha subunit [Acinetobacter baumannii
           6013113]
 gi|332872532|ref|ZP_08440501.1| succinyl-CoA synthetase, alpha subunit [Acinetobacter baumannii
           6014059]
 gi|169147877|emb|CAM85740.1| succinyl-CoA synthetase alpha chain [Acinetobacter baumannii AYE]
 gi|169151420|emb|CAP00151.1| succinyl-CoA synthetase alpha chain [Acinetobacter baumannii]
 gi|183210865|gb|ACC58263.1| Succinyl-CoA synthetase, alpha subunit [Acinetobacter baumannii
           ACICU]
 gi|193078185|gb|ABO13132.2| succinyl-CoA synthetase alpha chain [Acinetobacter baumannii ATCC
           17978]
 gi|213056805|gb|ACJ41707.1| succinyl-CoA synthetase, alpha subunit [Acinetobacter baumannii
           AB0057]
 gi|213988850|gb|ACJ59149.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Acinetobacter
           baumannii AB307-0294]
 gi|260409423|gb|EEX02725.1| succinyl-CoA synthetase subunit alpha [Acinetobacter baumannii ATCC
           19606]
 gi|322509185|gb|ADX04639.1| sucD [Acinetobacter baumannii 1656-2]
 gi|323519213|gb|ADX93594.1| succinyl-CoA synthetase subunit alpha [Acinetobacter baumannii
           TCDC-AB0715]
 gi|325123208|gb|ADY82731.1| succinyl-CoA synthetase alpha chain [Acinetobacter calcoaceticus
           PHEA-2]
 gi|332728165|gb|EGJ59553.1| succinyl-CoA synthetase, alpha subunit [Acinetobacter baumannii
           6013150]
 gi|332734665|gb|EGJ65769.1| succinyl-CoA synthetase, alpha subunit [Acinetobacter baumannii
           6013113]
 gi|332739218|gb|EGJ70076.1| succinyl-CoA synthetase, alpha subunit [Acinetobacter baumannii
           6014059]
          Length = 296

 Score =  340 bits (871), Expect = 2e-91,   Method: Composition-based stats.
 Identities = 161/301 (53%), Positives = 222/301 (73%), Gaps = 11/301 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+TKVLVQG TGK GTFH+ QA+ Y  T+VVGG+ P KG T      +++PVF 
Sbjct: 1   MSVLINKDTKVLVQGFTGKNGTFHSAQALDY-GTKVVGGVTPGKGGTTH----LDLPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARL--E 118
           T+ EA   T A+ASVIYVP     D+I+E++++ + LIV ITEG+P +DM++ K  L   
Sbjct: 56  TMKEAVRETNADASVIYVPAPFVLDSIVEAVDSGVGLIVVITEGVPTIDMLKAKRYLETN 115

Query: 119 KSSSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQS 178
            + +RL+GPNCPG++TP  CKIGIMPG I + G +GI+SRSGTLTYEAV QT++ GLGQS
Sbjct: 116 GNGTRLVGPNCPGVITPGECKIGIMPGHIHQPGRIGIISRSGTLTYEAVAQTTKLGLGQS 175

Query: 179 TAVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKP 238
           T +GIGGDP+ G   I+ L+LF  D  T++I+M+GEIGG+AEEEAA+F+K        KP
Sbjct: 176 TCIGIGGDPIPGMNQIEALQLFQDDPDTDAIIMIGEIGGTAEEEAAEFIKSN----VTKP 231

Query: 239 IVGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           +VG++AG TAP G+ MGHAGA+ISGG+G AE+K  A ++AG+    SPA +G +++++L 
Sbjct: 232 VVGYIAGVTAPKGKRMGHAGAIISGGQGTAEEKFAAFEKAGMAYTRSPAELGSTMLQVLK 291

Query: 299 S 299
            
Sbjct: 292 E 292


>gi|324112301|gb|EGC06279.1| succinate-CoA ligase [Escherichia fergusonii B253]
 gi|325499640|gb|EGC97499.1| Succinyl-CoA synthetase alpha chain (SCS-alpha) [Escherichia
           fergusonii ECD227]
          Length = 290

 Score =  340 bits (871), Expect = 2e-91,   Method: Composition-based stats.
 Identities = 169/299 (56%), Positives = 219/299 (73%), Gaps = 10/299 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+T+VLVQG+TGK GTFHTEQAI Y  TQ+VGG+ P KG        ++ PVF 
Sbjct: 1   MSVLINKHTRVLVQGITGKNGTFHTEQAIAY-GTQIVGGVTPGKGGQLH----LDRPVFD 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           ++ EA  +T A+ASVIYVP     D+++E+IE+ + LIV ITEG+P LDMV+V+  L+  
Sbjct: 56  SMKEAMRQTEADASVIYVPAPFVLDSVVEAIESGVKLIVVITEGVPTLDMVKVRRLLDCH 115

Query: 121 S-SRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQST 179
              RLIGPNCPGI+TP  CKIGIMPG I R G +GI+SRSGTLTYEAV QT+  GLGQST
Sbjct: 116 PDVRLIGPNCPGIITPGECKIGIMPGEIHRPGRIGIVSRSGTLTYEAVAQTTALGLGQST 175

Query: 180 AVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPI 239
            +GIGGDPV GT FID L LF  D  T++++M+GEIGG+AEE AA+F++ E      KP+
Sbjct: 176 CIGIGGDPVPGTNFIDALRLFENDPQTDAVIMIGEIGGNAEERAAEFIRHEM----NKPV 231

Query: 240 VGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           VG++AG TAP G+ MGHAGA+ISGG G AEDK  A  +AG+    +PA +G +L  ++ 
Sbjct: 232 VGYIAGVTAPKGKRMGHAGAIISGGSGSAEDKFRAFDKAGMAWTRNPALLGETLWNVIK 290


>gi|71064687|ref|YP_263414.1| succinyl-CoA synthetase (ADP-forming) alpha subunit [Psychrobacter
           arcticus 273-4]
 gi|71037672|gb|AAZ17980.1| succinyl-CoA synthetase (ADP-forming) alpha subunit [Psychrobacter
           arcticus 273-4]
          Length = 291

 Score =  340 bits (871), Expect = 2e-91,   Method: Composition-based stats.
 Identities = 173/299 (57%), Positives = 215/299 (71%), Gaps = 10/299 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L+DK+TKVLVQG TGK GTFH+EQAI Y  T+VVGG+ P KG     G    +PVF 
Sbjct: 1   MSVLIDKDTKVLVQGFTGKNGTFHSEQAIEY-GTKVVGGVTPGKGGQTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEK- 119
           T+ EA   T A+ASVIYVP     D+IIE+I+A + LIV ITEG+P LDM++ K  LE+ 
Sbjct: 56  TMNEAMAATQADASVIYVPAPFVLDSIIEAIDAGVKLIVVITEGVPTLDMLKAKRYLEEA 115

Query: 120 SSSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQST 179
              RLIGPNCPG++TP  CKIGIMPG I   G VGI+SRSGTLTYEAV QT+  G GQST
Sbjct: 116 GDVRLIGPNCPGVITPGQCKIGIMPGHIHLPGKVGIISRSGTLTYEAVAQTTTLGFGQST 175

Query: 180 AVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPI 239
            +GIGGDP+ G   ID L+LF  D  TE+I+++GEIGG+AEEEAA ++KD       KP+
Sbjct: 176 CIGIGGDPIPGMNQIDALKLFQEDPQTEAIILIGEIGGTAEEEAAAYIKDH----VTKPV 231

Query: 240 VGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           VG++AG TAP G+ MGHAGA+ISGG+G AEDK  A + AGI     P+++G  L E+ G
Sbjct: 232 VGYIAGVTAPEGKRMGHAGAIISGGQGTAEDKFKAFEAAGIAYTRDPSKLGEKLKEVTG 290


>gi|242373539|ref|ZP_04819113.1| succinyl-CoA synthetase subunit alpha [Staphylococcus epidermidis
           M23864:W1]
 gi|242348902|gb|EES40504.1| succinyl-CoA synthetase subunit alpha [Staphylococcus epidermidis
           M23864:W1]
          Length = 302

 Score =  340 bits (871), Expect = 2e-91,   Method: Composition-based stats.
 Identities = 168/299 (56%), Positives = 223/299 (74%), Gaps = 9/299 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+ +DKNTKV+VQG+TG    FHT+Q + Y  TQ+V G+ P KG     G    VPV+ 
Sbjct: 1   MSVFIDKNTKVMVQGITGSTALFHTKQMLDY-GTQIVAGVTPGKGGQVVEG----VPVYN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EAK  T AN SV+YVP   A D+I+E+ EA++ +++CITE IPV+DMV+VK  L+  
Sbjct: 56  TVQEAKNETGANVSVVYVPAPFAADSILEAAEADLDMVICITEHIPVVDMVKVKRYLQGR 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            +RL+GPNCPG++T D CKIGIMPG I +KG VG++SRSGTLTYEAV Q ++EG+GQ+TA
Sbjct: 116 KTRLVGPNCPGVITADECKIGIMPGYIHKKGHVGVVSRSGTLTYEAVHQLTEEGIGQTTA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPV GT FIDVL+ F  D  T+++VM+GEIGG+AEEEAAQ++K+       KP+V
Sbjct: 176 VGIGGDPVNGTNFIDVLKEFNEDPETKAVVMIGEIGGTAEEEAAQWIKENM----NKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
           GF+ G+TAPPG+ MGHAGA+ISGGKG A++KI  + + G+  A +P+ IG +L+E    
Sbjct: 232 GFIGGQTAPPGKRMGHAGAIISGGKGTADEKIKTLNDCGVETADTPSEIGTTLIEAAKK 290


>gi|163851072|ref|YP_001639115.1| succinyl-CoA synthetase, alpha subunit [Methylobacterium extorquens
           PA1]
 gi|163662677|gb|ABY30044.1| succinyl-CoA synthetase, alpha subunit [Methylobacterium extorquens
           PA1]
          Length = 295

 Score =  340 bits (871), Expect = 2e-91,   Method: Composition-based stats.
 Identities = 222/299 (74%), Positives = 255/299 (85%), Gaps = 5/299 (1%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL+D+NTKV+ QG TGK GTFH+EQAI Y  T++VGG  P KG +   G    +PVF 
Sbjct: 1   MSILIDQNTKVICQGFTGKNGTFHSEQAIAY-GTKMVGGTSPGKGGSTHLG----LPVFD 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TVAEA+E T A+ASV+YVPP GA DAI E+I+AEIPLIVCITEGIPVLDMVRVK  LE S
Sbjct: 56  TVAEAREATGADASVVYVPPPGAADAICEAIQAEIPLIVCITEGIPVLDMVRVKRALEGS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            SRLIGPNCPG++T    KIGIMP +IF+ GSVGI+SRSGTLTYEAVFQT+ EGLGQ+TA
Sbjct: 116 KSRLIGPNCPGVVTAGQSKIGIMPANIFKPGSVGIVSRSGTLTYEAVFQTTVEGLGQTTA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPVKGTEFI +LELFLAD  TESIVM+GEIGGSAEEEAAQFL DEAKRGRKKP+V
Sbjct: 176 VGIGGDPVKGTEFIAMLELFLADPKTESIVMIGEIGGSAEEEAAQFLADEAKRGRKKPMV 235

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
           GF+AG+TAPPGR MGHAGA+ISGGKGGAEDKI AM+ AGI ++PSPAR+G +LV++L S
Sbjct: 236 GFIAGRTAPPGRRMGHAGAIISGGKGGAEDKIAAMEAAGIRVSPSPARLGSTLVDVLKS 294


>gi|237703621|ref|ZP_04534102.1| succinyl-CoA synthetase subunit alpha [Escherichia sp. 3_2_53FAA]
 gi|226901533|gb|EEH87792.1| succinyl-CoA synthetase subunit alpha [Escherichia sp. 3_2_53FAA]
 gi|315287843|gb|EFU47245.1| succinyl-CoA synthetase subunit alpha [Escherichia coli MS 110-3]
 gi|323954474|gb|EGB50258.1| succinate-CoA ligase [Escherichia coli H263]
          Length = 290

 Score =  339 bits (870), Expect = 2e-91,   Method: Composition-based stats.
 Identities = 168/299 (56%), Positives = 220/299 (73%), Gaps = 10/299 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+T+VLVQG+TGK GTFHTEQAI Y  TQ+VGG+ P KG       +++ PVF 
Sbjct: 1   MSVLINKHTRVLVQGITGKNGTFHTEQAIAY-GTQIVGGVTPGKGGQ----RHLDRPVFD 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           ++ EA  +T A+ASVIYVP     D+++E+IEA + L+V ITEG+P LDMV+V+  L+  
Sbjct: 56  SMKEAMPQTEADASVIYVPAPFVLDSVVEAIEAGVKLVVVITEGVPTLDMVKVRRLLDCH 115

Query: 121 S-SRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQST 179
              RLIGPNCPG++TP  CKIGIMPG I R G +GI+SRSGTLTYEAV QT+  GLGQST
Sbjct: 116 PDVRLIGPNCPGVITPGECKIGIMPGEIHRPGRIGIVSRSGTLTYEAVAQTTALGLGQST 175

Query: 180 AVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPI 239
            +GIGGDPV GT FID L LF  D  T++++M+GEIGG+AEE AA+F++ E      KP+
Sbjct: 176 CIGIGGDPVPGTNFIDALRLFENDPQTDAVIMIGEIGGNAEERAAEFIRHEM----NKPV 231

Query: 240 VGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           VG++AG TAP G+ MGHAGA+ISGG G AEDK  A  +AG+    +PA +G +L  ++ 
Sbjct: 232 VGYIAGVTAPKGKRMGHAGAIISGGSGSAEDKFRAFDKAGMAWTRNPALLGETLWNVIK 290


>gi|323489568|ref|ZP_08094795.1| succinyl-CoA synthetase subunit alpha [Planococcus donghaensis
           MPA1U2]
 gi|323396699|gb|EGA89518.1| succinyl-CoA synthetase subunit alpha [Planococcus donghaensis
           MPA1U2]
          Length = 300

 Score =  339 bits (870), Expect = 2e-91,   Method: Composition-based stats.
 Identities = 176/299 (58%), Positives = 225/299 (75%), Gaps = 9/299 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+ ++K+TKVLVQG+TG    FHT+Q + Y  T++V G+ P KG T   G    VPVF 
Sbjct: 1   MSVYINKDTKVLVQGITGSTALFHTKQMLEY-GTKIVAGVTPGKGGTEAEG----VPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA + T AN SVIYVP   A DAI+E++EAE+ + +CITE IPVLDMV+V   +E  
Sbjct: 56  TVEEAVKATGANVSVIYVPAPFAADAILEAVEAELDMAICITEHIPVLDMVKVNRYMEGK 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            +RL+GPNCPG++TPD CKIGIMPG I +KG VG++SRSGTLTYEA  Q S+EG+GQSTA
Sbjct: 116 KTRLVGPNCPGVITPDECKIGIMPGYIHKKGHVGVVSRSGTLTYEATHQLSEEGIGQSTA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPV GT FIDVL+ F  DE T ++VM+GEIGG+AEEEAA+++K        KP+V
Sbjct: 176 VGIGGDPVNGTNFIDVLKEFNEDEDTYAVVMIGEIGGTAEEEAAEWVKANM----TKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
           GF+ G+TAP G+ MGHAGA+ISGGKG A DKI AM EAGI +A +P+ IG +L++++  
Sbjct: 232 GFIGGQTAPEGKRMGHAGAIISGGKGTAADKIKAMNEAGIEVADTPSVIGETLIKVIKE 290


>gi|94677017|ref|YP_588571.1| succinyl-CoA synthetase, alpha subunit [Baumannia cicadellinicola
           str. Hc (Homalodisca coagulata)]
 gi|94220167|gb|ABF14326.1| succinyl-CoA synthetase, alpha subunit [Baumannia cicadellinicola
           str. Hc (Homalodisca coagulata)]
          Length = 294

 Score =  339 bits (870), Expect = 2e-91,   Method: Composition-based stats.
 Identities = 163/297 (54%), Positives = 222/297 (74%), Gaps = 9/297 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL++K+TKV+ QGLTG+ G+FH+ QA+ Y  T++VGG+ P KG TY  G    +PVF 
Sbjct: 1   MSILINKHTKVICQGLTGRQGSFHSAQALAY-GTKIVGGVTPGKGGTYHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA  +T A  SVIYVP     DAI+E+I+A I LI+CITEG+P+LDM+ +KA+L++ 
Sbjct: 56  TVREACYQTCATTSVIYVPAPFCKDAILEAIDAGIQLIICITEGLPILDMLVIKAKLKQR 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
           + R+IGPNCPGI+TP  CKIGIMPG I + G +GI+SRSG+LTYEAV +T+   LGQS+ 
Sbjct: 116 NVRMIGPNCPGIITPGECKIGIMPGHIHQPGRIGIVSRSGSLTYEAVKETNDTNLGQSSC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGD + G+ FID+++LF  D  TE+I+++GEIGG AEEEAA ++K+       KP+V
Sbjct: 176 VGIGGDIILGSNFIDIIKLFELDPQTEAIILIGEIGGDAEEEAAIYIKNH----ITKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELL 297
           G++AG TAP G+ MGHAGA+I+GGKG A++K+  ++ AGI    S A IG+ L  +L
Sbjct: 232 GYIAGFTAPQGKRMGHAGAIITGGKGSAKEKLLLLEAAGINTVRSLADIGQVLKRIL 288


>gi|86747405|ref|YP_483901.1| succinyl-CoA synthetase, alpha subunit [Rhodopseudomonas palustris
           HaA2]
 gi|86570433|gb|ABD04990.1| succinyl-CoA synthetase (ADP-forming) alpha subunit
           [Rhodopseudomonas palustris HaA2]
          Length = 294

 Score =  339 bits (870), Expect = 2e-91,   Method: Composition-based stats.
 Identities = 216/299 (72%), Positives = 249/299 (83%), Gaps = 5/299 (1%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL+D NTKV+ QG TGK GTFH+E A+ Y  T++VGG  P KG T   G    +PVF 
Sbjct: 1   MSILIDANTKVICQGFTGKNGTFHSEAAVAY-GTKMVGGTSPGKGGTTHLG----LPVFD 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA+++T A+ASVIYVPP GA DAI E+I+AEIPLIVCITEGIPVLDMVRVK  L  S
Sbjct: 56  TVREARDKTGADASVIYVPPPGAADAICEAIDAEIPLIVCITEGIPVLDMVRVKRSLVGS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            SRLIGPNCPG++T   CKIGIMP +IF+ GSVGI+SRSGTLTYEAVFQT+ EGLGQ+TA
Sbjct: 116 KSRLIGPNCPGVMTAGECKIGIMPANIFKPGSVGIVSRSGTLTYEAVFQTTSEGLGQTTA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPVKGTEFIDVLE+FLAD+ TESI+M+GEIGGSAEEEAAQFL DEAKRGRKKP+V
Sbjct: 176 VGIGGDPVKGTEFIDVLEMFLADDKTESIIMIGEIGGSAEEEAAQFLIDEAKRGRKKPMV 235

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
           GF+AG TAPPGR MGHAGA+ISGGKG A  K  AM+ AGI ++PSPAR+G++L E L S
Sbjct: 236 GFIAGVTAPPGRRMGHAGAIISGGKGDAASKTAAMEAAGITVSPSPARLGKTLAEKLKS 294


>gi|302036211|ref|YP_003796533.1| succinyl-CoA synthetase, NAD(P)-binding subunit alpha [Candidatus
           Nitrospira defluvii]
 gi|300604275|emb|CBK40607.1| Succinyl-CoA synthetase, NAD(P)-binding, alpha subunit [Candidatus
           Nitrospira defluvii]
          Length = 290

 Score =  339 bits (870), Expect = 3e-91,   Method: Composition-based stats.
 Identities = 165/298 (55%), Positives = 216/298 (72%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSILV+KNT+V+VQG+TGK G+FH  Q   Y  T++V G+ P K      G    +PVF 
Sbjct: 1   MSILVNKNTRVVVQGITGKEGSFHATQCKAY-GTKMVAGVTPGKAGQEVEG----IPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TVA+A ++T  + S+I+VPP    DAI+E+ +A + LI+CITEGIPV DMV+VK  L   
Sbjct: 56  TVADAVKKTDCDTSLIFVPPPFCADAILEAADAGVKLIICITEGIPVNDMVKVKRALHGR 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             RLIGPNCPG++T D  KIGIMPG I ++G VG++SRSGTLTYEAV Q S  GLG++T 
Sbjct: 116 DVRLIGPNCPGVITVDEAKIGIMPGFIHKRGVVGVVSRSGTLTYEAVHQLSTLGLGETTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPV GT F+DVL LF  D  T+++VM+GEIGG AEE+AA+++K       KKP++
Sbjct: 176 VGIGGDPVNGTGFVDVLPLFEQDSETQAVVMIGEIGGDAEEKAAEYIKKH----VKKPVI 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            F+AG TAPPGR MGHAGA+ISGGKG A +K+ A++ AG+ +  +PA IG ++   LG
Sbjct: 232 SFIAGITAPPGRRMGHAGAIISGGKGTATEKMKALEAAGVRVVKNPAEIGHAVKAALG 289


>gi|253699671|ref|YP_003020860.1| succinyl-CoA synthetase, subunit alpha [Geobacter sp. M21]
 gi|251774521|gb|ACT17102.1| succinyl-CoA synthetase, alpha subunit [Geobacter sp. M21]
          Length = 290

 Score =  339 bits (870), Expect = 3e-91,   Method: Composition-based stats.
 Identities = 167/298 (56%), Positives = 219/298 (73%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSI+++K+T+V+ QG+TG  G FH + A  Y  TQ+VGG+ P KG T   G     PVF 
Sbjct: 1   MSIMINKDTRVITQGITGATGLFHAQGAREY-GTQMVGGVTPGKGGTVIDG----FPVFD 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TVAEA   T A ASVIYVPP  A D+I+E+++A + L+ CITEGIPVLDMV+VK  L   
Sbjct: 56  TVAEAVHETGATASVIYVPPPFAADSIMEAVDAGVELVCCITEGIPVLDMVKVKQYLVGK 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            +RL+GPNCPG++TP  CKIGIMPG I + G +G++SRSGTLTYEAV+Q +  GLGQST 
Sbjct: 116 RTRLVGPNCPGVITPGQCKIGIMPGYIHKPGRIGVVSRSGTLTYEAVWQLTSIGLGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPV GT  ID L LF AD  T++++M+GEIGG+AEEEAA F+K+      KKP+ 
Sbjct: 176 VGIGGDPVNGTSHIDCLRLFEADPDTDAVIMIGEIGGNAEEEAAHFVKENM----KKPVA 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            ++AG TAPPG+ MGHAGA+ISGGKG A +K+  ++E GI +A SPA + ++L+++  
Sbjct: 232 AYIAGVTAPPGKRMGHAGAIISGGKGTATEKVAVLRECGISVADSPAEMAQALLQVYK 289


>gi|26250849|ref|NP_756889.1| succinyl-CoA synthetase subunit alpha [Escherichia coli CFT073]
 gi|91213588|ref|YP_543574.1| SucD, succinyl-CoA synthetase subunit alpha [Escherichia coli
           UTI89]
 gi|110644397|ref|YP_672127.1| succinyl-CoA synthetase alpha subunit [Escherichia coli 536]
 gi|117626331|ref|YP_859654.1| succinyl-CoA synthetase alpha subunit [Escherichia coli APEC O1]
 gi|191171983|ref|ZP_03033528.1| succinyl-CoA ligase [ADP-forming] subunit alpha [Escherichia coli
           F11]
 gi|215489396|ref|YP_002331827.1| predicted succinyl-CoA synthetase, NAD(P)-binding, alpha subunit
           [Escherichia coli O127:H6 str. E2348/69]
 gi|218561134|ref|YP_002394047.1| Succinyl-CoA synthetase alpha chain (SCS-alpha) [Escherichia coli
           S88]
 gi|300980467|ref|ZP_07175014.1| succinyl-CoA synthetase subunit alpha [Escherichia coli MS 200-1]
 gi|300992978|ref|ZP_07180133.1| succinyl-CoA synthetase subunit alpha [Escherichia coli MS 45-1]
 gi|301047015|ref|ZP_07194124.1| succinyl-CoA synthetase subunit alpha [Escherichia coli MS 185-1]
 gi|306815830|ref|ZP_07449975.1| succinyl-CoA synthetase alpha chain [Escherichia coli NC101]
 gi|312965654|ref|ZP_07779883.1| succinyl-CoA ligase [ADP-forming] subunit alpha [Escherichia coli
           2362-75]
 gi|331650071|ref|ZP_08351144.1| succinate-CoA ligase, alpha subunit [Escherichia coli M605]
 gi|331660625|ref|ZP_08361557.1| succinate-CoA ligase, alpha subunit [Escherichia coli TA206]
 gi|26111280|gb|AAN83463.1|AE016770_263 Succinyl-CoA synthetase alpha chain [Escherichia coli CFT073]
 gi|91075162|gb|ABE10043.1| SucD, succinyl-CoA synthetase alpha chain [Escherichia coli UTI89]
 gi|110345989|gb|ABG72226.1| succinyl-CoA synthetase alpha subunit [Escherichia coli 536]
 gi|115515455|gb|ABJ03530.1| succinyl-CoA synthetase alpha subunit [Escherichia coli APEC O1]
 gi|190907748|gb|EDV67342.1| succinyl-CoA ligase [ADP-forming] subunit alpha [Escherichia coli
           F11]
 gi|215267468|emb|CAS11922.1| predicted succinyl-CoA synthetase, NAD(P)-binding, alpha subunit
           [Escherichia coli O127:H6 str. E2348/69]
 gi|218367903|emb|CAR05698.1| Succinyl-CoA synthetase alpha chain (SCS-alpha) [Escherichia coli
           S88]
 gi|222035771|emb|CAP78516.1| SucD, succinyl-CoA synthetase alpha chain (EC62 15) [Escherichia
           coli LF82]
 gi|294491040|gb|ADE89796.1| succinyl-CoA synthetase, alpha subunit [Escherichia coli IHE3034]
 gi|300301060|gb|EFJ57445.1| succinyl-CoA synthetase subunit alpha [Escherichia coli MS 185-1]
 gi|300307769|gb|EFJ62289.1| succinyl-CoA synthetase subunit alpha [Escherichia coli MS 200-1]
 gi|300406752|gb|EFJ90290.1| succinyl-CoA synthetase subunit alpha [Escherichia coli MS 45-1]
 gi|305850805|gb|EFM51261.1| succinyl-CoA synthetase alpha chain [Escherichia coli NC101]
 gi|307629113|gb|ADN73417.1| succinyl-CoA synthetase alpha chain [Escherichia coli UM146]
 gi|312289628|gb|EFR17519.1| succinyl-CoA ligase [ADP-forming] subunit alpha [Escherichia coli
           2362-75]
 gi|312948636|gb|ADR29463.1| Succinyl-CoA synthetase alpha chain (SCS-alpha) [Escherichia coli
           O83:H1 str. NRG 857C]
 gi|315291542|gb|EFU50902.1| succinyl-CoA synthetase subunit alpha [Escherichia coli MS 153-1]
 gi|315297530|gb|EFU56809.1| succinyl-CoA synthetase subunit alpha [Escherichia coli MS 16-3]
 gi|320193418|gb|EFW68055.1| Succinyl-CoA ligase [ADP-forming] alpha chain [Escherichia coli
           WV_060327]
 gi|323190078|gb|EFZ75356.1| succinyl-CoA ligase [ADP-forming] subunit alpha [Escherichia coli
           RN587/1]
 gi|323950392|gb|EGB46273.1| succinate-CoA ligase [Escherichia coli H252]
 gi|324007783|gb|EGB77002.1| succinyl-CoA synthetase subunit alpha [Escherichia coli MS 57-2]
 gi|324014860|gb|EGB84079.1| succinyl-CoA synthetase subunit alpha [Escherichia coli MS 60-1]
 gi|330908384|gb|EGH36903.1| succinyl-CoA ligase [ADP-forming] alpha chain [Escherichia coli
           AA86]
 gi|331041016|gb|EGI13173.1| succinate-CoA ligase, alpha subunit [Escherichia coli M605]
 gi|331051667|gb|EGI23706.1| succinate-CoA ligase, alpha subunit [Escherichia coli TA206]
          Length = 290

 Score =  339 bits (870), Expect = 3e-91,   Method: Composition-based stats.
 Identities = 168/299 (56%), Positives = 220/299 (73%), Gaps = 10/299 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+T+VLVQG+TGK GTFHTEQAI Y  TQ+VGG+ P KG       +++ PVF 
Sbjct: 1   MSVLINKHTRVLVQGITGKNGTFHTEQAIAY-GTQIVGGVTPGKGGQ----RHLDRPVFD 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           ++ EA  +T A+ASVIYVP     D+++E+IEA + L+V ITEG+P LDMV+V+  L+  
Sbjct: 56  SMKEAMRQTEADASVIYVPAPFVLDSVVEAIEAGVKLVVVITEGVPTLDMVKVRRLLDCH 115

Query: 121 S-SRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQST 179
              RLIGPNCPG++TP  CKIGIMPG I R G +GI+SRSGTLTYEAV QT+  GLGQST
Sbjct: 116 PDVRLIGPNCPGVITPGECKIGIMPGEIHRPGRIGIVSRSGTLTYEAVAQTTALGLGQST 175

Query: 180 AVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPI 239
            +GIGGDPV GT FID L LF  D  T++++M+GEIGG+AEE AA+F++ E      KP+
Sbjct: 176 CIGIGGDPVPGTNFIDALRLFENDPQTDAVIMIGEIGGNAEERAAEFIRHEM----NKPV 231

Query: 240 VGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           VG++AG TAP G+ MGHAGA+ISGG G AEDK  A  +AG+    +PA +G +L  ++ 
Sbjct: 232 VGYIAGVTAPKGKRMGHAGAIISGGSGSAEDKFRAFDKAGMAWTRNPALLGETLWNVIK 290


>gi|197119590|ref|YP_002140017.1| succinyl-CoA synthetase subunit alpha [Geobacter bemidjiensis Bem]
 gi|197088950|gb|ACH40221.1| succinyl-CoA synthetase, alpha subunit [Geobacter bemidjiensis Bem]
          Length = 290

 Score =  339 bits (870), Expect = 3e-91,   Method: Composition-based stats.
 Identities = 167/298 (56%), Positives = 219/298 (73%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSI+++K T+V+ QG+TG  G FH + A  Y  TQ+VGG+ P KG T   G     PVF 
Sbjct: 1   MSIMINKETRVITQGITGATGLFHAQGAREY-GTQMVGGVTPGKGGTVIDG----FPVFD 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TVAEA   T A ASVIYVPP  A D+I+E+++A + L+ CITEGIPVLDMV+VK  L   
Sbjct: 56  TVAEAVHETGATASVIYVPPPFAADSIMEAVDAGVELVCCITEGIPVLDMVKVKQYLVGK 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            +RL+GPNCPG++TP  CKIGIMPG I + G +G++SRSGTLTYEAV+Q +  GLGQST 
Sbjct: 116 RTRLVGPNCPGVITPGQCKIGIMPGYIHKPGRIGVVSRSGTLTYEAVWQLTSIGLGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPV GT  ID L LF AD  T++++M+GEIGG+AEEEAA+F+K+      KKP+ 
Sbjct: 176 VGIGGDPVNGTSHIDCLRLFEADPDTDAVIMIGEIGGNAEEEAARFVKENM----KKPVA 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            ++AG TAPPG+ MGHAGA+ISGGKG A +K+  ++E GI +A SPA + ++L+++  
Sbjct: 232 AYIAGVTAPPGKRMGHAGAIISGGKGTATEKVAVLRECGISVADSPAEMAQALLQVYK 289


>gi|148284071|ref|YP_001248161.1| succinyl-CoA synthetase, alpha chain [Orientia tsutsugamushi str.
           Boryong]
 gi|146739510|emb|CAM79216.1| succinyl-CoA synthetase, alpha chain [Orientia tsutsugamushi str.
           Boryong]
          Length = 292

 Score =  339 bits (869), Expect = 3e-91,   Method: Composition-based stats.
 Identities = 186/300 (62%), Positives = 237/300 (79%), Gaps = 8/300 (2%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+LVD+NTKV+ QG+TG  GTFHTEQA+ Y  T++VGG+ P KG        +N+PV+ 
Sbjct: 1   MSVLVDRNTKVICQGITGAQGTFHTEQALKY-GTKMVGGVTPGKGGQTI----LNLPVYN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           +V EA ++T A ASVIYVPP+ A D+I E+I+A I L+VCITEGIPVLDM+++K  L+ S
Sbjct: 56  SVDEAVQKTGATASVIYVPPAFAADSIFEAIDAGIELLVCITEGIPVLDMLKIKQVLKGS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            +RLIGPNCPGI+TP+ CKIGIMPG I + GS+GI+SRSGTLTYEAV QT++ GLGQST 
Sbjct: 116 KTRLIGPNCPGIITPEQCKIGIMPGHIHKAGSIGIISRSGTLTYEAVAQTTEVGLGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           +GIGGD + GT F+D LELFLAD+ T++I+++GEIGGSAEEEAA FLK       KKPIV
Sbjct: 176 IGIGGDTINGTSFVDCLELFLADDDTKAIIIIGEIGGSAEEEAADFLKSSR---IKKPIV 232

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGSL 300
           GF+AG TAPPG+ MGHAGA+I G KG A  K+ A+K AG+CIA SPA+IG+++  LL +L
Sbjct: 233 GFIAGVTAPPGKRMGHAGAIIDGEKGAASSKLEALKSAGVCIAESPAKIGQTMYNLLHNL 292


>gi|292572046|gb|ADE29961.1| Succinyl-CoA synthetase alpha chain [Rickettsia prowazekii Rp22]
          Length = 292

 Score =  339 bits (869), Expect = 3e-91,   Method: Composition-based stats.
 Identities = 179/300 (59%), Positives = 230/300 (76%), Gaps = 8/300 (2%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           M+IL++K TKV+ QG TG  GTFH+EQAI Y  T +VGG+ P KG        +N+PV+ 
Sbjct: 1   MAILINKKTKVICQGFTGSQGTFHSEQAIAY-GTNMVGGVTPGKGGHTH----LNLPVYN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EAK +T ANASVIYVPP  A D+I+E+I+A+I ++VCITEGIPVLDM++VK  L  S
Sbjct: 56  TVHEAKAKTGANASVIYVPPGFAADSILEAIDAKIEVVVCITEGIPVLDMIKVKRALIGS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            +RLIGPNCPG++TP  CKIGIMPG I + G +GI+SRSGTLTYEAV QT+  GLGQST 
Sbjct: 116 KTRLIGPNCPGVITPGECKIGIMPGHIHKIGDIGIVSRSGTLTYEAVAQTTAAGLGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPV GT F+D +E+FL D+ T++I+++GEIGGSAEE+AA F+K       KKPIV
Sbjct: 176 VGIGGDPVNGTSFVDCIEMFLQDDETKAIIIIGEIGGSAEEDAADFIKQ---SKIKKPIV 232

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGSL 300
            F+AG TAP  + MGHAGA+ISGGKG AEDK+  ++ AG+ I  SPA IG+++++LL  +
Sbjct: 233 SFIAGITAPADKRMGHAGAIISGGKGSAEDKVEVLQSAGVIITRSPADIGKTMLDLLNKI 292


>gi|262369430|ref|ZP_06062758.1| succinyl-CoA synthetase subunit alpha [Acinetobacter johnsonii
           SH046]
 gi|262315498|gb|EEY96537.1| succinyl-CoA synthetase subunit alpha [Acinetobacter johnsonii
           SH046]
          Length = 296

 Score =  339 bits (869), Expect = 3e-91,   Method: Composition-based stats.
 Identities = 165/301 (54%), Positives = 222/301 (73%), Gaps = 11/301 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+TKVLVQG TGK GTFH+ QA+ Y  T+VVGG+ P KG T      +++PVF 
Sbjct: 1   MSVLINKDTKVLVQGFTGKNGTFHSAQALDY-GTKVVGGVTPGKGGTTH----LDLPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLE-- 118
           T+ +A   T A+A+VIYVP     D+IIE++++ + LIV ITEG+P LDM++ K  L+  
Sbjct: 56  TMKDAVAGTGADATVIYVPAPFVLDSIIEAVDSGVGLIVVITEGVPTLDMLKAKRYLQTN 115

Query: 119 KSSSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQS 178
            + +RLIGPNCPGI+TP  CKIGIMPG I + G +GI+SRSGTLTYEAV QT++ GLGQS
Sbjct: 116 GNGTRLIGPNCPGIITPGECKIGIMPGHIHQPGKIGIISRSGTLTYEAVAQTTKLGLGQS 175

Query: 179 TAVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKP 238
           T +GIGGDP+ G   ID L+LF  D  TE+I+M+GEIGG+AEEEAA++++        KP
Sbjct: 176 TCIGIGGDPIPGMNQIDCLKLFQEDPQTEAIIMIGEIGGTAEEEAAEYIQSH----VTKP 231

Query: 239 IVGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           +VG++AG TAP G+ MGHAGA+ISGGKG AE+K  A ++AG+    SPA +G ++ +LL 
Sbjct: 232 VVGYIAGVTAPKGKRMGHAGAIISGGKGTAEEKFAAFEKAGMAYTRSPAELGSTMFQLLK 291

Query: 299 S 299
            
Sbjct: 292 D 292


>gi|294506661|ref|YP_003570719.1| succinyl-CoA synthetase, alpha subunit [Salinibacter ruber M8]
 gi|294342989|emb|CBH23767.1| succinyl-CoA synthetase, alpha subunit [Salinibacter ruber M8]
          Length = 288

 Score =  339 bits (869), Expect = 3e-91,   Method: Composition-based stats.
 Identities = 165/297 (55%), Positives = 210/297 (70%), Gaps = 9/297 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSILVD +T+V+VQG TG  GTFH EQ + Y  T VV G+ P KG     G     PV+ 
Sbjct: 1   MSILVDDDTRVVVQGFTGSEGTFHAEQMMDY-GTNVVAGVTPGKGGQTHLGR----PVYN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TVAEA E+  AN S+I+VPP  A DAI ES +A   +I+CITEGIPV DM      ++K 
Sbjct: 56  TVAEAVEQENANTSIIFVPPPFAADAIQESADAGAEVIICITEGIPVADMKPTYQYVKKK 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            + LIGPNCPG++TP + K+GIMP  IF  GS+GI+SRSGTLTYEAV Q ++ G GQSTA
Sbjct: 116 GAHLIGPNCPGVITPGAAKVGIMPAMIFEPGSIGIISRSGTLTYEAVDQITRAGFGQSTA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPV GT FID LELF  D  T+ IV++GEIGG+ E+EAA++++D        P+ 
Sbjct: 176 VGIGGDPVIGTRFIDALELFEDDPDTDGIVLIGEIGGTDEQEAARYVQDHM----DTPVF 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELL 297
           GF+AG+TAPPGR MGHAGA++SGG G AE K  A++EAG  +  +PA IG ++ ++L
Sbjct: 232 GFIAGRTAPPGRRMGHAGAIVSGGSGTAEAKFQALEEAGATVVKNPALIGETVQDVL 288


>gi|281181130|dbj|BAI57460.1| succinyl-CoA synthetase alpha subunit [Escherichia coli SE15]
          Length = 290

 Score =  339 bits (869), Expect = 3e-91,   Method: Composition-based stats.
 Identities = 166/299 (55%), Positives = 219/299 (73%), Gaps = 10/299 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+T+VLVQG+TGK GTFHTEQAI Y  TQ+VGG+ P KG       +++ PVF 
Sbjct: 1   MSVLINKHTRVLVQGITGKNGTFHTEQAIAY-GTQIVGGVTPGKGGQ----RHLDRPVFD 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           ++ +A  +T A+ASVIYVP     D+++E+IEA + L+V ITEG+P LDMV+V+  L+  
Sbjct: 56  SMKDAMRQTEADASVIYVPAPFVLDSVVEAIEAGVKLVVVITEGVPTLDMVKVRRLLDCH 115

Query: 121 S-SRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQST 179
              RLIGPNCPG++TP  CKIGIMPG I R G +GI+SRSGTLTYEAV QT+  GLGQST
Sbjct: 116 PDVRLIGPNCPGVITPGECKIGIMPGEIHRPGRIGIVSRSGTLTYEAVAQTTALGLGQST 175

Query: 180 AVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPI 239
            +GIGGDPV GT FID L LF  D  T++++M+GEIGG+AEE AA+F++        KP+
Sbjct: 176 CIGIGGDPVPGTNFIDALRLFENDPQTDAVIMIGEIGGNAEERAAEFIR----HDMNKPV 231

Query: 240 VGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           VG++AG TAP G+ MGHAGA+ISGG G AEDK  A  +AG+    +PA +G +L  ++ 
Sbjct: 232 VGYIAGVTAPKGKRMGHAGAIISGGSGSAEDKFRAFDKAGMAWTRNPALLGETLWNVIK 290


>gi|253996050|ref|YP_003048114.1| succinyl-CoA synthetase subunit alpha [Methylotenera mobilis JLW8]
 gi|253982729|gb|ACT47587.1| succinyl-CoA synthetase, alpha subunit [Methylotenera mobilis JLW8]
          Length = 293

 Score =  339 bits (869), Expect = 3e-91,   Method: Composition-based stats.
 Identities = 179/297 (60%), Positives = 225/297 (75%), Gaps = 9/297 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSILV+KNTKVL QG TGK GTFH+EQA+ Y  TQ+VGG+ P KG     G    +PVF 
Sbjct: 1   MSILVNKNTKVLCQGFTGKQGTFHSEQALAY-GTQMVGGVTPGKGGQLHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           T+ +A   T ANASVIYVPP+ A D+I+E+ +A I LI+CITEGIPVLDM+ VKA L+ +
Sbjct: 56  TMRDAVRTTGANASVIYVPPAFAADSILEASDAGIELIICITEGIPVLDMLNVKAALKAN 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            +RLIGPNCPG++TPD CKIGIMPGSI  +G VG++SRSGTLTYEAV QT+   LGQST 
Sbjct: 116 GTRLIGPNCPGVITPDECKIGIMPGSIHLRGKVGVVSRSGTLTYEAVHQTTALNLGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+KG  FI+ LE+F AD  TE+I+MVGEIGGS EE AA+F+K   +    KP+ 
Sbjct: 176 VGIGGDPIKGLNFIECLEMFEADPETEAIIMVGEIGGSDEEAAAEFIKSNVR----KPVA 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELL 297
            ++AG+TAP G+ MGHAGA+ISGG G A DKI A++ AG  +A SPA +G +++  +
Sbjct: 232 AYIAGQTAPAGKRMGHAGAIISGGSGKAADKIRALELAGAVVASSPAGLGEAVLAAM 288


>gi|239636274|ref|ZP_04677276.1| succinate-CoA ligase, alpha subunit family [Staphylococcus warneri
           L37603]
 gi|239597629|gb|EEQ80124.1| succinate-CoA ligase, alpha subunit family [Staphylococcus warneri
           L37603]
          Length = 301

 Score =  339 bits (869), Expect = 4e-91,   Method: Composition-based stats.
 Identities = 167/299 (55%), Positives = 221/299 (73%), Gaps = 9/299 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+ +DKNTKV+VQG+TG    FHT+Q + Y  TQ+V G+ P KG     G    VPV+ 
Sbjct: 1   MSVFIDKNTKVIVQGITGSTALFHTKQMLDY-GTQIVAGVTPGKGGQVVEG----VPVYN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EAK+ T AN SV+YVP   A D+I+E+ +AE+ +++CITE IPV+DMV+VK  L+  
Sbjct: 56  TVEEAKQETGANVSVVYVPAPFAADSILEAADAELDMVICITEHIPVVDMVKVKRYLQGR 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            +RL+GPNCPG++T D CKIGIMPG I +KG VG++SRSGTLTYEAV Q ++EG+GQ+TA
Sbjct: 116 KTRLVGPNCPGVITADECKIGIMPGYIHKKGHVGVVSRSGTLTYEAVHQLTEEGIGQTTA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPV GT FIDVL+ F  D  T+++VM+GEIGG+AEEEAA+++K        KP+V
Sbjct: 176 VGIGGDPVNGTNFIDVLKAFNEDPETKAVVMIGEIGGTAEEEAAEWIKANM----TKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
           GF+ G+TAPPG+ MGHAGA+ISGGKG A +KI  +   G+  A +P+ IG +L+E    
Sbjct: 232 GFIGGQTAPPGKRMGHAGAIISGGKGTASEKIKTLNSCGVETANTPSEIGTTLIEAAKK 290


>gi|90421034|ref|ZP_01228937.1| succinyl-CoA synthetase, alpha subunit [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90334669|gb|EAS48446.1| succinyl-CoA synthetase, alpha subunit [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 303

 Score =  339 bits (869), Expect = 4e-91,   Method: Composition-based stats.
 Identities = 222/302 (73%), Positives = 267/302 (88%), Gaps = 4/302 (1%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGN----VNV 56
           MSILVDKNTKV+VQGLTGK G+FHTEQA+ Y  TQ+VGG HPKKG   W G +    V +
Sbjct: 1   MSILVDKNTKVIVQGLTGKTGSFHTEQALAYYGTQMVGGTHPKKGGEMWEGQSDGRTVQL 60

Query: 57  PVFTTVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKAR 116
           P+F++V EA+++T A ASVIYVPP+GA  AI E+I+AEI LIVCITEGIPV DMVRVKA+
Sbjct: 61  PIFSSVVEARDKTGATASVIYVPPAGAAAAIEEAIDAEIGLIVCITEGIPVSDMVRVKAK 120

Query: 117 LEKSSSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLG 176
           L+K+ SRL+GPNCPG+LTP+ CKIGIMPG+IF+ G+VGI+SRSGTLTYEAVFQT+ EGLG
Sbjct: 121 LDKTKSRLLGPNCPGVLTPEQCKIGIMPGNIFKTGNVGIVSRSGTLTYEAVFQTTNEGLG 180

Query: 177 QSTAVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRK 236
           Q+TAVGIGGDPVKGTEFID+LE+FLAD+ T+S++M+GEIGGSAEEEAAQFLKDEAK+GR 
Sbjct: 181 QTTAVGIGGDPVKGTEFIDMLEMFLADDETKSMIMIGEIGGSAEEEAAQFLKDEAKKGRS 240

Query: 237 KPIVGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVEL 296
           KP VGF+AG+TAP GRTMGHAGAV+SGGKGGAEDKI AM+ AGI ++PSPA++G++LVEL
Sbjct: 241 KPTVGFIAGRTAPKGRTMGHAGAVVSGGKGGAEDKIAAMESAGIRVSPSPAQLGKTLVEL 300

Query: 297 LG 298
           L 
Sbjct: 301 LK 302


>gi|15241592|ref|NP_196447.1| succinyl-CoA ligase (GDP-forming) alpha-chain, mitochondrial,
           putative / succinyl-CoA synthetase, alpha chain,
           putative / SCS-alpha, putative [Arabidopsis thaliana]
 gi|57014135|sp|P68209|SUCA1_ARATH RecName: Full=Succinyl-CoA ligase [ADP-forming] subunit alpha-1,
           mitochondrial; AltName: Full=Succinyl-CoA synthetase
           subunit alpha-1; Short=SCS-alpha-1; Flags: Precursor
 gi|3660467|emb|CAA05023.1| succinyl-CoA-ligase alpha subunit [Arabidopsis thaliana]
 gi|10178272|emb|CAC08330.1| succinyl-CoA-ligase alpha subunit [Arabidopsis thaliana]
 gi|18252215|gb|AAL61940.1| succinyl-CoA-ligase alpha subunit [Arabidopsis thaliana]
 gi|21387057|gb|AAM47932.1| succinyl-CoA-ligase alpha subunit [Arabidopsis thaliana]
 gi|21536557|gb|AAM60889.1| succinyl-CoA-ligase alpha subunit [Arabidopsis thaliana]
 gi|332003896|gb|AED91279.1| Succinyl-CoA ligase [GDP-forming] subunit alpha-1 [Arabidopsis
           thaliana]
          Length = 347

 Score =  339 bits (869), Expect = 4e-91,   Method: Composition-based stats.
 Identities = 185/299 (61%), Positives = 223/299 (74%), Gaps = 9/299 (3%)

Query: 2   SILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFTT 61
           ++ VDKNT+VL QG+TGK GTFHTEQAI Y  T++V G+ PKKG T   G    +PVF +
Sbjct: 51  AVFVDKNTRVLCQGITGKNGTFHTEQAIEY-GTKMVAGVTPKKGGTEHLG----LPVFNS 105

Query: 62  VAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLE-KS 120
           VAEAK  T ANASVIYVP   A  AI+E IEAE+ LIVCITEGIP  DMVRVK  L  +S
Sbjct: 106 VAEAKADTKANASVIYVPAPFAAAAIMEGIEAELDLIVCITEGIPQHDMVRVKHALNSQS 165

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            +RLIGPNCPGI+ P  CKIGIMPG I + G +GI+SRSGTLTYEAVFQT+  GLGQST 
Sbjct: 166 KTRLIGPNCPGIIKPGECKIGIMPGYIHKPGKIGIVSRSGTLTYEAVFQTTAVGLGQSTC 225

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP  GT F+D LE F  D  TE IV++GEIGG+AEE+AA  +K     G +KP+V
Sbjct: 226 VGIGGDPFNGTNFVDCLEKFFVDPQTEGIVLIGEIGGTAEEDAAALIKA---SGTEKPVV 282

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
            F+AG TAPPGR MGHAGA++SGGKG A+DKI ++ +AG+ +  SPA+IG ++ EL   
Sbjct: 283 AFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKSLNDAGVKVVESPAKIGSAMYELFQE 341


>gi|313895074|ref|ZP_07828631.1| succinyl-CoA synthetase, alpha subunit [Selenomonas sp. oral taxon
           137 str. F0430]
 gi|312975969|gb|EFR41427.1| succinyl-CoA synthetase, alpha subunit [Selenomonas sp. oral taxon
           137 str. F0430]
          Length = 301

 Score =  339 bits (869), Expect = 4e-91,   Method: Composition-based stats.
 Identities = 166/299 (55%), Positives = 220/299 (73%), Gaps = 8/299 (2%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL+DKNTK +VQG+TGKA  FHT Q +    TQ+V G+ P K      G    VPV+ 
Sbjct: 1   MSILIDKNTKAIVQGITGKAALFHTRQMLD-AGTQIVAGVTPGKAGQVVEG----VPVYN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV +A E T ANASVIYVP   A D+I+E+++AE+PL++CITE IPVLDMV+V+  ++  
Sbjct: 56  TVRDAVEATGANASVIYVPARFAADSIMEAVDAELPLVICITEHIPVLDMVKVRRYMQGK 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            SRL+GPNCPG+LTP+  K+GI P S+ + G VG++SRSGTLTYEA FQ +  G+GQ+T 
Sbjct: 116 KSRLVGPNCPGLLTPNQAKLGITPTSVAKPGHVGLVSRSGTLTYEAAFQLTNAGIGQTTT 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPVK  +FIDVL+LF  D  T ++ M+GEIGG+AEEEAA+++K+      +KP+ 
Sbjct: 176 VGIGGDPVKDMDFIDVLKLFKEDPDTLAVFMIGEIGGTAEEEAAKWIKENM---PEKPVA 232

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
            F+AG+ APPG+ MGHAGA+ISGGKG A DK+ A+  AGI +A + A IG ++V+LL  
Sbjct: 233 AFIAGRQAPPGKRMGHAGAIISGGKGTAADKVAALNAAGIPVADTVAHIGETMVKLLKE 291


>gi|294637431|ref|ZP_06715722.1| succinyl-CoA synthetase subunit alpha [Edwardsiella tarda ATCC
           23685]
 gi|291089424|gb|EFE21985.1| succinyl-CoA synthetase subunit alpha [Edwardsiella tarda ATCC
           23685]
          Length = 290

 Score =  338 bits (868), Expect = 4e-91,   Method: Composition-based stats.
 Identities = 171/299 (57%), Positives = 223/299 (74%), Gaps = 10/299 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL++K T+V+ QG TG  GTFH+EQA+ Y  +Q+VGG+ P KG +   G    +PVF 
Sbjct: 1   MSILINKETRVICQGFTGSQGTFHSEQALAY-GSQLVGGVTPGKGGSEHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA + TAA+ASVIYVP     D+I+E+I+A I LI+CITEGIP  DM+ VKA+L++ 
Sbjct: 56  TVREAVQATAASASVIYVPAPFCKDSILEAIDAGITLIICITEGIPTQDMLLVKAKLDQC 115

Query: 121 S-SRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQST 179
              R+IGPNCPG++TP  CKIGIMPG I + G +GI+SRSGTLTYEAV QTS  GLGQST
Sbjct: 116 PGVRMIGPNCPGVITPGECKIGIMPGHIHQPGRIGIVSRSGTLTYEAVKQTSDVGLGQST 175

Query: 180 AVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPI 239
            VGIGGDP+ G+ FID+L LF AD  T++IVM+GEIGG+AEEEAA ++K        KP+
Sbjct: 176 CVGIGGDPIPGSSFIDILALFQADPQTDAIVMIGEIGGNAEEEAAAYIKQH----VTKPV 231

Query: 240 VGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           V ++AG TAP G+ MGHAGA+I+GGKG A++K  A++ AG+    S A IG++L+ +LG
Sbjct: 232 VAYIAGVTAPKGKRMGHAGAIIAGGKGTADEKFAALEAAGVTTVRSLADIGQALLRVLG 290


>gi|297808323|ref|XP_002872045.1| hypothetical protein ARALYDRAFT_489184 [Arabidopsis lyrata subsp.
           lyrata]
 gi|297317882|gb|EFH48304.1| hypothetical protein ARALYDRAFT_489184 [Arabidopsis lyrata subsp.
           lyrata]
          Length = 339

 Score =  338 bits (868), Expect = 4e-91,   Method: Composition-based stats.
 Identities = 184/299 (61%), Positives = 225/299 (75%), Gaps = 9/299 (3%)

Query: 2   SILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFTT 61
           ++ VDKNT+V+ QG+TGK GTFHTEQAI Y  T++V G+ PKKG T   G    +PVF T
Sbjct: 44  AVFVDKNTRVICQGITGKNGTFHTEQAIEY-GTKMVAGVTPKKGGTEHLG----LPVFNT 98

Query: 62  VAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLE-KS 120
           VAEAK  T ANASVIYVP   A  AI+E + AE+ LIVCITEGIP  DMVRVKA L  +S
Sbjct: 99  VAEAKAETKANASVIYVPAPFAAAAIMEGLAAELDLIVCITEGIPQHDMVRVKAALNSQS 158

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            +RLIGPNCPGI+ P  CKIGIMPG I + G +GI+SRSGTLTYEAVFQT+  GLGQST 
Sbjct: 159 KTRLIGPNCPGIIKPGECKIGIMPGYIHKPGKIGIVSRSGTLTYEAVFQTTAVGLGQSTC 218

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP  GT F+D LE F AD  TE IV++GEIGG+AEE+AA  +K+    G  KP+V
Sbjct: 219 VGIGGDPFNGTNFVDCLEKFFADPQTEGIVLIGEIGGTAEEDAAALIKE---SGTDKPVV 275

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
            F+AG TAPPGR MGHAGA++SGGKG A+DKI ++++AG+ +  SPA+IG ++ E+   
Sbjct: 276 AFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKSLRDAGVKVVESPAKIGAAMFEIFQE 334


>gi|90416061|ref|ZP_01223994.1| succinyl-CoA synthetase alpha chain [marine gamma proteobacterium
           HTCC2207]
 gi|90332435|gb|EAS47632.1| succinyl-CoA synthetase alpha chain [marine gamma proteobacterium
           HTCC2207]
          Length = 290

 Score =  338 bits (868), Expect = 4e-91,   Method: Composition-based stats.
 Identities = 169/298 (56%), Positives = 213/298 (71%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL++++TKV+ QG TG  GTFH+EQA+ Y  T++VGG+ P KG T   G    +PVF 
Sbjct: 1   MSILINRDTKVICQGFTGGQGTFHSEQALEY-GTKMVGGVTPGKGGTTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TVAEA E T A ASVIYVP +   D+I+E+  A + L+VCITEGIP  DM+  K   +  
Sbjct: 56  TVAEAVETTGAEASVIYVPAAFCKDSILEAANAGLKLVVCITEGIPTQDMLDCKVVCDTL 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             RLIGPNCPG++TP  CKIGIMPG I   G VGI+SRSGTLTYEAV QT+  G GQST 
Sbjct: 116 GVRLIGPNCPGVITPGECKIGIMPGHIHLPGKVGIVSRSGTLTYEAVKQTTDYGYGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L LF  D ATE+IVM+GEIGG+AEEEAA ++K        KP+V
Sbjct: 176 VGIGGDPIPGSSFIDILALFEKDPATEAIVMIGEIGGTAEEEAAAYIKAN----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            ++AG TAP G+ MGHAGA++SGGKG A++K  A+++AG+    S A IG  L E+ G
Sbjct: 232 SYIAGVTAPAGKRMGHAGAIVSGGKGTADEKFAALEDAGVKTVRSLADIGAGLKEITG 289


>gi|314933427|ref|ZP_07840792.1| succinyl-CoA synthase, alpha subunit [Staphylococcus caprae C87]
 gi|313653577|gb|EFS17334.1| succinyl-CoA synthase, alpha subunit [Staphylococcus caprae C87]
          Length = 302

 Score =  338 bits (868), Expect = 4e-91,   Method: Composition-based stats.
 Identities = 167/299 (55%), Positives = 221/299 (73%), Gaps = 9/299 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+ +DKNTKV+VQG+TG    FHT+Q + Y  TQ+V G+ P KG     G    VPV+ 
Sbjct: 1   MSVFIDKNTKVMVQGITGSTALFHTKQMLDY-GTQIVAGVTPGKGGQVVEG----VPVYN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EAK  T AN SV+YVP   A D+I+E+ EAE+ +++CITE IPV+DMV+V   L+  
Sbjct: 56  TVEEAKNETGANVSVVYVPAPFAADSILEAAEAELDMVICITEHIPVVDMVKVNRYLQGR 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            +RL+GPNCPG++T D CKIGIMPG I +KG VG++SRSGTLTYEAV Q ++EG+GQ+TA
Sbjct: 116 KTRLVGPNCPGVITADECKIGIMPGYIHKKGHVGVVSRSGTLTYEAVHQLTEEGIGQTTA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPV GT FIDVL+ F  D  T+++VM+GEIGG+AEEEAAQ++K        KP+V
Sbjct: 176 VGIGGDPVNGTNFIDVLKEFNEDPETKAVVMIGEIGGTAEEEAAQWIKQNM----NKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
           GF+ G+TAPPG+ MGHAGA+ISGGKG A++KI  + + G+  A +P+ IG +L++    
Sbjct: 232 GFIGGQTAPPGKRMGHAGAIISGGKGTADEKIKTLNDCGVETADTPSEIGTTLIDAAKK 290


>gi|114563511|ref|YP_751024.1| succinyl-CoA synthetase, alpha subunit [Shewanella frigidimarina
           NCIMB 400]
 gi|114334804|gb|ABI72186.1| succinyl-CoA synthetase (ADP-forming) alpha subunit [Shewanella
           frigidimarina NCIMB 400]
          Length = 290

 Score =  338 bits (868), Expect = 4e-91,   Method: Composition-based stats.
 Identities = 174/294 (59%), Positives = 217/294 (73%), Gaps = 9/294 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+TKV+ QG TG  GTFH+EQAI Y  TQ+VGG+ P KG     G    +PVF 
Sbjct: 1   MSVLINKDTKVICQGFTGGQGTFHSEQAIAY-GTQMVGGVSPGKGGQTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV +A   T A A+VIYVP     DAI+E+I+A + LIVCITEGIP LDM++VK +LE++
Sbjct: 56  TVKDAVAATGATATVIYVPAPFCKDAILEAIDAGLELIVCITEGIPTLDMLQVKVKLEET 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TP  CKIGIMPG I   G VGI+SRSGTLTYEAV QT+ EG GQST 
Sbjct: 116 GVRMIGPNCPGVITPGECKIGIMPGHIHLPGKVGIVSRSGTLTYEAVKQTTDEGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ GT FIDVLE+F  D  TE+IVM+GEIGG+AEEEAA ++K        KP+V
Sbjct: 176 VGIGGDPIPGTNFIDVLEMFQNDPQTEAIVMIGEIGGNAEEEAAAYIKAH----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLV 294
            ++AG TAP G+ MGHAGA+I+GGKG AEDK  A++ AG+    S A IG++L 
Sbjct: 232 SYIAGVTAPEGKRMGHAGAIIAGGKGTAEDKFAALEAAGVTTVRSLADIGKALR 285


>gi|126726905|ref|ZP_01742744.1| succinyl-CoA synthetase subunit alpha [Rhodobacterales bacterium
           HTCC2150]
 gi|126703863|gb|EBA02957.1| succinyl-CoA synthetase subunit alpha [Rhodobacterales bacterium
           HTCC2150]
          Length = 299

 Score =  338 bits (868), Expect = 4e-91,   Method: Composition-based stats.
 Identities = 225/299 (75%), Positives = 265/299 (88%), Gaps = 1/299 (0%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGG-NVNVPVF 59
           MSIL++K+TK++VQGLTGK GTFHTEQA+ Y  TQ+V G HPKKG T WT      +P+F
Sbjct: 1   MSILINKDTKIIVQGLTGKTGTFHTEQALAYHGTQMVAGTHPKKGGTNWTAESGAELPIF 60

Query: 60  TTVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEK 119
            +VAEAKE+T A ASVIYVPP+GA  AI E+I+AEI LI CITEG+PV DMVRVK +L+ 
Sbjct: 61  ASVAEAKEQTGATASVIYVPPAGAAAAIEEAIDAEIDLITCITEGVPVQDMVRVKEKLDA 120

Query: 120 SSSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQST 179
           S SRLIGPNCPG++TPD CKIGIMPGSIF+KGSVG+LSRSGTLTYEAVFQT+Q GLGQS+
Sbjct: 121 SKSRLIGPNCPGLMTPDECKIGIMPGSIFKKGSVGVLSRSGTLTYEAVFQTTQAGLGQSS 180

Query: 180 AVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPI 239
           AVGIGGDPVKGTEFID+LEL+LAD  T+SI+M+GEIGGSAEE+AAQFL DEAK+GRKKP+
Sbjct: 181 AVGIGGDPVKGTEFIDILELYLADPETQSIIMIGEIGGSAEEDAAQFLIDEAKKGRKKPV 240

Query: 240 VGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           VGF+AG+TAPPGRTMGHAGAVISGGKGGA+DKI AM+EAGI ++PSPA++G +LVELLG
Sbjct: 241 VGFIAGRTAPPGRTMGHAGAVISGGKGGADDKIAAMQEAGIAVSPSPAKLGETLVELLG 299


>gi|319407857|emb|CBI81510.1| succinyl-CoA synthetase, alpha chain [Bartonella sp. 1-1C]
          Length = 300

 Score =  338 bits (868), Expect = 5e-91,   Method: Composition-based stats.
 Identities = 235/299 (78%), Positives = 269/299 (89%), Gaps = 1/299 (0%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTG-GNVNVPVF 59
           MSIL++K+TKVLVQGLTGK GTFHTEQA+ Y  TQ+VGGI+PKKG   W G     +P+F
Sbjct: 1   MSILINKDTKVLVQGLTGKTGTFHTEQALAYHGTQMVGGINPKKGGETWKGSKGETLPIF 60

Query: 60  TTVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEK 119
            +V E KE+T A+ASVIYVPP+GA DAIIE+IEAEI LIVCITEGIPV+DMV+VKA+LE+
Sbjct: 61  ASVVEGKEKTGADASVIYVPPAGAADAIIEAIEAEIGLIVCITEGIPVMDMVKVKAKLEQ 120

Query: 120 SSSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQST 179
           S SRLIGPNCPGILTPD CKIGIMPGSIFRKGSVG++SRSGTLTYEAVFQTS EGLGQ+T
Sbjct: 121 SKSRLIGPNCPGILTPDECKIGIMPGSIFRKGSVGVVSRSGTLTYEAVFQTSHEGLGQTT 180

Query: 180 AVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPI 239
           A+GIGGDPVKGTEFIDVLE+FLAD  TESIVM+GEIGGSAEE AAQFLKDEAK+GRKKP+
Sbjct: 181 AIGIGGDPVKGTEFIDVLEMFLADNETESIVMIGEIGGSAEEAAAQFLKDEAKKGRKKPM 240

Query: 240 VGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           VGF+AG+TAPPGRTMGHAGAVISGGKGGAEDKI AM+ AGI ++PSP++IG++LVE L 
Sbjct: 241 VGFIAGRTAPPGRTMGHAGAVISGGKGGAEDKIAAMEAAGIRVSPSPSQIGKTLVEELK 299


>gi|262371938|ref|ZP_06065217.1| succinyl-CoA synthetase subunit alpha [Acinetobacter junii SH205]
 gi|262311963|gb|EEY93048.1| succinyl-CoA synthetase subunit alpha [Acinetobacter junii SH205]
          Length = 296

 Score =  338 bits (868), Expect = 5e-91,   Method: Composition-based stats.
 Identities = 161/301 (53%), Positives = 222/301 (73%), Gaps = 11/301 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+TKVLVQG TGK GTFH+ QA+ Y  T+VVGG+ P KG T      +++PVF 
Sbjct: 1   MSVLINKDTKVLVQGFTGKNGTFHSAQALDY-GTKVVGGVTPGKGGTTH----LDLPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARL--E 118
           T+ +A   T A+ASVIYVP     D+I+E++++ + LIV ITEG+P +DM++ K  L   
Sbjct: 56  TMKDAVRETGADASVIYVPAPFVLDSIVEAVDSGVGLIVVITEGVPTIDMLKAKRYLETN 115

Query: 119 KSSSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQS 178
            + +RL+GPNCPG++TP  CKIGIMPG I + G +GI+SRSGTLTYEAV QT++ GLGQS
Sbjct: 116 GNGTRLVGPNCPGVITPGECKIGIMPGHIHQPGRIGIISRSGTLTYEAVAQTTKLGLGQS 175

Query: 179 TAVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKP 238
           T +GIGGDP+ G   ID L+LF  D  T++I+M+GEIGG+AEEEAA+F++        KP
Sbjct: 176 TCIGIGGDPIPGMNQIDALKLFQDDPDTDAIIMIGEIGGTAEEEAAEFIQSN----VTKP 231

Query: 239 IVGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           +VG++AG TAP G+ MGHAGA+ISGGKG AE+K  A ++AG+    SPA +G +++++L 
Sbjct: 232 VVGYIAGVTAPKGKRMGHAGAIISGGKGTAEEKFAAFEKAGMAYTRSPAELGSTMMQVLK 291

Query: 299 S 299
            
Sbjct: 292 E 292


>gi|83816633|ref|YP_444808.1| succinyl-CoA synthetase, alpha subunit [Salinibacter ruber DSM
           13855]
 gi|83758027|gb|ABC46140.1| succinyl-CoA synthetase, alpha subunit [Salinibacter ruber DSM
           13855]
          Length = 288

 Score =  338 bits (868), Expect = 5e-91,   Method: Composition-based stats.
 Identities = 166/297 (55%), Positives = 211/297 (71%), Gaps = 9/297 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSILVD +T+V+VQGLTG  GTFH EQ + Y  T VV G+ P KG     G     PV+ 
Sbjct: 1   MSILVDDDTRVVVQGLTGSEGTFHAEQMMDY-GTNVVAGVTPGKGGQTHLGR----PVYN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TVAEA E+  AN S+I+VPP  A DAI ES +A   +I+CITEGIPV DM      ++K 
Sbjct: 56  TVAEAVEQENANTSIIFVPPPFAADAIQESADAGAEVIICITEGIPVADMKPTYQYVKKK 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            + LIGPNCPG++TP + K+GIMP  IF  GS+GI+SRSGTLTYEAV Q ++ G GQSTA
Sbjct: 116 GAHLIGPNCPGVITPGAAKVGIMPAMIFEPGSIGIISRSGTLTYEAVDQITRAGFGQSTA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPV GT FID LELF  D  T+ IV++GEIGG+ E+EAA++++D        P+ 
Sbjct: 176 VGIGGDPVIGTRFIDALELFEDDPDTDGIVLIGEIGGTDEQEAARYVQDHM----DTPVF 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELL 297
           GF+AG+TAPPGR MGHAGA++SGG G AE K  A++EAG  +  +PA IG ++ ++L
Sbjct: 232 GFIAGRTAPPGRRMGHAGAIVSGGSGTAEAKFQALEEAGATVVKNPALIGETVQDVL 288


>gi|293610892|ref|ZP_06693191.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|292826544|gb|EFF84910.1| conserved hypothetical protein [Acinetobacter sp. SH024]
          Length = 296

 Score =  338 bits (868), Expect = 5e-91,   Method: Composition-based stats.
 Identities = 161/301 (53%), Positives = 222/301 (73%), Gaps = 11/301 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+TKVLVQG TGK GTFH+ QA+ Y  T+VVGG+ P KG T      +++PVF 
Sbjct: 1   MSVLINKDTKVLVQGFTGKNGTFHSAQALDY-GTKVVGGVTPGKGGTTH----LDLPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARL--E 118
           T+ EA   T A+ASVIYVP     D+I+E++++ + LIV ITEG+P +DM++ K  L   
Sbjct: 56  TMKEAVGETNADASVIYVPAPFVLDSIVEAVDSGVGLIVVITEGVPTIDMLKAKRYLETN 115

Query: 119 KSSSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQS 178
            + +RL+GPNCPG++TP  CKIGIMPG I + G +GI+SRSGTLTYEAV QT++ GLGQS
Sbjct: 116 GNGTRLVGPNCPGVITPGECKIGIMPGHIHQPGRIGIISRSGTLTYEAVAQTTKLGLGQS 175

Query: 179 TAVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKP 238
           T +GIGGDP+ G   I+ L+LF  D  T++I+M+GEIGG+AEEEAA+F+K        KP
Sbjct: 176 TCIGIGGDPIPGMNQIEALQLFQDDPDTDAIIMIGEIGGTAEEEAAEFIKSN----VTKP 231

Query: 239 IVGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           +VG++AG TAP G+ MGHAGA+ISGG+G AE+K  A ++AG+    SPA +G +++++L 
Sbjct: 232 VVGYIAGVTAPKGKRMGHAGAIISGGQGTAEEKFAAFEKAGMAYTRSPAELGSTMLQVLK 291

Query: 299 S 299
            
Sbjct: 292 E 292


>gi|332976752|gb|EGK13583.1| succinyl-CoA synthetase subunit alpha [Desmospora sp. 8437]
          Length = 310

 Score =  338 bits (868), Expect = 5e-91,   Method: Composition-based stats.
 Identities = 176/304 (57%), Positives = 227/304 (74%), Gaps = 10/304 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWT-----GGNVN 55
           MSI ++K+TKV+ QG+TGK G FHT+  + Y  TQ+V G  P KG T        G   +
Sbjct: 1   MSIFINKDTKVITQGITGKTGLFHTKGGLEY-GTQMVAGAVPGKGGTQVEITLDNGEIKS 59

Query: 56  VPVFTTVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKA 115
           VPVF TVAEAKE+T ANASVIYVPP+ A DAI+E+++A++ L++CITEGIPV+DMV+V  
Sbjct: 60  VPVFDTVAEAKEKTGANASVIYVPPAFAADAIMEAVDADLDLVICITEGIPVMDMVKVNR 119

Query: 116 RLEKSSSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGL 175
            +E   +RLIGPNCPG++TP   KIGIMPG I   G VG++SRSGTLTYEAV Q +Q G+
Sbjct: 120 YMEGKRTRLIGPNCPGVITPGESKIGIMPGYIHTPGRVGVVSRSGTLTYEAVHQLTQRGI 179

Query: 176 GQSTAVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGR 235
           GQSTAVGIGGDPV GT FIDVLE F  D  T +++M+GEIGG+AEEEAA ++K       
Sbjct: 180 GQSTAVGIGGDPVNGTNFIDVLEQFQQDPDTSAVIMIGEIGGTAEEEAADWIKANM---- 235

Query: 236 KKPIVGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVE 295
            KP+VGF+ G+TAPPG+ MGHAGA+ISGGKG A++K+  ++  G+ +AP+PA IG +LV 
Sbjct: 236 TKPVVGFIGGQTAPPGKRMGHAGAIISGGKGTAKEKVAKLEACGVAVAPTPADIGETLVR 295

Query: 296 LLGS 299
           +L  
Sbjct: 296 VLKE 299


>gi|312113430|ref|YP_004011026.1| succinyl-CoA synthetase, subunit alpha [Rhodomicrobium vannielii
           ATCC 17100]
 gi|311218559|gb|ADP69927.1| succinyl-CoA synthetase, alpha subunit [Rhodomicrobium vannielii
           ATCC 17100]
          Length = 291

 Score =  338 bits (868), Expect = 5e-91,   Method: Composition-based stats.
 Identities = 198/298 (66%), Positives = 237/298 (79%), Gaps = 8/298 (2%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           M+ILVDKNTKV+ QG TG  GTFH+EQAI Y  T++VGG+ P KG +   G    +PVF 
Sbjct: 1   MAILVDKNTKVICQGFTGAQGTFHSEQAIAY-GTKMVGGVTPGKGGSTHLG----LPVFD 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV +A ++T ANA+ IYVPP  A DAI+E+I+AEIPLIV ITEGIPV DM++VK  L  S
Sbjct: 56  TVLDAVQKTGANATAIYVPPPFAADAILEAIDAEIPLIVTITEGIPVEDMIKVKRALVGS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            SRLIGPNCPG++TP  CKIGIMPG I ++GSVGI+SRSGTLTYEAV QT+  GLGQ+T 
Sbjct: 116 KSRLIGPNCPGVITPGECKIGIMPGHIHKRGSVGIVSRSGTLTYEAVHQTTLAGLGQTTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           +GIGGDPVKGTE IDVLE+ LAD+ T+SI+M+GEIGGSAEEEAA F +      RKKPIV
Sbjct: 176 IGIGGDPVKGTEHIDVLEMLLADDETQSIIMIGEIGGSAEEEAADFYR---TSSRKKPIV 232

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           GF+AG TAPPGR MGHAGA+I+GGKG A DKI AMK AGI ++PSPA +G +LVE+L 
Sbjct: 233 GFIAGVTAPPGRRMGHAGAIIAGGKGSAGDKIEAMKSAGIVVSPSPAALGSTLVEVLK 290


>gi|294651210|ref|ZP_06728538.1| succinyl-CoA synthetase subunit alpha [Acinetobacter haemolyticus
           ATCC 19194]
 gi|292822863|gb|EFF81738.1| succinyl-CoA synthetase subunit alpha [Acinetobacter haemolyticus
           ATCC 19194]
          Length = 296

 Score =  338 bits (867), Expect = 5e-91,   Method: Composition-based stats.
 Identities = 161/301 (53%), Positives = 221/301 (73%), Gaps = 11/301 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+TKVLVQG TGK GTFH+ QA+ Y  T+VVGG+ P KG T      +++PVF 
Sbjct: 1   MSVLINKDTKVLVQGFTGKNGTFHSAQALDY-GTKVVGGVTPGKGGTTH----LDLPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARL--E 118
           T+ EA   T A+ASVIYVP     D+I+E++++ + LIV ITEG+P +DM++ K  L   
Sbjct: 56  TMKEAVRETQADASVIYVPAPFVLDSIVEAVDSGVGLIVVITEGVPTIDMLKAKRYLETN 115

Query: 119 KSSSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQS 178
            + +RL+GPNCPG++TP  CKIGIMPG I + G +GI+SRSGTLTYEAV QT++ GLGQS
Sbjct: 116 GNGTRLVGPNCPGVITPGECKIGIMPGHIHQPGRIGIISRSGTLTYEAVAQTTKLGLGQS 175

Query: 179 TAVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKP 238
           T +GIGGDP+ G   I+ L+LF  D  T++I+M+GEIGG+AEEEAA+F+K        KP
Sbjct: 176 TCIGIGGDPIPGMNQIEALQLFQDDPDTDAIIMIGEIGGTAEEEAAEFIKSN----VTKP 231

Query: 239 IVGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           +VG++AG TAP G+ MGHAGA+ISGG+G AE+K  A + AG+    SPA +G +++++L 
Sbjct: 232 VVGYIAGVTAPKGKRMGHAGAIISGGQGTAEEKFAAFERAGMAYTRSPAELGSTMMQVLK 291

Query: 299 S 299
            
Sbjct: 292 E 292


>gi|91776240|ref|YP_545996.1| succinyl-CoA synthetase (ADP-forming) alpha subunit
           [Methylobacillus flagellatus KT]
 gi|91710227|gb|ABE50155.1| succinyl-CoA synthetase (ADP-forming) alpha subunit
           [Methylobacillus flagellatus KT]
          Length = 292

 Score =  338 bits (867), Expect = 5e-91,   Method: Composition-based stats.
 Identities = 180/299 (60%), Positives = 229/299 (76%), Gaps = 9/299 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           M+ILV+K TKVL QG TGK GTFH+EQA+ Y  TQ+VGG+ P KG       ++++PVF 
Sbjct: 1   MAILVNKQTKVLCQGFTGKQGTFHSEQALAY-GTQMVGGVTPGKGGQ----RHLDLPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           T+  A   T ANASVIYVPP+ A D+I+E+ +A I LIVCITEGIPVLDM+ VKA L+ +
Sbjct: 56  TMRSAVRETGANASVIYVPPAFAADSILEACDAGIELIVCITEGIPVLDMLNVKAALQAN 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            +RL+GPNCPG++TPD CKIGIMPGSI  +G VGI+SRSGTLTYEAV QT+  GLGQST 
Sbjct: 116 GARLVGPNCPGVITPDECKIGIMPGSIHLRGKVGIVSRSGTLTYEAVHQTTALGLGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP++G  FID LELF AD  TE+I+MVGEIGGS EE AA+++K        KP+ 
Sbjct: 176 VGIGGDPIRGMNFIDCLELFEADPETEAIIMVGEIGGSDEEAAAEYIKQY----VTKPVA 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
           G++AG+TAP G+ MGHAGA+ISGG G AEDKI A+++AG+ +A SPA +G ++   + +
Sbjct: 232 GYIAGQTAPAGKRMGHAGAIISGGSGKAEDKIRALEQAGVVVASSPAGLGEAVQVAIQA 290


>gi|226951553|ref|ZP_03822017.1| succinyl-CoA synthetase alpha chain [Acinetobacter sp. ATCC 27244]
 gi|226837695|gb|EEH70078.1| succinyl-CoA synthetase alpha chain [Acinetobacter sp. ATCC 27244]
          Length = 296

 Score =  338 bits (867), Expect = 5e-91,   Method: Composition-based stats.
 Identities = 161/301 (53%), Positives = 221/301 (73%), Gaps = 11/301 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+TKVLVQG TGK GTFH+ QA+ Y  T+VVGG+ P KG T      +++PVF 
Sbjct: 1   MSVLINKDTKVLVQGFTGKNGTFHSAQALDY-GTKVVGGVTPGKGGTTH----LDLPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARL--E 118
           T+ EA   T A+ASVIYVP     D+I+E++++ + LIV ITEG+P +DM++ K  L   
Sbjct: 56  TMKEAVRETQADASVIYVPAPFVLDSIVEAVDSGVGLIVVITEGVPTIDMLKAKRYLETN 115

Query: 119 KSSSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQS 178
            + +RL+GPNCPG++TP  CKIGIMPG I + G +GI+SRSGTLTYEAV QT++ GLGQS
Sbjct: 116 GNGTRLVGPNCPGVITPGECKIGIMPGHIHQPGRIGIISRSGTLTYEAVAQTTKLGLGQS 175

Query: 179 TAVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKP 238
           T +GIGGDP+ G   I+ L+LF  D  T++I+M+GEIGG+AEEEAA+F+K        KP
Sbjct: 176 TCIGIGGDPIPGMNQIEALQLFQDDPDTDAIIMIGEIGGTAEEEAAEFIKSN----VSKP 231

Query: 239 IVGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           +VG++AG TAP G+ MGHAGA+ISGG+G AE+K  A + AG+    SPA +G +++++L 
Sbjct: 232 VVGYIAGVTAPKGKRMGHAGAIISGGQGTAEEKFAAFERAGMAYTRSPAELGSTMMQVLK 291

Query: 299 S 299
            
Sbjct: 292 E 292


>gi|284097281|ref|ZP_06385421.1| succinyl-CoA synthetase, alpha subunit [Candidatus Poribacteria sp.
           WGA-A3]
 gi|283831205|gb|EFC35175.1| succinyl-CoA synthetase, alpha subunit [Candidatus Poribacteria sp.
           WGA-A3]
          Length = 290

 Score =  338 bits (867), Expect = 6e-91,   Method: Composition-based stats.
 Identities = 174/299 (58%), Positives = 221/299 (73%), Gaps = 9/299 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSILV+K+T+V+VQG+TGK G+FH  Q   Y  TQVV G+ P K      G    +PVF 
Sbjct: 1   MSILVNKSTRVVVQGITGKEGSFHATQCQAY-GTQVVAGVTPGKAGQEVEG----IPVFH 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV +A + T A  S+I+VPP  A DAI+E+  A I L+VCITEGIPV DMVRVK  L  +
Sbjct: 56  TVRDAVKETEATTSLIFVPPPFAADAILEAANAGIWLVVCITEGIPVNDMVRVKRALAST 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            +RLIGPNCPGI+T D CKIGIMPG I RKG VG++SRSGTLTYEAV Q +  GLG++T 
Sbjct: 116 QTRLIGPNCPGIITADECKIGIMPGFIHRKGKVGVISRSGTLTYEAVNQLTNLGLGETTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ GT +ID+L++F  DE T+++VM+GEIGG AEE+AA F+K    R   KP+V
Sbjct: 176 VGIGGDPIIGTGYIDLLQMFEHDEETKAVVMIGEIGGDAEEKAAAFIK----REMTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
           GF+AG TAPPGR MGHAGA+I+GG+G A+DKI A++ AG+ +  +PA IG ++   LGS
Sbjct: 232 GFIAGMTAPPGRRMGHAGAIITGGQGTAKDKIAALEAAGVQVVRNPAEIGETVKAALGS 290


>gi|304321562|ref|YP_003855205.1| Succinyl-CoA synthetase subunit alpha [Parvularcula bermudensis
           HTCC2503]
 gi|303300464|gb|ADM10063.1| Succinyl-CoA synthetase alpha chain [Parvularcula bermudensis
           HTCC2503]
          Length = 299

 Score =  338 bits (867), Expect = 6e-91,   Method: Composition-based stats.
 Identities = 206/302 (68%), Positives = 239/302 (79%), Gaps = 8/302 (2%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNV----NV 56
           MSILVDKNTKV+ QGLTGK GTFHTE AI Y  T++VGG+ P KG   W  G V     +
Sbjct: 1   MSILVDKNTKVICQGLTGKTGTFHTEHAIAY-GTKMVGGVTPGKGGQTWEAGEVASGATL 59

Query: 57  PVFTTVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKAR 116
           PVF TV  AKE T A+ASVIYVPP  A  +IIE+IEAEIPL++ ITEGIPVLDMV+VKA+
Sbjct: 60  PVFDTVQAAKEETGADASVIYVPPKFAAASIIEAIEAEIPLVITITEGIPVLDMVKVKAK 119

Query: 117 LEKSSSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLG 176
           LE S +RL+GPNCPG++TPD CKIGIMPG I R+GSVGI+SRSGTLTYEAV QT+Q GLG
Sbjct: 120 LEGSKTRLVGPNCPGVITPDECKIGIMPGHIHRRGSVGIVSRSGTLTYEAVHQTTQVGLG 179

Query: 177 QSTAVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRK 236
           QST VGIGGDPVKG +FIDVLELFLAD+ T+ I+M+GEIGGSAE EAA FL +      K
Sbjct: 180 QSTCVGIGGDPVKGMDFIDVLELFLADDETQQIIMIGEIGGSAETEAAAFLAE---SKVK 236

Query: 237 KPIVGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVEL 296
           KP VGF+AG TAPPGR MGHAGA++SGG   AE KI AMK AGI ++PSPA +G ++ EL
Sbjct: 237 KPTVGFIAGVTAPPGRRMGHAGAIVSGGADTAEAKIEAMKAAGISVSPSPAGLGATMKEL 296

Query: 297 LG 298
           L 
Sbjct: 297 LA 298


>gi|148262239|ref|YP_001228945.1| succinyl-CoA synthetase, alpha subunit [Geobacter uraniireducens
           Rf4]
 gi|148265507|ref|YP_001232213.1| succinyl-CoA synthetase, alpha subunit [Geobacter uraniireducens
           Rf4]
 gi|146395739|gb|ABQ24372.1| succinyl-CoA synthetase, alpha subunit [Geobacter uraniireducens
           Rf4]
 gi|146399007|gb|ABQ27640.1| succinyl-CoA synthetase (ADP-forming) alpha subunit [Geobacter
           uraniireducens Rf4]
          Length = 290

 Score =  338 bits (867), Expect = 6e-91,   Method: Composition-based stats.
 Identities = 164/298 (55%), Positives = 220/298 (73%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL++K+TKV+ QG+TG  G FH + A  Y  TQ+VGG+ P KG T   G     PV+ 
Sbjct: 1   MSILINKDTKVITQGITGATGLFHAQGAREY-GTQMVGGVTPGKGGTTIDG----FPVYD 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA  +T A ASVIYVPP  A D+I+E+++A I L+ CITEGIPVLDMV+VK  ++  
Sbjct: 56  TVREAVLQTGATASVIYVPPPFAADSIMEAVDAGIELVCCITEGIPVLDMVKVKQYMKGK 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            +RL+GPNCPG++TP  CKIGIMPG I + G +G++SRSGTLTYEAV+Q +  GLGQST 
Sbjct: 116 KTRLVGPNCPGVITPGQCKIGIMPGYIHKPGKIGVVSRSGTLTYEAVWQLTSLGLGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPV GT  +DVL++F AD  TE+++M+GEIGG++EEE A F+K+       KP+ 
Sbjct: 176 VGIGGDPVNGTNHLDVLKMFEADPDTEAVIMIGEIGGTSEEEGAYFVKEHM----TKPVA 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            ++AG TAPPG+ MGHAGA+ISGGKG A +K+  ++E GI +A SPA + ++L+++  
Sbjct: 232 AYIAGVTAPPGKRMGHAGAIISGGKGTATEKVAVLEECGISVAASPAEMAQALLKIYK 289


>gi|297806865|ref|XP_002871316.1| hypothetical protein ARALYDRAFT_487662 [Arabidopsis lyrata subsp.
           lyrata]
 gi|297317153|gb|EFH47575.1| hypothetical protein ARALYDRAFT_487662 [Arabidopsis lyrata subsp.
           lyrata]
          Length = 347

 Score =  338 bits (867), Expect = 6e-91,   Method: Composition-based stats.
 Identities = 185/299 (61%), Positives = 223/299 (74%), Gaps = 9/299 (3%)

Query: 2   SILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFTT 61
           ++ VDKNT+VL QG+TGK GTFHTEQAI Y  T++V G+ PKKG T   G    +PVF +
Sbjct: 51  AVFVDKNTRVLCQGITGKNGTFHTEQAIEY-GTKMVAGVTPKKGGTEHLG----LPVFNS 105

Query: 62  VAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLE-KS 120
           VAEAK  T ANASVIYVP   A  AI+E IEAE+ LIVCITEGIP  DMVRVK  L  +S
Sbjct: 106 VAEAKADTKANASVIYVPAPFAAAAIMEGIEAELDLIVCITEGIPQHDMVRVKHALNSQS 165

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            +RLIGPNCPGI+ P  CKIGIMPG I + G +GI+SRSGTLTYEAVFQT+  GLGQST 
Sbjct: 166 KTRLIGPNCPGIIKPGECKIGIMPGYIHKPGKIGIVSRSGTLTYEAVFQTTAVGLGQSTC 225

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP  GT F+D LE F  D  TE IV++GEIGG+AEE+AA  +K     G +KP+V
Sbjct: 226 VGIGGDPFNGTNFVDCLEKFFVDPQTEGIVLIGEIGGTAEEDAAALIKA---SGTEKPVV 282

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
            F+AG TAPPGR MGHAGA++SGGKG A+DKI ++ +AG+ +  SPA+IG ++ EL   
Sbjct: 283 AFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKSLNDAGVKVVESPAKIGAAMYELFQE 341


>gi|320529608|ref|ZP_08030688.1| succinyl-CoA synthetase subunit alpha [Selenomonas artemidis F0399]
 gi|320138101|gb|EFW30003.1| succinyl-CoA synthetase subunit alpha [Selenomonas artemidis F0399]
          Length = 301

 Score =  338 bits (867), Expect = 6e-91,   Method: Composition-based stats.
 Identities = 163/299 (54%), Positives = 221/299 (73%), Gaps = 8/299 (2%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL+DKNTK +VQG+TGKA  FHT Q +    TQ+V G+ P K      G    VPV+ 
Sbjct: 1   MSILIDKNTKAIVQGITGKAALFHTRQMLD-AGTQIVAGVTPGKAGQVVEG----VPVYN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV +A + T ANASVIYVP   A D+I+E+++AE+PL++CITE IPVLDMV+V+  ++  
Sbjct: 56  TVRDAVKATGANASVIYVPARFAADSIMEAVDAELPLVICITEHIPVLDMVKVRRYMQGK 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            +RL+GPNCPG+LTP+  K+GI P S+ + G VG++SRSGTLTYEA FQ +  G+GQ+T 
Sbjct: 116 KTRLLGPNCPGLLTPNQAKLGITPTSVAKPGHVGLVSRSGTLTYEAAFQLTNAGIGQTTT 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPVK  +FIDVL+LF AD  T ++ ++GEIGG+AEEEAA+++++      +KP+ 
Sbjct: 176 VGIGGDPVKDMDFIDVLKLFKADPDTLAVFLIGEIGGTAEEEAAKWIRENM---PEKPVA 232

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
            F+AG+ APPG+ MGHAGA+ISGGKG A DK+ A+  AGI +A + A IG ++V+LL  
Sbjct: 233 AFIAGRQAPPGKRMGHAGAIISGGKGTAADKVAALNAAGIPVAETVAHIGDTMVKLLKE 291


>gi|238898947|ref|YP_002924629.1| succinyl-CoA synthetase, alpha subunit, NAD(P)-binding [Candidatus
           Hamiltonella defensa 5AT (Acyrthosiphon pisum)]
 gi|229466707|gb|ACQ68481.1| succinyl-CoA synthetase, alpha subunit, NAD(P)-binding [Candidatus
           Hamiltonella defensa 5AT (Acyrthosiphon pisum)]
          Length = 290

 Score =  338 bits (867), Expect = 6e-91,   Method: Composition-based stats.
 Identities = 177/298 (59%), Positives = 220/298 (73%), Gaps = 8/298 (2%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSILVDKNTKV+ QG TG  GTFH+E AI Y  TQ+VGG+ P KG T   G    +PVF 
Sbjct: 1   MSILVDKNTKVICQGFTGSQGTFHSEHAIAY-GTQMVGGVTPGKGGTTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA  +T A ASVIYVP     D+I+E+I+A I LIVCITEGIP LDM+ VK +L++S
Sbjct: 56  TVKEAVLKTGATASVIYVPAPFCKDSILEAIDAGITLIVCITEGIPTLDMLIVKEKLKQS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPGI+TP +CKIGIMPG I R G VGI+SRSGTLTYEAV QT+  GLGQST 
Sbjct: 116 HVRMIGPNCPGIITPGACKIGIMPGHIHRPGKVGIVSRSGTLTYEAVKQTTDAGLGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L LF  D  TE+IVM+GEIGG+AEEE A ++K+      KK +V
Sbjct: 176 VGIGGDPISGSHFIDILTLFEQDPQTEAIVMIGEIGGNAEEETADYIKN---TSFKKLVV 232

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            ++AG TAP G+ MGHAGA+ISGG+G AE+K  A++ AG+    S   IG++++ +L 
Sbjct: 233 AYIAGVTAPKGKRMGHAGAIISGGRGTAEEKFLALEAAGVKTVHSLTDIGQTVINILS 290


>gi|27375564|ref|NP_767093.1| succinyl-CoA synthetase subunit alpha [Bradyrhizobium japonicum
           USDA 110]
 gi|27348701|dbj|BAC45718.1| succinyl-CoA synthetase alpha chain [Bradyrhizobium japonicum USDA
           110]
          Length = 294

 Score =  338 bits (867), Expect = 6e-91,   Method: Composition-based stats.
 Identities = 217/298 (72%), Positives = 249/298 (83%), Gaps = 5/298 (1%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL+DKNTKV+ QG TGK GTFH+E AI Y  T++VGG  P KG +   G    +PVF 
Sbjct: 1   MSILIDKNTKVICQGFTGKNGTFHSEAAIAY-GTKMVGGTSPGKGGSTHLG----LPVFD 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV +A+E+T A+ASVIYVPP GA DAI E+I+AEIPLIVCITEGIPV+DMVRVK  L  S
Sbjct: 56  TVRDAREKTGADASVIYVPPPGAADAICEAIDAEIPLIVCITEGIPVIDMVRVKRSLAGS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            SRLIGPNCPG++T   CKIGIMP +IF+ GSVGI+SRSGTLTYEAVFQTSQEGLGQ+TA
Sbjct: 116 KSRLIGPNCPGVMTAGECKIGIMPANIFKTGSVGIVSRSGTLTYEAVFQTSQEGLGQTTA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPVKGTEFIDVLE+ LAD  TESI+M+GEIGGSAEE+AAQFLKDEAKRGRKKP+V
Sbjct: 176 VGIGGDPVKGTEFIDVLEMLLADPKTESIIMIGEIGGSAEEDAAQFLKDEAKRGRKKPMV 235

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           GF+AG TAPPGR MGHAGA+ISGGKG A  K +AMK AGI ++PSPAR+G +L E L 
Sbjct: 236 GFIAGVTAPPGRRMGHAGAIISGGKGDAGSKTDAMKSAGITVSPSPARLGHTLAEKLK 293


>gi|110635725|ref|YP_675933.1| succinyl-CoA synthetase subunit alpha [Mesorhizobium sp. BNC1]
 gi|110286709|gb|ABG64768.1| succinyl-CoA synthetase (ADP-forming) alpha subunit [Chelativorans
           sp. BNC1]
          Length = 303

 Score =  338 bits (866), Expect = 7e-91,   Method: Composition-based stats.
 Identities = 227/302 (75%), Positives = 266/302 (88%), Gaps = 3/302 (0%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYW---TGGNVNVP 57
           MSILVDKNTKVLVQGLTGK GTFHTEQA+ Y  T++VGGIHPKKG   W         +P
Sbjct: 1   MSILVDKNTKVLVQGLTGKTGTFHTEQALAYYGTKMVGGIHPKKGGETWRSGLDSAAELP 60

Query: 58  VFTTVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARL 117
           +F +VAE KE+T A+ASVIYVPP+GA  AIIE+IEAEIPLIVCITEGIPV+DMV VKA+L
Sbjct: 61  IFASVAEGKEKTGADASVIYVPPAGAAAAIIEAIEAEIPLIVCITEGIPVMDMVHVKAKL 120

Query: 118 EKSSSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQ 177
           +KS SRLIGPNCPG+LTP+ CKIGIMPG+IF+KGSVG++SRSGTLTYEAVFQT+ EGLGQ
Sbjct: 121 DKSKSRLIGPNCPGVLTPEECKIGIMPGNIFKKGSVGVVSRSGTLTYEAVFQTTNEGLGQ 180

Query: 178 STAVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKK 237
           +TAVGIGGDPVKGTEFID+LE+FLAD+ T+SI+M+GEIGGSAEE+AAQFL DEA+RGRKK
Sbjct: 181 TTAVGIGGDPVKGTEFIDILEMFLADDETKSIIMIGEIGGSAEEDAAQFLMDEARRGRKK 240

Query: 238 PIVGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELL 297
           P+ GF+AG+TAP GRTMGHAGAVISGGKGGAEDKI AM+ AGI ++PSPAR+G++L E +
Sbjct: 241 PMAGFIAGRTAPKGRTMGHAGAVISGGKGGAEDKIEAMERAGIKVSPSPARLGQTLSEAI 300

Query: 298 GS 299
             
Sbjct: 301 KD 302


>gi|75674619|ref|YP_317040.1| succinyl-CoA ligase, alpha subunit [Nitrobacter winogradskyi
           Nb-255]
 gi|74419489|gb|ABA03688.1| succinyl-CoA synthetase (ADP-forming) alpha subunit [Nitrobacter
           winogradskyi Nb-255]
          Length = 294

 Score =  338 bits (866), Expect = 7e-91,   Method: Composition-based stats.
 Identities = 210/298 (70%), Positives = 247/298 (82%), Gaps = 5/298 (1%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           M IL+D+NT+V+ QG TGK GTFH+E AI Y  T++VGG  P KG        +++PVF 
Sbjct: 1   MPILIDRNTRVICQGFTGKNGTFHSEAAIAY-GTKMVGGTSPGKGGQTH----LDLPVFD 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA+E T A+ASVIYVPP+GA DAI E+I+AEIPLIVCITEGIPVLDMVRVK  L  S
Sbjct: 56  TVREAREATGADASVIYVPPAGAADAICEAIDAEIPLIVCITEGIPVLDMVRVKRSLTGS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            SRLIGPNCPG++T   CKIGIMP +IF+ G+VGI+SRSGTLTYEAVFQTSQEGLGQ+TA
Sbjct: 116 KSRLIGPNCPGVVTAGECKIGIMPANIFKPGNVGIVSRSGTLTYEAVFQTSQEGLGQTTA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPVKGTEFID+LE+FLAD  T +IVM+GEIGGSAEE+AAQFL DEA+RGR KP+V
Sbjct: 176 VGIGGDPVKGTEFIDMLEMFLADPNTSAIVMIGEIGGSAEEDAAQFLIDEARRGRNKPVV 235

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           GF+AG TAPPGR MGHAGA+ISGGKG A  K  AM+ AGI ++PSPAR+G++LVE L 
Sbjct: 236 GFIAGVTAPPGRRMGHAGAIISGGKGDAASKTAAMEAAGIAVSPSPARLGKTLVEKLK 293


>gi|154244113|ref|YP_001415071.1| succinyl-CoA synthetase, alpha subunit [Xanthobacter autotrophicus
           Py2]
 gi|154244448|ref|YP_001415406.1| succinyl-CoA synthetase, alpha subunit [Xanthobacter autotrophicus
           Py2]
 gi|154158198|gb|ABS65414.1| succinyl-CoA synthetase, alpha subunit [Xanthobacter autotrophicus
           Py2]
 gi|154158533|gb|ABS65749.1| succinyl-CoA synthetase, alpha subunit [Xanthobacter autotrophicus
           Py2]
          Length = 294

 Score =  338 bits (866), Expect = 8e-91,   Method: Composition-based stats.
 Identities = 217/298 (72%), Positives = 255/298 (85%), Gaps = 5/298 (1%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L+D NT+V+ QG TGK GTFH +QAI Y  T++VGG  P KG T      +N+PVF 
Sbjct: 1   MSVLIDANTRVITQGFTGKNGTFHAQQAIAY-GTKMVGGTSPGKGGTTH----LNLPVFD 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EAKE T A+ASVIYVPP GA DAI+E+I+AEIPLIVCITEGIPVLDMV+VK  L  S
Sbjct: 56  TVIEAKEATGADASVIYVPPPGAADAILEAIDAEIPLIVCITEGIPVLDMVKVKRALSGS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            SRL+GPNCPGI+T    KIGIMP +IF+ GSVG++SRSGTLTYEAVFQTSQEGLGQ++A
Sbjct: 116 KSRLVGPNCPGIVTAGQSKIGIMPANIFKTGSVGVVSRSGTLTYEAVFQTSQEGLGQTSA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPVKGTEFIDVLE+FLAD  TESI+M+GEIGGSAEEEAAQF+ DEAK+GRKKP+V
Sbjct: 176 VGIGGDPVKGTEFIDVLEMFLADPKTESIIMIGEIGGSAEEEAAQFIADEAKKGRKKPMV 235

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           GF+AG+TAPPGR MGHAGA+ISGGKGGAEDKI AM+ AGI ++PSPAR+G++LVE+L 
Sbjct: 236 GFIAGRTAPPGRRMGHAGAIISGGKGGAEDKIAAMEAAGIRVSPSPARLGKTLVEVLK 293


>gi|32476525|ref|NP_869519.1| succinyl-CoA synthetase alpha subunit [Rhodopirellula baltica SH 1]
 gi|32447071|emb|CAD76880.1| putative succinyl-CoA synthetase alpha subunit [Rhodopirellula
           baltica SH 1]
 gi|327539988|gb|EGF26585.1| succinyl-CoA synthetase alpha subunit [Rhodopirellula baltica WH47]
          Length = 290

 Score =  338 bits (866), Expect = 8e-91,   Method: Composition-based stats.
 Identities = 169/299 (56%), Positives = 225/299 (75%), Gaps = 9/299 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSILVDKNTKV+ QG+TG AG FH+     Y  TQ+VGG+ P KG     G    +PVF 
Sbjct: 1   MSILVDKNTKVICQGITGNAGKFHSLGCRDY-GTQMVGGVTPGKGGQDVEG----IPVFD 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA ++T A+A++I+VPP    DAI+E+++A I +I  ITEG+PV+DMVRV  +++ S
Sbjct: 56  TVEEAVQKTGADATMIFVPPPFTADAILEAVDAGIRVIAAITEGVPVIDMVRVYEKVKAS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            S LIGPNCPG++TP  CKIGIMPG I   G VG++SRSGTLTYEAV+QTS   LGQST 
Sbjct: 116 GSTLIGPNCPGLITPGECKIGIMPGYIHNPGKVGVMSRSGTLTYEAVWQTSSLKLGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VG+GGDP+ GT +ID+ +++  D+ TE+I+M+GEIGGSAEEEAA F+K+       KP+ 
Sbjct: 176 VGLGGDPIVGTNYIDLFKMYQEDDQTEAILMIGEIGGSAEEEAAAFVKEH----VTKPVA 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
            F+AG+TAPPG+ MGHAGA+ISGGKG AE+K+ A+++AGI +APSPA +G ++V+ +  
Sbjct: 232 AFIAGRTAPPGKRMGHAGAIISGGKGTAEEKVAALEDAGIVVAPSPAEMGEAVVKAMSK 290


>gi|145220333|ref|YP_001131042.1| succinyl-CoA synthetase (ADP-forming) alpha subunit
           [Prosthecochloris vibrioformis DSM 265]
 gi|145206497|gb|ABP37540.1| succinyl-CoA synthetase (ADP-forming) alpha subunit [Chlorobium
           phaeovibrioides DSM 265]
          Length = 300

 Score =  338 bits (866), Expect = 8e-91,   Method: Composition-based stats.
 Identities = 169/303 (55%), Positives = 226/303 (74%), Gaps = 10/303 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVN----- 55
           MS+LV+K+T++ VQG+TG  GTFHT Q + Y  T VV G+ P KG   + G + +     
Sbjct: 1   MSVLVNKDTRLCVQGITGGEGTFHTSQILEY-GTNVVAGVTPGKGGVLYNGNDRDSFCRP 59

Query: 56  VPVFTTVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKA 115
           VPVF TV EA E+  AN +VI+VP + A DAI+E+ +A + +I+CITEGIPV DM++  A
Sbjct: 60  VPVFNTVKEAVEKAEANTTVIFVPAAFAADAIMEAADAGLKVIICITEGIPVNDMMKAYA 119

Query: 116 RLEKSSSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGL 175
            ++   + L+GPNCPG++TP   KIGIMPG I +KGS+G++SRSGTLTYEAV Q +  GL
Sbjct: 120 FVKSKGAVLVGPNCPGVITPGEAKIGIMPGFIHKKGSIGVVSRSGTLTYEAVHQLTHVGL 179

Query: 176 GQSTAVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGR 235
           GQST +GIGGDPV GT F+D +++F  D+ TE +VM+GEIGGSAEEEAA+++K       
Sbjct: 180 GQSTCIGIGGDPVIGTRFLDAVKMFAKDDETEGLVMIGEIGGSAEEEAAEYIKKH----F 235

Query: 236 KKPIVGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVE 295
           KKP+VGF+AG+TAPPGR MGHAGA++SGGKG AE+KI AM+ AGI +  SPA IG ++++
Sbjct: 236 KKPVVGFIAGRTAPPGRRMGHAGAIVSGGKGTAEEKIKAMEAAGIHVVESPADIGEAMMK 295

Query: 296 LLG 298
            LG
Sbjct: 296 ALG 298


>gi|301167410|emb|CBW26992.1| succinyl-CoA synthetase alpha chain [Bacteriovorax marinus SJ]
          Length = 291

 Score =  337 bits (865), Expect = 9e-91,   Method: Composition-based stats.
 Identities = 165/299 (55%), Positives = 218/299 (72%), Gaps = 9/299 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           M+IL++++TK++  G TGK GTFH+ Q+  Y  T  VGG+ P KG T   G     PVF 
Sbjct: 1   MAILINRDTKLITVGFTGKQGTFHSLQSRDY-GTNFVGGVTPGKGGTVHEG----FPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA ++T ANA++I VPP  A D+I+E I+A +PL++ ITEGIP++DMV+VKA L+ S
Sbjct: 56  TVKEAVDKTEANAAMIMVPPPFAADSILECIDAGMPLVIAITEGIPIVDMVKVKAALKDS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
           ++RLIGPNCPG++TP  CKIGIMPG I   G VG++SRSGTLTYEAVFQ +Q  +GQST 
Sbjct: 116 NTRLIGPNCPGLITPGECKIGIMPGHIHMPGKVGVVSRSGTLTYEAVFQLTQRDIGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPV GT FIDVLELF  D  TE+++M+GEIGG+AE +A ++++        KP+V
Sbjct: 176 VGIGGDPVNGTNFIDVLELFEKDPDTEAVIMIGEIGGNAETDAGRWIQKNM----TKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
            F+AG +AP G+ MGHAGA+ISGG   AE K   ++E G+ IA SPA +G  + E+LG 
Sbjct: 232 SFIAGASAPAGKRMGHAGAIISGGDDTAEAKFRILEECGVTIARSPAELGHKMEEVLGK 290


>gi|294054272|ref|YP_003547930.1| succinyl-CoA synthetase, alpha subunit [Coraliomargarita
           akajimensis DSM 45221]
 gi|293613605|gb|ADE53760.1| succinyl-CoA synthetase, alpha subunit [Coraliomargarita
           akajimensis DSM 45221]
          Length = 294

 Score =  337 bits (865), Expect = 9e-91,   Method: Composition-based stats.
 Identities = 170/301 (56%), Positives = 221/301 (73%), Gaps = 11/301 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSILV+K+T+++VQG+TGK GTFHT+Q   Y  T VV G+ P KG   W      VPV  
Sbjct: 1   MSILVNKDTRLVVQGITGKTGTFHTKQCAEY-GTNVVAGVTPGKGGQLWEDK---VPVCN 56

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TVAEA +   ANASVIYVPP+ AGD+I+E+IEAEIPL++CITEG+PV DM  ++ RL   
Sbjct: 57  TVAEAVKEHGANASVIYVPPAFAGDSILEAIEAEIPLVICITEGVPVRDMAEIRRRLYFH 116

Query: 121 S--SRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQS 178
           +  +RLIGPNCPGI+TP  CKIGIMPG I + G VG++SRSGTLTYEAV+Q +Q G GQS
Sbjct: 117 NCKTRLIGPNCPGIITPGECKIGIMPGYIHKPGRVGVVSRSGTLTYEAVWQLTQRGHGQS 176

Query: 179 TAVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKP 238
           T +GIGGDP+ GT   D + +F  D  T++I+M+GEIGGSAEEEA  ++K+      KKP
Sbjct: 177 TCIGIGGDPINGTSQTDAIRMFNEDPDTDAIIMIGEIGGSAEEEACAYIKEH----VKKP 232

Query: 239 IVGFVAGKTAPPGRTMGHAGAVIS-GGKGGAEDKINAMKEAGICIAPSPARIGRSLVELL 297
           + GF+AG +AP GRTMGHAGA++S  G G AE K  AM++AG+ IA +P+ I  +L+++ 
Sbjct: 233 VAGFIAGASAPKGRTMGHAGAIVSASGAGTAEAKFAAMEDAGVSIARNPSEIADALLKIY 292

Query: 298 G 298
            
Sbjct: 293 K 293


>gi|219363381|ref|NP_001136494.1| hypothetical protein LOC100216609 [Zea mays]
 gi|194695918|gb|ACF82043.1| unknown [Zea mays]
          Length = 331

 Score =  337 bits (865), Expect = 1e-90,   Method: Composition-based stats.
 Identities = 182/298 (61%), Positives = 229/298 (76%), Gaps = 9/298 (3%)

Query: 2   SILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFTT 61
           ++ VDK+T+V+ QG+TGK GTFHTEQAI Y  T +VGG+ PKKG T   G    +PVF +
Sbjct: 36  AVFVDKSTRVICQGITGKNGTFHTEQAIEY-GTNMVGGVTPKKGGTEHLG----LPVFNS 90

Query: 62  VAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEK-S 120
           VAEAK  T ANASVIYVPP  A  AI+E++EAE+ L+VCITEGIP  DMV+VKA L + S
Sbjct: 91  VAEAKAETKANASVIYVPPPFAAAAIMEAMEAELDLVVCITEGIPQHDMVKVKAALNRQS 150

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            +RLIGPNCPGI+ P  CKIGIMPG I + G +GI+SRSGTLTYEAVFQT+  GLGQST 
Sbjct: 151 KTRLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTC 210

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP  GT F+D LE F+ D  TE IV++GEIGG+AEE+AA F+++      +KP+V
Sbjct: 211 VGIGGDPFNGTNFVDCLEKFVDDPQTEGIVLIGEIGGTAEEDAATFIQE---SKTQKPVV 267

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            F+AG TAPPGR MGHAGA+++GGKG A+DKI A++EAG+ +  SPA+IG ++ E+  
Sbjct: 268 AFIAGLTAPPGRRMGHAGAIVAGGKGTAQDKIKALREAGVTVVESPAKIGSTMFEIFK 325


>gi|15889892|ref|NP_355573.1| succinyl-CoA synthetase subunit alpha [Agrobacterium tumefaciens
           str. C58]
 gi|15157841|gb|AAK88358.1| succinyl-CoA synthetase alpha chain [Agrobacterium tumefaciens str.
           C58]
          Length = 300

 Score =  337 bits (865), Expect = 1e-90,   Method: Composition-based stats.
 Identities = 232/299 (77%), Positives = 271/299 (90%), Gaps = 1/299 (0%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTG-GNVNVPVF 59
           MSILV+K+TK+LVQGLTGK GTFHTEQA+ Y  TQ+VGGIHPKKG   WTG    ++P+F
Sbjct: 1   MSILVNKDTKILVQGLTGKTGTFHTEQALAYYGTQMVGGIHPKKGGETWTGSKGESLPIF 60

Query: 60  TTVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEK 119
            TVAEAKE+T A+ASVIYVPP+GA DAIIE+IEAEIP I CITEGIPV+DMVRVKARL++
Sbjct: 61  ATVAEAKEKTGADASVIYVPPAGAADAIIEAIEAEIPFITCITEGIPVMDMVRVKARLDR 120

Query: 120 SSSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQST 179
           S SRL+GPNCPGI+TP+ CKIGIMPGSIFRKGSVGI+SRSGTLTYEAVFQTS EGLGQ+T
Sbjct: 121 SKSRLLGPNCPGIMTPEECKIGIMPGSIFRKGSVGIVSRSGTLTYEAVFQTSNEGLGQTT 180

Query: 180 AVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPI 239
           AVGIGGDPVKGTEFID+LE+FLAD+AT+SI+M+GEIGGSAEE+AAQFL DEAK+GRKKP+
Sbjct: 181 AVGIGGDPVKGTEFIDILEMFLADDATQSIIMIGEIGGSAEEDAAQFLIDEAKKGRKKPM 240

Query: 240 VGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            GF+AG+TAP GRTMGHAGAV+SGGKG AE KI AM+ AGI ++PSPAR+G++LVE+L 
Sbjct: 241 AGFIAGRTAPKGRTMGHAGAVVSGGKGDAESKIAAMEAAGIKVSPSPARLGKTLVEVLK 299


>gi|189184255|ref|YP_001938040.1| succinyl-CoA synthetase alpha chain [Orientia tsutsugamushi str.
           Ikeda]
 gi|189181026|dbj|BAG40806.1| succinyl-CoA synthetase alpha chain [Orientia tsutsugamushi str.
           Ikeda]
          Length = 292

 Score =  337 bits (865), Expect = 1e-90,   Method: Composition-based stats.
 Identities = 187/300 (62%), Positives = 237/300 (79%), Gaps = 8/300 (2%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+LVD+NTKV+ QG+TG  GTFHTEQA+ Y  T++VGG+ P KG        +N+PV+ 
Sbjct: 1   MSVLVDRNTKVICQGITGAQGTFHTEQALKY-GTKMVGGVTPGKGGQTI----LNLPVYN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           +V EA ++T A ASVIYVPP+ A D+I E+I+A I L+VCITEGIPVLDM+++K  L+ S
Sbjct: 56  SVDEAVQKTGATASVIYVPPAFAADSIFEAIDAGIELLVCITEGIPVLDMLKIKQVLKGS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            +RLIGPNCPGI+TP+ CKIGIMPG I + GS+GI+SRSGTLTYEAV QT++ GLGQST 
Sbjct: 116 KTRLIGPNCPGIITPEQCKIGIMPGHIHKAGSIGIISRSGTLTYEAVAQTTEVGLGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           +GIGGDP+ GT F+D LELFLAD  T++I+++GEIGGSAEEEAA FLK       KKPIV
Sbjct: 176 IGIGGDPINGTSFVDCLELFLADGDTKAIIIIGEIGGSAEEEAADFLKS---SRIKKPIV 232

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGSL 300
           GF+AG TAPPG+ MGHAGA+I G KG A  K+ A+K AG+CIA SPA+IG+++  LL +L
Sbjct: 233 GFIAGVTAPPGKRMGHAGAIIDGEKGAASSKLEALKSAGVCIAESPAKIGQTMYNLLHNL 292


>gi|300024732|ref|YP_003757343.1| succinyl-CoA synthetase, subunit alpha [Hyphomicrobium
           denitrificans ATCC 51888]
 gi|299526553|gb|ADJ25022.1| succinyl-CoA synthetase, alpha subunit [Hyphomicrobium
           denitrificans ATCC 51888]
          Length = 299

 Score =  337 bits (865), Expect = 1e-90,   Method: Composition-based stats.
 Identities = 206/298 (69%), Positives = 250/298 (83%), Gaps = 2/298 (0%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYW-TGGNVNVPVF 59
           MSILVDK TKV+ QG+TG  GTFHT+QA  Y  T++VGG+ P KG +        +VP+F
Sbjct: 1   MSILVDKATKVICQGITGSQGTFHTKQARAY-GTKIVGGVTPGKGGSKHPDAELADVPLF 59

Query: 60  TTVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEK 119
            +VAEA  RT A AS IYVPP  A DAI+E+I+AE+PLIVCITEGIPV+DMVRVK  L+ 
Sbjct: 60  DSVAEAVARTGATASSIYVPPPFAADAILEAIDAEVPLIVCITEGIPVMDMVRVKRALDG 119

Query: 120 SSSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQST 179
           S SRL+GPNCPGILTPD CKIGIMPG+IF+ GSVGI+SRSGTLTYEAV QT+  GLGQ+T
Sbjct: 120 SKSRLVGPNCPGILTPDQCKIGIMPGNIFKHGSVGIVSRSGTLTYEAVKQTTDVGLGQTT 179

Query: 180 AVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPI 239
           AVGIGGDPVKGTEFIDVL+LFL+D+ T+SI+M+GEIGGSAEE+A++FL  EA++GRKKP+
Sbjct: 180 AVGIGGDPVKGTEFIDVLDLFLSDDETQSIIMIGEIGGSAEEDASEFLTREARKGRKKPM 239

Query: 240 VGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELL 297
            GF+AG TAPPGR MGHAGA+ISGGKG AEDK+ AM+ AGI I+PSPA +GR+L+++L
Sbjct: 240 AGFIAGVTAPPGRRMGHAGAIISGGKGKAEDKLAAMQAAGIAISPSPAALGRTLIDIL 297


>gi|330685666|gb|EGG97307.1| succinyl-CoA synthetase, alpha subunit [Staphylococcus epidermidis
           VCU121]
          Length = 301

 Score =  337 bits (864), Expect = 1e-90,   Method: Composition-based stats.
 Identities = 168/299 (56%), Positives = 221/299 (73%), Gaps = 9/299 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+ +DKNTKV+VQG+TG    FHT+Q + Y  TQ+V G+ P KG     G    VPVF 
Sbjct: 1   MSVFIDKNTKVMVQGITGSTALFHTKQMLDY-GTQIVAGVTPGKGGQVVEG----VPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EAK+ T AN SV+YVP   A D+I+E+ +AE+ +++CITE IPV+DMV+VK  L+  
Sbjct: 56  TVEEAKQETGANVSVVYVPAPFAADSILEAADAELDMVICITEHIPVVDMVKVKRYLQGR 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            +RL+GPNCPG++T D CKIGIMPG I +KG VG++SRSGTLTYEAV Q ++EG+GQ+TA
Sbjct: 116 KTRLVGPNCPGVITADECKIGIMPGYIHKKGHVGVVSRSGTLTYEAVHQLTEEGIGQTTA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPV GT FIDVL+ F  D  T+++VM+GEIGG+AEEEAA+++K        KP+V
Sbjct: 176 VGIGGDPVNGTNFIDVLKAFNEDPETKAVVMIGEIGGTAEEEAAEWIKANM----TKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
           GF+ G+TAPPG+ MGHAGA+ISGGKG A +KI  +   G+  A +P+ IG +L+E    
Sbjct: 232 GFIGGQTAPPGKRMGHAGAIISGGKGTASEKIKTLNSCGVETADTPSEIGTTLIEAAKK 290


>gi|253998618|ref|YP_003050681.1| succinyl-CoA synthetase subunit alpha [Methylovorus sp. SIP3-4]
 gi|313200692|ref|YP_004039350.1| succinyl-CoA synthetase subunit alpha [Methylovorus sp. MP688]
 gi|253985297|gb|ACT50154.1| succinyl-CoA synthetase, alpha subunit [Methylovorus sp. SIP3-4]
 gi|312440008|gb|ADQ84114.1| succinyl-CoA synthetase, alpha subunit [Methylovorus sp. MP688]
          Length = 295

 Score =  337 bits (864), Expect = 1e-90,   Method: Composition-based stats.
 Identities = 177/299 (59%), Positives = 230/299 (76%), Gaps = 9/299 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           M+ILVD++TKVL QG TGK GTFH+EQA+ Y  T++VGG+ P KG       ++++PVF 
Sbjct: 1   MAILVDQHTKVLCQGFTGKQGTFHSEQALAY-GTRMVGGVTPGKGGQ----QHLDLPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           T+ +A   T ANASVIYVPP  A D+I+E+ +A +PLIVCITEGIPVLDM+ VKA L+ +
Sbjct: 56  TMRDAVRETGANASVIYVPPPFAADSILEACDAGVPLIVCITEGIPVLDMLNVKAALKAN 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            +RLIGPNCPG++TPD+CKIGIMPGSI  +G VGI+SRSGTLTYEAV QT+  GLGQST 
Sbjct: 116 GARLIGPNCPGVITPDACKIGIMPGSIHLRGKVGIVSRSGTLTYEAVHQTTALGLGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP++G  FID L LF  D  TE+I+MVGEIGG+ EE AA+++K        KP+ 
Sbjct: 176 VGIGGDPIRGMNFIDCLALFEQDPETEAIIMVGEIGGADEEAAAEYIKQH----VTKPVA 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
           G++AG+TAP G+ MGHAGA+ISGG G AEDKI A+++AG+ +A SPA +G ++   + +
Sbjct: 232 GYIAGQTAPKGKRMGHAGAIISGGSGKAEDKIRALEQAGVIVASSPAGLGEAVQAAIKA 290


>gi|332977242|gb|EGK14037.1| succinyl-CoA synthetase subunit alpha [Psychrobacter sp.
           1501(2011)]
          Length = 291

 Score =  337 bits (864), Expect = 1e-90,   Method: Composition-based stats.
 Identities = 169/299 (56%), Positives = 220/299 (73%), Gaps = 10/299 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L+DK+TKVLVQG TGK GTFH+EQAI Y  T+VVGG+ P KG     G    +PVF 
Sbjct: 1   MSVLIDKDTKVLVQGFTGKNGTFHSEQAIEY-GTKVVGGVTPGKGGQTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEK- 119
           T+AEA E T A+ASVIYVP     D+IIE+++A + LIV ITEG+P LDM++ K  +E+ 
Sbjct: 56  TMAEAMEATNADASVIYVPAPFVLDSIIEAVDAGVKLIVVITEGVPTLDMLKAKRYIEEA 115

Query: 120 SSSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQST 179
              +++GPNCPG++TP  CKIGIMPG I   G VGI+SRSGTLTYEAV QT++ G GQST
Sbjct: 116 GDVKMVGPNCPGVITPGQCKIGIMPGHIHLPGKVGIISRSGTLTYEAVAQTTKLGFGQST 175

Query: 180 AVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPI 239
            +GIGGDP+ G   ID L++F  D  TE+IV++GEIGG+AEEEAA ++K+       KP+
Sbjct: 176 CIGIGGDPIPGMNQIDCLKMFQEDPQTEAIVLIGEIGGTAEEEAAAYIKEH----VTKPV 231

Query: 240 VGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           +G++AG TAP G+ MGHAGA+ISGGKG AE+K  A +EAGI     P++IG ++ E+ G
Sbjct: 232 IGYIAGVTAPKGKRMGHAGAIISGGKGTAEEKFKAFEEAGIAYTRDPSKIGETVKEVTG 290


>gi|325186353|emb|CCA20859.1| unnamed protein product [Albugo laibachii Nc14]
          Length = 325

 Score =  337 bits (864), Expect = 1e-90,   Method: Composition-based stats.
 Identities = 176/304 (57%), Positives = 220/304 (72%), Gaps = 12/304 (3%)

Query: 1   MS----ILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNV 56
           MS    + ++++T+V+ QG TGK GTFH+EQAI Y  T++VGG+ PKKG +   G    +
Sbjct: 22  MSSSAKVWINEDTRVICQGFTGKQGTFHSEQAIAY-GTKMVGGVTPKKGGSTHLG----L 76

Query: 57  PVFTTVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRV-KA 115
           PVF +V+EAK  T A+ASVIYVPP     AII++IEAEIPL+V ITEGIP  DMV+V   
Sbjct: 77  PVFNSVSEAKRATNADASVIYVPPPFCAQAIIDAIEAEIPLVVAITEGIPQQDMVKVKWH 136

Query: 116 RLEKSSSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGL 175
             ++  +RLIGPNCPGI+ P  CK+GIMPG I  KG +GI+SRSGTLTYEAV QT+  GL
Sbjct: 137 LRQQKVTRLIGPNCPGIIKPGECKMGIMPGYIHLKGKIGIVSRSGTLTYEAVAQTTSTGL 196

Query: 176 GQSTAVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGR 235
           GQST +GIGGDP  GT FID LE F  D  TE I+M+GEIGGSAEEEAA +L+      R
Sbjct: 197 GQSTVIGIGGDPFNGTNFIDCLERFTNDPETEGIIMIGEIGGSAEEEAADWLQQY--GDR 254

Query: 236 KKPIVGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVE 295
            KP+V F+AG TAPPGR MGHAGA++SGGKG AE K  A++ AG+ +  SPAR+G  + E
Sbjct: 255 NKPVVSFIAGTTAPPGRRMGHAGAIVSGGKGTAEGKFKALEAAGVAVTRSPARLGELMAE 314

Query: 296 LLGS 299
           L+  
Sbjct: 315 LMKD 318


>gi|146328935|ref|YP_001210179.1| succinyl-CoA synthetase, alpha subunit [Dichelobacter nodosus
           VCS1703A]
 gi|146232405|gb|ABQ13383.1| succinyl-CoA synthetase, alpha subunit [Dichelobacter nodosus
           VCS1703A]
          Length = 290

 Score =  337 bits (864), Expect = 1e-90,   Method: Composition-based stats.
 Identities = 180/299 (60%), Positives = 220/299 (73%), Gaps = 9/299 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSI VDKNT+V+ QG TG  GTFH+EQAI Y  TQ++GG+ P KG        ++ PVF 
Sbjct: 1   MSIYVDKNTRVITQGFTGSQGTFHSEQAIAY-GTQLLGGVTPNKGGETH----LDRPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
              EA   T ANAS+I+VPP  A DAI+E+I+A I  I CITEGIPVLDM++VKA L+ +
Sbjct: 56  NCYEAVCATKANASMIFVPPPFAADAILEAIDAGIETIACITEGIPVLDMLKVKAALKGT 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
           + RLIGPNCPGI+TPD CK+GIMP  I +KGS+GI+SRSGTLTYEAV QT+Q G GQST 
Sbjct: 116 NVRLIGPNCPGIITPDECKMGIMPAHIHQKGSIGIVSRSGTLTYEAVHQTTQSGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ GT FIDVL  F  DE T +IVM+GEIGGSAEEEAA+F+K       KKP+V
Sbjct: 176 VGIGGDPICGTRFIDVLSAFEQDEQTRAIVMIGEIGGSAEEEAAEFIKS----CIKKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
            ++AG+TAP G+ MGHAGA+I G  G A  KI A++ AG+    SPA IG +L +LL S
Sbjct: 232 AYIAGRTAPLGKRMGHAGAIIKGNMGSAAAKIKALQNAGVVTVSSPAEIGAALKQLLHS 290


>gi|260831053|ref|XP_002610474.1| hypothetical protein BRAFLDRAFT_124275 [Branchiostoma floridae]
 gi|229295840|gb|EEN66484.1| hypothetical protein BRAFLDRAFT_124275 [Branchiostoma floridae]
          Length = 323

 Score =  337 bits (864), Expect = 1e-90,   Method: Composition-based stats.
 Identities = 178/299 (59%), Positives = 227/299 (75%), Gaps = 6/299 (2%)

Query: 3   ILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFTTV 62
           I + K+TKV+ QG TGK GTFH++Q+I Y  +Q+VGG+ P KG     G    +PVF +V
Sbjct: 28  IAIGKDTKVICQGFTGKQGTFHSQQSIEY-GSQMVGGVSPGKGGKTHLG----LPVFNSV 82

Query: 63  AEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKSS- 121
           AEAKE T A ASVIYVPP  AG AI+E+I AE+ L+VCITEGIP  DMV+VK RL +   
Sbjct: 83  AEAKEATGAVASVIYVPPPFAGKAILEAINAEMSLVVCITEGIPQQDMVKVKHRLVRQDK 142

Query: 122 SRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTAV 181
           +RLIGPNCPGI+ P  CKIGIMPG I + G++GI+SRSGTLTYEAV QT++ GLGQ+  +
Sbjct: 143 TRLIGPNCPGIIKPGECKIGIMPGHIHQPGNIGIVSRSGTLTYEAVHQTTRAGLGQTLCI 202

Query: 182 GIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIVG 241
           GIGGDP  GT F+D LE+FL D AT+ IVM+GEIGGS EE AA++LK+      KKP+V 
Sbjct: 203 GIGGDPFNGTNFVDCLEVFLGDPATKGIVMIGEIGGSMEESAAEYLKEHNTGPNKKPVVS 262

Query: 242 FVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGSL 300
           F+AG TAPPGR MGHAGA+ISGGKG A+DKI A++EAG+ +  SPA++G ++++ +  L
Sbjct: 263 FIAGVTAPPGRRMGHAGAIISGGKGAAQDKIQALQEAGVEVTMSPAQMGTTMLQEMQKL 321


>gi|149177236|ref|ZP_01855842.1| putative succinyl-CoA synthetase alpha subunit [Planctomyces maris
           DSM 8797]
 gi|148843950|gb|EDL58307.1| putative succinyl-CoA synthetase alpha subunit [Planctomyces maris
           DSM 8797]
          Length = 292

 Score =  337 bits (864), Expect = 1e-90,   Method: Composition-based stats.
 Identities = 168/299 (56%), Positives = 220/299 (73%), Gaps = 9/299 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSILV + T+V+ QG+TGK+G FH++Q   Y  T +VGG+ P KG T   G     PVF 
Sbjct: 1   MSILVTEKTRVICQGITGKSGLFHSQQCREY-GTPLVGGVTPGKGGTEVDG----FPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E+T AN S+++VPP   G+AI+E+ +A + LI+ ITEG+PV DMVRV   L+  
Sbjct: 56  TVEEAVEKTGANTSLVFVPPPFCGEAIMEAADAGMELIIAITEGVPVFDMVRVMEYLKGK 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            SRLIGPNCPG++TP   KIGIMPG I   GSVG++S+SGTLTYEA +Q    GLGQSTA
Sbjct: 116 KSRLIGPNCPGVITPGIAKIGIMPGYIHTPGSVGLISKSGTLTYEAAWQLGNIGLGQSTA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ GT FID+LELF  D ATESI+++GEIGG+AE EAA+++K+       KP+ 
Sbjct: 176 VGIGGDPIIGTTFIDLLELFENDPATESIMLIGEIGGTAEIEAAEYIKEH----VTKPVA 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
           GF+AGKTAPPG+ MGHAGA+ISGG G A++KI A++ AG+ +A SPA +G ++   + +
Sbjct: 232 GFIAGKTAPPGKRMGHAGAIISGGSGTADEKIAALEAAGVVVAESPADMGTAMKRAIEA 290


>gi|325294006|ref|YP_004279870.1| succinyl-CoA synthetase subunit alpha [Agrobacterium sp. H13-3]
 gi|325061859|gb|ADY65550.1| succinyl-CoA synthetase subunit alpha [Agrobacterium sp. H13-3]
          Length = 300

 Score =  337 bits (864), Expect = 1e-90,   Method: Composition-based stats.
 Identities = 234/299 (78%), Positives = 272/299 (90%), Gaps = 1/299 (0%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTG-GNVNVPVF 59
           MSILV+K+TK+LVQGLTGK GTFHTEQA+ Y  TQ+VGGIHPKKG   WTG    ++P+F
Sbjct: 1   MSILVNKDTKILVQGLTGKTGTFHTEQALAYYGTQMVGGIHPKKGGETWTGSKGESLPIF 60

Query: 60  TTVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEK 119
            TVAEAKE+T A+ASVIYVPP+GA DAIIE+IEAEIP I CITEGIPV+DMVRVKARL++
Sbjct: 61  ATVAEAKEKTGADASVIYVPPAGAADAIIEAIEAEIPFITCITEGIPVMDMVRVKARLDR 120

Query: 120 SSSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQST 179
           S+SRL+GPNCPGI+TP+ CKIGIMPGSIFRKGSVGI+SRSGTLTYEAVFQTS EGLGQ+T
Sbjct: 121 SNSRLLGPNCPGIMTPEECKIGIMPGSIFRKGSVGIVSRSGTLTYEAVFQTSNEGLGQTT 180

Query: 180 AVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPI 239
           AVGIGGDPVKGTEFIDVLE+FLADEAT+SI+M+GEIGGSAEE+AAQFL DEAK+GRKKP+
Sbjct: 181 AVGIGGDPVKGTEFIDVLEMFLADEATQSIIMIGEIGGSAEEDAAQFLIDEAKKGRKKPM 240

Query: 240 VGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            GF+AG+TAP GRTMGHAGAV+SGGKG AE KI AM+ AGI ++PSPAR+G++LVE+L 
Sbjct: 241 AGFIAGRTAPKGRTMGHAGAVVSGGKGDAESKIAAMEAAGIKVSPSPARLGKTLVEVLK 299


>gi|254294600|ref|YP_003060623.1| succinyl-CoA synthetase subunit alpha [Hirschia baltica ATCC 49814]
 gi|254043131|gb|ACT59926.1| succinyl-CoA synthetase, alpha subunit [Hirschia baltica ATCC
           49814]
          Length = 300

 Score =  337 bits (864), Expect = 1e-90,   Method: Composition-based stats.
 Identities = 228/299 (76%), Positives = 270/299 (90%), Gaps = 1/299 (0%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWT-GGNVNVPVF 59
           MSIL+DKNTK+L QG+TGK G+FHT QA+ Y  TQ+VGGIHPKKG T WT      +P+F
Sbjct: 1   MSILIDKNTKILTQGMTGKTGSFHTNQALDYFGTQMVGGIHPKKGGTNWTSDKGQELPIF 60

Query: 60  TTVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEK 119
            +VAE KE+T A+ASVIYVPP+G G AIIE+IEAEIPLIVCITEG+PVLDMV VKA+L+K
Sbjct: 61  ASVAEGKEKTGADASVIYVPPAGCGAAIIEAIEAEIPLIVCITEGVPVLDMVDVKAKLDK 120

Query: 120 SSSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQST 179
           S SRLIGPNCPG++TP+ CKIGIMPGSIF+KGSVG++SRSGTLTYEAV+QTS EGLGQ++
Sbjct: 121 SKSRLIGPNCPGLMTPEQCKIGIMPGSIFKKGSVGVVSRSGTLTYEAVYQTSVEGLGQTS 180

Query: 180 AVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPI 239
           AVGIGGDPVKGTEFIDVLE+FLAD+ TESI+M+GEIGGSAEEEAAQFLKDEAK+GRKKP+
Sbjct: 181 AVGIGGDPVKGTEFIDVLEMFLADDETESIIMIGEIGGSAEEEAAQFLKDEAKKGRKKPM 240

Query: 240 VGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           VGF+AG+TAPPGRTMGHAGA++SGGKGGAEDKI AM+EAGI ++PSPAR+G ++ E+L 
Sbjct: 241 VGFIAGRTAPPGRTMGHAGAIVSGGKGGAEDKIAAMEEAGITVSPSPARLGVTMTEVLK 299


>gi|170769497|ref|ZP_02903950.1| succinate-CoA ligase, alpha subunit [Escherichia albertii TW07627]
 gi|170121554|gb|EDS90485.1| succinate-CoA ligase, alpha subunit [Escherichia albertii TW07627]
          Length = 290

 Score =  337 bits (864), Expect = 1e-90,   Method: Composition-based stats.
 Identities = 166/299 (55%), Positives = 218/299 (72%), Gaps = 10/299 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+T+VLVQG+TGK GTFHTEQAI Y  TQ+VGG+ P KG       +++ PVF 
Sbjct: 1   MSVLINKHTRVLVQGITGKNGTFHTEQAIAY-GTQIVGGVTPGKGGQ----RHLDRPVFD 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           ++ EA  +T A+ASVIYVP     D+++E++E+ + LIV ITEG+P LDMV+V+  L+  
Sbjct: 56  SMKEAMRQTEADASVIYVPAPFVLDSVVEAVESGVKLIVVITEGVPTLDMVKVRRLLDCH 115

Query: 121 S-SRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQST 179
              RLIGPNCPGI+TP  CKIGIMPG I R G +GI+SRSGTLTYEAV QT+  GLGQST
Sbjct: 116 PDVRLIGPNCPGIITPGECKIGIMPGEIHRPGRIGIVSRSGTLTYEAVAQTTALGLGQST 175

Query: 180 AVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPI 239
            +GIGGDPV GT FID L LF  D  T++++M+GEIGG+AEE AA+F+         KP+
Sbjct: 176 CIGIGGDPVPGTNFIDALRLFENDPQTDAVIMIGEIGGNAEERAAEFI----HHEMTKPV 231

Query: 240 VGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           VG++AG TAP G+ MGHAGA+ISGG G AE+K  A  +AG+    +PA +G +L  ++ 
Sbjct: 232 VGYIAGVTAPKGKRMGHAGAIISGGSGSAEEKFRAFDKAGMAWTRNPALLGDTLWNVIK 290


>gi|188580839|ref|YP_001924284.1| succinyl-CoA synthetase, alpha subunit [Methylobacterium populi
           BJ001]
 gi|179344337|gb|ACB79749.1| succinyl-CoA synthetase, alpha subunit [Methylobacterium populi
           BJ001]
          Length = 294

 Score =  337 bits (864), Expect = 1e-90,   Method: Composition-based stats.
 Identities = 223/298 (74%), Positives = 256/298 (85%), Gaps = 5/298 (1%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL+D+NTKV+ QG TGK GTFH+EQAI Y  T++VGG  P KG +   G    +PVF 
Sbjct: 1   MSILIDQNTKVICQGFTGKNGTFHSEQAIAY-GTKMVGGTSPGKGGSQHLG----LPVFD 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TVAEA+E T A+ASV+YVPP GA DAI E+I+AEIPLIVCITEGIPVLDMVRVK  LE S
Sbjct: 56  TVAEAREATGADASVVYVPPPGAADAICEAIQAEIPLIVCITEGIPVLDMVRVKRALEGS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            SRLIGPNCPG++T    KIGIMP +IF+ GSVGI+SRSGTLTYEAVFQT+ EGLGQ+TA
Sbjct: 116 KSRLIGPNCPGVVTAGESKIGIMPANIFKPGSVGIVSRSGTLTYEAVFQTTVEGLGQTTA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPVKGTEFI +LELFLADE T+SIVM+GEIGGSAEEEAAQFL DEAKRGRKKP+V
Sbjct: 176 VGIGGDPVKGTEFISMLELFLADEKTQSIVMIGEIGGSAEEEAAQFLADEAKRGRKKPMV 235

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           GF+AG+TAPPGR MGHAGA+ISGGKGGAEDKI AM+ AGI ++PSPAR+GR+LVE+L 
Sbjct: 236 GFIAGRTAPPGRRMGHAGAIISGGKGGAEDKIAAMEAAGIRVSPSPARLGRTLVEVLK 293


>gi|218551371|ref|YP_002385163.1| succinyl-CoA synthetase subunit alpha [Escherichia fergusonii ATCC
           35469]
 gi|218358913|emb|CAQ91574.1| Succinyl-CoA synthetase alpha chain (SCS-alpha) [Escherichia
           fergusonii ATCC 35469]
          Length = 290

 Score =  337 bits (864), Expect = 1e-90,   Method: Composition-based stats.
 Identities = 168/299 (56%), Positives = 218/299 (72%), Gaps = 10/299 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+T+VLVQG+TGK GTFHTEQAI Y  TQ+VGG+ P KG        ++ PVF 
Sbjct: 1   MSVLINKHTRVLVQGITGKNGTFHTEQAIAY-GTQIVGGVTPGKGGQLH----LDRPVFD 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           ++ EA  +T A+ASVIYVP     D+++E+IE+ + LIV ITEG+P LDMV+V+  L+  
Sbjct: 56  SMKEAMRQTEADASVIYVPAPFVLDSVVEAIESGVKLIVVITEGVPTLDMVKVRRLLDCH 115

Query: 121 S-SRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQST 179
              RLIGPNCPGI+TP  CKIGIMPG I R G +GI+SRSGTLTYEAV QT+  GLGQST
Sbjct: 116 PDVRLIGPNCPGIITPGECKIGIMPGEIHRPGRIGIVSRSGTLTYEAVAQTTALGLGQST 175

Query: 180 AVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPI 239
            +GIGGDPV GT FID L LF  D  T++++M+GEIGG+AEE AA+F++ E      K +
Sbjct: 176 CIGIGGDPVPGTNFIDALRLFENDPQTDAVIMIGEIGGNAEERAAEFIRHEM----NKTV 231

Query: 240 VGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           VG++AG TAP G+ MGHAGA+ISGG G AEDK  A  +AG+    +PA +G +L  ++ 
Sbjct: 232 VGYIAGVTAPKGKRMGHAGAIISGGSGSAEDKFRAFDKAGMAWTRNPALLGETLWNVIK 290


>gi|254475089|ref|ZP_05088475.1| succinyl-CoA ligase, alpha subunit [Ruegeria sp. R11]
 gi|214029332|gb|EEB70167.1| succinyl-CoA ligase, alpha subunit [Ruegeria sp. R11]
          Length = 294

 Score =  337 bits (864), Expect = 1e-90,   Method: Composition-based stats.
 Identities = 198/299 (66%), Positives = 247/299 (82%), Gaps = 5/299 (1%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           M++L+D+NTKV+ QG TG  GTFH+EQAI Y  T++VGG+ P KG        +N+PVF 
Sbjct: 1   MAVLIDENTKVICQGFTGSQGTFHSEQAIAY-GTKMVGGVTPGKGGQTH----LNLPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           +V EAK  T ANASVIYVPP  A D+I+E+I+AE+ LIVCITEGIPVLDM++VK  LE S
Sbjct: 56  SVHEAKHVTEANASVIYVPPPFAADSILEAIDAEMELIVCITEGIPVLDMMKVKRALEDS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            SRLIGPNCPG++TPD+CKIGIMPG I ++GSVG++SRSGTLTYEAV QT+  GLGQSTA
Sbjct: 116 KSRLIGPNCPGVITPDACKIGIMPGHIHKRGSVGVVSRSGTLTYEAVKQTADIGLGQSTA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+KGTE IDVL++FL D  TESI+M+GEIGGSAEEEAA+FL ++ K+GR KP+ 
Sbjct: 176 VGIGGDPIKGTEHIDVLDMFLDDPETESIIMIGEIGGSAEEEAAEFLAEQKKKGRWKPVA 235

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
           GF+AG+TAPPGR MGHAGA+++GGKGGAEDKI AMK AGI +A SPA +G ++++ +G 
Sbjct: 236 GFIAGRTAPPGRRMGHAGAIVAGGKGGAEDKIEAMKSAGIVVADSPATLGEAVLKAIGK 294


>gi|319406381|emb|CBI80022.1| succinyl-CoA synthetase, alpha chain [Bartonella sp. AR 15-3]
          Length = 300

 Score =  337 bits (863), Expect = 2e-90,   Method: Composition-based stats.
 Identities = 235/299 (78%), Positives = 269/299 (89%), Gaps = 1/299 (0%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTG-GNVNVPVF 59
           MSIL++K+TKVLVQGLTGK GTFHTEQA+ Y  TQ+VGGI+PKKG   W G     +P+F
Sbjct: 1   MSILINKDTKVLVQGLTGKTGTFHTEQALAYHGTQMVGGINPKKGGETWKGLKGETLPIF 60

Query: 60  TTVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEK 119
            +V E KE+T A+ASVIYVPP GA DAIIE+IEAEI LIVCITEGIPV+DMV+VKA+LE+
Sbjct: 61  ASVMEGKEKTGADASVIYVPPGGAADAIIEAIEAEIGLIVCITEGIPVMDMVKVKAKLEQ 120

Query: 120 SSSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQST 179
           S SRLIGPNCPGILTPD CKIGIMPGSIFRKGSVG++SRSGTLTYEAVFQTS EGLGQ+T
Sbjct: 121 SKSRLIGPNCPGILTPDECKIGIMPGSIFRKGSVGVVSRSGTLTYEAVFQTSHEGLGQTT 180

Query: 180 AVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPI 239
           A+GIGGDPVKGTEFIDVLE+FLADE T+SIVM+GEIGGSAEEEAAQFLKDEAK+GRKKPI
Sbjct: 181 AIGIGGDPVKGTEFIDVLEMFLADEETQSIVMIGEIGGSAEEEAAQFLKDEAKKGRKKPI 240

Query: 240 VGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           VGF+AG+TAPPGRTMGHAGAVISGGKGGAEDKI AM+ A I ++PSP++IG++LV +L 
Sbjct: 241 VGFIAGRTAPPGRTMGHAGAVISGGKGGAEDKIAAMEAAEIRVSPSPSQIGKTLVAVLK 299


>gi|294500950|ref|YP_003564650.1| succinate-CoA ligase subunit alpha [Bacillus megaterium QM B1551]
 gi|295706296|ref|YP_003599371.1| succinate-CoA ligase subunit alpha [Bacillus megaterium DSM 319]
 gi|294350887|gb|ADE71216.1| succinate-CoA ligase, alpha subunit [Bacillus megaterium QM B1551]
 gi|294803955|gb|ADF41021.1| succinate-CoA ligase, alpha subunit [Bacillus megaterium DSM 319]
          Length = 300

 Score =  337 bits (863), Expect = 2e-90,   Method: Composition-based stats.
 Identities = 175/299 (58%), Positives = 233/299 (77%), Gaps = 9/299 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+ ++++TKV+VQG+TG  G FHT+Q + Y  T++VGG+ P KG     G    VPVF 
Sbjct: 1   MSVFINQDTKVIVQGITGGVGLFHTQQMLEY-GTKIVGGVTPGKGGLEVEG----VPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TVAEAKE+T A ASV+YVPP+ A D+IIE+++A++ L++CITEGIPVLDMV+VK  +E  
Sbjct: 56  TVAEAKEKTGATASVVYVPPAFAADSIIEAVDADLDLVICITEGIPVLDMVKVKRYMEGK 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            +RL+GPNCPG++TP+ CKIGIMPG I +KG VG++SRSGTLTYEAV Q S+ G+GQSTA
Sbjct: 116 RTRLVGPNCPGVITPEECKIGIMPGYIHKKGHVGVVSRSGTLTYEAVHQLSEAGIGQSTA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPV GT FIDVL+ F  DE T +++M+GEIGG+AEEEAA+++K        KP+V
Sbjct: 176 VGIGGDPVNGTNFIDVLKAFNEDEDTYAVIMIGEIGGTAEEEAAEWVKANM----TKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
           GF+ G+TAPPG+ MGHAGA+ISGGKG A +KI  M E GI +A +P+ +G +L+++L  
Sbjct: 232 GFIGGQTAPPGKRMGHAGAIISGGKGTASEKIKTMNECGIQVAETPSVMGETLIKVLKE 290


>gi|115522326|ref|YP_779237.1| succinyl-CoA synthetase, alpha subunit [Rhodopseudomonas palustris
           BisA53]
 gi|115516273|gb|ABJ04257.1| succinyl-CoA synthetase (ADP-forming) alpha subunit
           [Rhodopseudomonas palustris BisA53]
          Length = 294

 Score =  337 bits (863), Expect = 2e-90,   Method: Composition-based stats.
 Identities = 216/298 (72%), Positives = 249/298 (83%), Gaps = 5/298 (1%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L+D NTKV+ QG TGK GTFH+E A+ Y  T++VGG  P KG +   G    +PVF 
Sbjct: 1   MSVLIDSNTKVICQGFTGKNGTFHSEAAVAY-GTKMVGGTSPGKGGSTHLG----LPVFD 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA+E+T A ASVIYVPP GA DAI E+I+AEIPLIVCITEGIPVLDMVRVK  L  S
Sbjct: 56  TVKEAREQTGAEASVIYVPPPGAADAICEAIDAEIPLIVCITEGIPVLDMVRVKRSLSGS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            SRLIGPNCPG++T   CKIGIMP +IF+ GSVGI+SRSGTLTYEAVFQT+QEGLGQ+TA
Sbjct: 116 KSRLIGPNCPGVVTAGQCKIGIMPANIFKPGSVGIVSRSGTLTYEAVFQTTQEGLGQTTA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPVKGTEFIDVLE+FLADE T SIVM+GEIGGSAEEEAAQFL DEAKRGRKKP+V
Sbjct: 176 VGIGGDPVKGTEFIDVLEMFLADEKTHSIVMIGEIGGSAEEEAAQFLIDEAKRGRKKPMV 235

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           GF+AG+TAPPGR MGHAGA++SGGKG A  KI AM+ AGI ++PSPAR+G++L E L 
Sbjct: 236 GFIAGRTAPPGRRMGHAGAIVSGGKGDAGSKIAAMEAAGIIVSPSPARLGKTLAERLK 293


>gi|261868410|ref|YP_003256332.1| hypothetical protein D11S_1750 [Aggregatibacter
           actinomycetemcomitans D11S-1]
 gi|261413742|gb|ACX83113.1| hypothetical protein D11S_1750 [Aggregatibacter
           actinomycetemcomitans D11S-1]
          Length = 290

 Score =  337 bits (863), Expect = 2e-90,   Method: Composition-based stats.
 Identities = 173/299 (57%), Positives = 217/299 (72%), Gaps = 9/299 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL+D NTKV+ QG TG  GTFH++QA+ Y  T++VGG+ P KG T   G    +PVF 
Sbjct: 1   MSILIDNNTKVICQGFTGGQGTFHSQQALAY-GTKLVGGVSPGKGGTTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV +A E T A A+VIYVP  G  DAI+E+I+A I LIVCITEGIP LDM+ VK RL ++
Sbjct: 56  TVRDAVEATGATATVIYVPAPGCKDAILEAIDAGIQLIVCITEGIPTLDMLVVKQRLNQT 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             R+IGPNCPG++TP+ CKIGIMPG I +KG +GI+SRSGTLTYEAV QT+ EG GQST 
Sbjct: 116 GVRMIGPNCPGVITPEECKIGIMPGDIHKKGKIGIVSRSGTLTYEAVKQTTDEGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+  + F+D+L+LF  D  TE+IVM+GEIGGSAEEEAA F+K        KP+V
Sbjct: 176 VGIGGDPIPCSNFVDILKLFQEDPQTEAIVMIGEIGGSAEEEAAAFIKQH----VTKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
            ++AG TAP  + MGHAGA+ISGGKG A+ K  A++ AG+    S   IG  L ++L  
Sbjct: 232 SYIAGVTAPKDKRMGHAGAIISGGKGTADAKFVALEAAGVKTVRSLVGIGAVLRDVLKK 290


>gi|258545092|ref|ZP_05705326.1| succinyl-CoA synthetase subunit alpha [Cardiobacterium hominis ATCC
           15826]
 gi|258519669|gb|EEV88528.1| succinyl-CoA synthetase subunit alpha [Cardiobacterium hominis ATCC
           15826]
          Length = 290

 Score =  337 bits (863), Expect = 2e-90,   Method: Composition-based stats.
 Identities = 175/299 (58%), Positives = 221/299 (73%), Gaps = 9/299 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSI ++KNTKV+ QG TG  GTFH+EQAI Y  TQ+VGG+ P KG        ++ PVF 
Sbjct: 1   MSIYINKNTKVICQGFTGSQGTFHSEQAIAY-GTQLVGGVTPGKGGQSH----LDRPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
              EA   T ANAS+I+VPP+ A D+I+E+++A I +I CITEGIPVLDM++VK  L  +
Sbjct: 56  NCHEAVAATGANASMIFVPPAFAADSILEAVDAGIEVIACITEGIPVLDMLKVKTALSGT 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
           + RLIGPNCPG++TP  CK+GIMPG I + G VGI+SRSGTLTYEAV QT+  GLGQST 
Sbjct: 116 NVRLIGPNCPGVITPGECKMGIMPGHIHQPGVVGIVSRSGTLTYEAVHQTTGIGLGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ GT F+DVL  F AD  T+ IVMVGEIGGSAEEEAA+++K        KP+V
Sbjct: 176 VGIGGDPINGTSFVDVLAAFQADPQTKGIVMVGEIGGSAEEEAAEYIKAH----VNKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
            ++AG TAPPG+ MGHAGA+I+GGKG A DK  A++ AG+    SPA IG +L +L+G+
Sbjct: 232 AYIAGVTAPPGKRMGHAGAIIAGGKGTAADKFRALEAAGVATVRSPADIGATLKQLMGA 290


>gi|304438122|ref|ZP_07398065.1| succinyl-CoA synthetase subunit alpha [Selenomonas sp. oral taxon
           149 str. 67H29BP]
 gi|304368895|gb|EFM22577.1| succinyl-CoA synthetase subunit alpha [Selenomonas sp. oral taxon
           149 str. 67H29BP]
          Length = 301

 Score =  336 bits (862), Expect = 2e-90,   Method: Composition-based stats.
 Identities = 161/299 (53%), Positives = 222/299 (74%), Gaps = 8/299 (2%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+++DK+TKV+VQG+TGKA  FHT+Q + Y  T++V G+ P K      G    VPVF 
Sbjct: 1   MSVMIDKDTKVIVQGITGKAAMFHTQQMLAY-GTKIVAGVTPGKAGQEVHG----VPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TVA+A + T A ASVIYVP   A D+I+E+++AE+ L+VCITE IPVLDMV+V+  ++  
Sbjct: 56  TVADAVKATGATASVIYVPARFAADSILEAVDAELDLVVCITEHIPVLDMVKVRRYMQGK 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            +RL+GPNCPG+LT    K+GI PG++ + G VG++SRSGTLTYEA FQ +  G+GQ+T 
Sbjct: 116 KTRLVGPNCPGLLTSQQSKLGITPGTVSKPGHVGLISRSGTLTYEAAFQLTNAGIGQTTT 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPVKGT+FID L+LF  D  T +++++GEIGG+AEE+AA+++K+       KP+ 
Sbjct: 176 VGIGGDPVKGTDFIDALQLFKDDPDTYAVLIIGEIGGTAEEDAAKWIKENM---PNKPVS 232

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
            F+AG+ APPG+ MGHAGA+ISGGKG A DK+ A+  AGI +A + A IG ++V+LL  
Sbjct: 233 AFIAGRQAPPGKRMGHAGAIISGGKGTAADKVAALNAAGIPVADTVAHIGETMVKLLKE 291


>gi|319892263|ref|YP_004149138.1| Succinyl-CoA ligase [ADP-forming] alpha chain [Staphylococcus
           pseudintermedius HKU10-03]
 gi|317161959|gb|ADV05502.1| Succinyl-CoA ligase [ADP-forming] alpha chain [Staphylococcus
           pseudintermedius HKU10-03]
 gi|323464640|gb|ADX76793.1| succinate-CoA ligase alpha subunit [Staphylococcus pseudintermedius
           ED99]
          Length = 301

 Score =  336 bits (862), Expect = 2e-90,   Method: Composition-based stats.
 Identities = 174/296 (58%), Positives = 220/296 (74%), Gaps = 9/296 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+ VDKN+KV+VQG+TG    FHT+Q + Y  TQ+V G+ P KG     G    VPVF 
Sbjct: 1   MSVFVDKNSKVIVQGITGSTALFHTKQMLEY-GTQIVAGVTPGKGGQVVEG----VPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EAK+ T  N SVIYVP   A DAI+E I+AE+ L +CITE IPV+DM++VK  LE  
Sbjct: 56  TVEEAKKETGGNVSVIYVPAPFAADAILECIDAELDLAICITEHIPVIDMIKVKRYLEGK 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            +RLIGPNCPG++T D  KIGIMPG I +KG VG++SRSGTLTYEAV Q ++EG+GQSTA
Sbjct: 116 KTRLIGPNCPGVITSDETKIGIMPGYIHKKGHVGVVSRSGTLTYEAVHQLTEEGIGQSTA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPV GT FIDVLE F  D+ T+++VM+GEIGG+AEEEAA+++K        KP+V
Sbjct: 176 VGIGGDPVNGTNFIDVLEAFNNDDDTKAVVMIGEIGGTAEEEAAEWIKANM----TKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVEL 296
           GF+ G+TAPPG+ MGHAGA+ISGGKG A +KI  + E G+  A +P+ IG +L+E 
Sbjct: 232 GFIGGQTAPPGKRMGHAGAIISGGKGTAAEKIKTLNECGVKTAATPSEIGSTLIEA 287


>gi|83313058|ref|YP_423322.1| succinyl-CoA synthetase subunit alpha [Magnetospirillum magneticum
           AMB-1]
 gi|82947899|dbj|BAE52763.1| Succinyl-CoA synthetase [Magnetospirillum magneticum AMB-1]
          Length = 291

 Score =  336 bits (862), Expect = 2e-90,   Method: Composition-based stats.
 Identities = 183/298 (61%), Positives = 228/298 (76%), Gaps = 8/298 (2%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           M++LV+ NTKV+ QG TG  GTFH+EQAI Y  T++VGG+ P KG T      +++PVF 
Sbjct: 1   MAVLVNSNTKVICQGFTGAQGTFHSEQAIAY-GTKMVGGVTPGKGGTTH----LDLPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TVAEAK +T  NASVIYVPP  A DAI+E+I+AEI L VCITEGIPV DM+ VK  L+ S
Sbjct: 56  TVAEAKAKTGCNASVIYVPPPFAADAILEAIDAEIELAVCITEGIPVADMLAVKRALQGS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            +RLIGPNCPG++TP  CKIGIMPG I  +G +GI+SRSGTLTYEAV QT+  GLGQ+T 
Sbjct: 116 KTRLIGPNCPGVITPGECKIGIMPGHIHMRGKIGIVSRSGTLTYEAVAQTTATGLGQTTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           +GIGGDP+ GT F+D LELFLAD  T++I+M+GEIGG AE + A+ LK   +   KKP V
Sbjct: 176 IGIGGDPINGTNFVDSLELFLADPETQAIIMIGEIGGDAEVQGAELLK---RSKIKKPTV 232

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           GF+AG+TAPPGR MGHAGAVISGG   A+ K+ A+K AGI +A SPA +G ++V+LL 
Sbjct: 233 GFIAGRTAPPGRRMGHAGAVISGGNDTADFKVEALKSAGIAVADSPASLGSTMVKLLK 290


>gi|77164233|ref|YP_342758.1| succinyl-CoA ligase, alpha subunit [Nitrosococcus oceani ATCC
           19707]
 gi|76882547|gb|ABA57228.1| succinyl-CoA synthetase (ADP-forming) alpha subunit [Nitrosococcus
           oceani ATCC 19707]
          Length = 291

 Score =  336 bits (862), Expect = 2e-90,   Method: Composition-based stats.
 Identities = 178/299 (59%), Positives = 223/299 (74%), Gaps = 9/299 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSILVDK T+V+ QG TGK GTFH+ QA+ Y  TQ+VGG+ P KG     G     PVF 
Sbjct: 1   MSILVDKQTRVICQGFTGKQGTFHSRQALEY-GTQLVGGVTPGKGGQTHLGQ----PVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TVAEA E T ANA++IYVP + A DAI+E+ +  +PLIVCITEGIPVLDM+RVKA L   
Sbjct: 56  TVAEAVEATGANATMIYVPAAFAADAILEAADGGVPLIVCITEGIPVLDMLRVKAALAGL 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            S L+GPNCPGI+TP +CKIGIMPG I + G +GI+SRSGTLTYEAV+QTS++GLGQST 
Sbjct: 116 PSYLVGPNCPGIITPGACKIGIMPGDIHQAGRIGIVSRSGTLTYEAVYQTSRKGLGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP++G  F+D L LF  D  TE +++VGEIGGSAEEEAA++++        KP+V
Sbjct: 176 VGIGGDPIQGMSFVDCLTLFEQDPQTEGVILVGEIGGSAEEEAAEYIQHH----VSKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
            ++AG TAP G+ MGHAGA+ISGGKG AE K+ A+  AG+ IA SPA +G  + + +G 
Sbjct: 232 AYIAGLTAPKGKRMGHAGAIISGGKGTAEGKLKALSAAGVSIAHSPAEMGECMEQAMGD 290


>gi|118486457|gb|ABK95068.1| unknown [Populus trichocarpa]
          Length = 331

 Score =  336 bits (862), Expect = 2e-90,   Method: Composition-based stats.
 Identities = 183/298 (61%), Positives = 231/298 (77%), Gaps = 9/298 (3%)

Query: 3   ILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFTTV 62
           + VDKNT+V+ QG+TGK GTFHTEQAI Y  T++VGG+ PKKG T   G    +PVF +V
Sbjct: 37  VFVDKNTRVICQGITGKNGTFHTEQAIEY-GTKMVGGVTPKKGGTEHLG----LPVFNSV 91

Query: 63  AEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEK-SS 121
           +EAK  T ANASVIYVPP  A  AI+E++EAE+ L+VCITEGIP  DMVRVKA ++K + 
Sbjct: 92  SEAKAETKANASVIYVPPPFAAAAILEAVEAELDLVVCITEGIPQHDMVRVKAAIKKQTK 151

Query: 122 SRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTAV 181
           +RLIGPNCPGI+ P  CKIGIMPG I + G VGI+SRSGTLTYEAVFQT+  GLGQST V
Sbjct: 152 TRLIGPNCPGIIKPGECKIGIMPGYIHKPGRVGIVSRSGTLTYEAVFQTTAVGLGQSTCV 211

Query: 182 GIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIVG 241
           GIGGDP  GT F+D +E FLAD  TE IV++GEIGG+AEE+AA  +K+    G +KP+V 
Sbjct: 212 GIGGDPFNGTNFVDCVEKFLADPQTEGIVLIGEIGGTAEEDAATLIKE---SGTEKPVVA 268

Query: 242 FVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
           F+AG TAPPGR MGHAGA++SGGKG A+DKI  +++AG+ +  SPA+IG +++++   
Sbjct: 269 FIAGVTAPPGRRMGHAGAIVSGGKGTAQDKIKTLRDAGVIVVESPAKIGTAMLDVFKE 326


>gi|260886824|ref|ZP_05898087.1| succinyl-CoA synthetase subunit alpha [Selenomonas sputigena ATCC
           35185]
 gi|330839370|ref|YP_004413950.1| succinyl-CoA synthetase, alpha subunit [Selenomonas sputigena ATCC
           35185]
 gi|260863423|gb|EEX77923.1| succinyl-CoA synthetase subunit alpha [Selenomonas sputigena ATCC
           35185]
 gi|329747134|gb|AEC00491.1| succinyl-CoA synthetase, alpha subunit [Selenomonas sputigena ATCC
           35185]
          Length = 301

 Score =  336 bits (862), Expect = 2e-90,   Method: Composition-based stats.
 Identities = 161/299 (53%), Positives = 223/299 (74%), Gaps = 8/299 (2%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L+DK+TKV+VQG+TGKA TFHT+Q + Y   ++V G+ P K      G    VPVF 
Sbjct: 1   MSVLIDKDTKVIVQGITGKAATFHTKQMLDY-GAKIVAGVTPGKAGQKVEG----VPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TVA+A + T A ASV+YVPP  A D+I+E+++A++ L+VCITE IPVLDMV+V+  +E  
Sbjct: 56  TVADAVKATGATASVVYVPPRFAADSIMEAVDADLDLVVCITEHIPVLDMVKVRRYMEGK 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            +RL+GPNCPG+LT    K+GI P ++ + G VG++SRSGTLTYEA FQ +  G+GQ+T 
Sbjct: 116 KTRLVGPNCPGLLTSKQSKLGITPATVSKPGHVGVISRSGTLTYEAAFQLTNAGIGQTTT 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPVKGT+FID L+LF  D  T +++++GEIGG+AEE+AA+++++  K    KP+ 
Sbjct: 176 VGIGGDPVKGTDFIDALQLFKDDPDTYAVLIIGEIGGTAEEDAAKWIQENMK---DKPVS 232

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
            F+AG+ APPG+ MGHAGA+ISGGKG A DK+ A+  AGI +A + A IG ++V+LL  
Sbjct: 233 AFIAGRQAPPGKRMGHAGAIISGGKGTAADKVAALNAAGIPVADTVAHIGETMVKLLKE 291


>gi|322420764|ref|YP_004199987.1| succinyl-CoA synthetase subunit alpha [Geobacter sp. M18]
 gi|320127151|gb|ADW14711.1| succinyl-CoA synthetase, alpha subunit [Geobacter sp. M18]
          Length = 290

 Score =  336 bits (862), Expect = 2e-90,   Method: Composition-based stats.
 Identities = 167/298 (56%), Positives = 218/298 (73%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSI+++K+T+V+ QG+TG  G FH + A  Y  T++VGG+ P KG T   G     PVF 
Sbjct: 1   MSIMINKDTRVITQGITGATGLFHAQGAREY-GTRMVGGVTPGKGGTVVEG----FPVFD 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TVA+A + T A ASVIYVPP  A D+I+E+++A I L+ CITEGIPVLDMV+VK  L   
Sbjct: 56  TVADAVQATGATASVIYVPPPFAADSIMEAVDAGIELVCCITEGIPVLDMVKVKQYLIGR 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            +RLIGPNCPG++TP  CKIGIMPG I + G VG++SRSGTLTYEAV+Q +  GLGQST 
Sbjct: 116 KTRLIGPNCPGVITPGQCKIGIMPGYIHKPGKVGVVSRSGTLTYEAVWQLTSIGLGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPV GT  ID L LF  D  TE+++M+GEIGGSAEEEAA+F+K        KP+ 
Sbjct: 176 VGIGGDPVNGTSHIDCLRLFEQDPDTEAVIMIGEIGGSAEEEAARFVKAHM----TKPVA 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            ++AG TAPPG+ MGHAGA+ISGGKG A +K+  ++E GI +A +PA + ++L+++  
Sbjct: 232 AYIAGVTAPPGKRMGHAGAIISGGKGTATEKVAVLRECGISVAATPAEMAQALLKVYK 289


>gi|238926407|ref|ZP_04658167.1| succinate--CoA ligase (ADP-forming) [Selenomonas flueggei ATCC
           43531]
 gi|238885811|gb|EEQ49449.1| succinate--CoA ligase (ADP-forming) [Selenomonas flueggei ATCC
           43531]
          Length = 301

 Score =  336 bits (862), Expect = 2e-90,   Method: Composition-based stats.
 Identities = 162/299 (54%), Positives = 223/299 (74%), Gaps = 8/299 (2%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+++DK+TKV+VQG+TGKA  FHT+Q + Y  T++VGG+ P K      G    VPVF 
Sbjct: 1   MSVMIDKDTKVIVQGITGKAAMFHTQQMLDY-GTKIVGGVTPGKAGQDVHG----VPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TVA+A + T A ASVIYVP   A D+I+E+++AE+ L+VCITE IPVLDMV+V+  ++  
Sbjct: 56  TVADAVKATGATASVIYVPARFAADSILEAVDAELDLVVCITEHIPVLDMVKVRRYMQGK 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            +RL+GPNCPG+LT    K+GI PG++ + G VG++SRSGTLTYEA FQ +  G+GQ+T 
Sbjct: 116 KTRLVGPNCPGLLTAQQSKLGITPGTVSKPGHVGLISRSGTLTYEAAFQLTNAGIGQTTT 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPVKGT+FID L+LF  D  T +++++GEIGG+AEE+AA+++K+       KP+ 
Sbjct: 176 VGIGGDPVKGTDFIDALQLFKDDPDTYAVLIIGEIGGTAEEDAAKWIKENM---PNKPVS 232

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
            F+AG+ APPG+ MGHAGA+ISGGKG A DK+ A+  AGI +A + A IG ++V+LL  
Sbjct: 233 AFIAGRQAPPGKRMGHAGAIISGGKGTAADKVAALNAAGIPVADTVAHIGETMVKLLKE 291


>gi|253573509|ref|ZP_04850852.1| succinyl-CoA synthetase [Paenibacillus sp. oral taxon 786 str. D14]
 gi|251847037|gb|EES75042.1| succinyl-CoA synthetase [Paenibacillus sp. oral taxon 786 str. D14]
          Length = 309

 Score =  336 bits (862), Expect = 2e-90,   Method: Composition-based stats.
 Identities = 177/304 (58%), Positives = 228/304 (75%), Gaps = 10/304 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWT-----GGNVN 55
           MSILVDKNTKV+ QG+TGK   FH + A+ Y  TQ+VGG  P KG T        G  V+
Sbjct: 1   MSILVDKNTKVITQGITGKTALFHAKGALDY-GTQMVGGTSPGKGGTKVDITLESGETVS 59

Query: 56  VPVFTTVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKA 115
           +PVF TV EAKE T A ASVIYVPP+ A D+I+E++EAE+ L++CITEGIPVLDMV+VK 
Sbjct: 60  LPVFNTVREAKEATGATASVIYVPPAFAADSILEAVEAELDLVICITEGIPVLDMVKVKR 119

Query: 116 RLEKSSSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGL 175
            +E   + LIGPNCPG++TP  CKIGIMPG I   G VG++SRSGTLTYEAV Q +  G+
Sbjct: 120 YMEGKKTVLIGPNCPGVITPGECKIGIMPGYIHLPGHVGVVSRSGTLTYEAVHQLTTRGI 179

Query: 176 GQSTAVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGR 235
           GQS+AVGIGGDPVKG+EFID+L  F  D+ T +++M+GEIGG+AEEEAA++++       
Sbjct: 180 GQSSAVGIGGDPVKGSEFIDILRRFNDDDNTHAVIMIGEIGGTAEEEAAEWIQKNM---- 235

Query: 236 KKPIVGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVE 295
            KP+VGF+ G TAPPG+ MGHAGA+ISGGKG A++KI  ++  GI +AP+P+ +G +LV 
Sbjct: 236 TKPVVGFIGGVTAPPGKRMGHAGAIISGGKGTAKEKIAKLESCGIKVAPTPSEMGATLVS 295

Query: 296 LLGS 299
           +L  
Sbjct: 296 VLEE 299


>gi|229918616|ref|YP_002887262.1| succinyl-CoA synthetase subunit alpha [Exiguobacterium sp. AT1b]
 gi|229470045|gb|ACQ71817.1| succinyl-CoA synthetase, alpha subunit [Exiguobacterium sp. AT1b]
          Length = 305

 Score =  336 bits (861), Expect = 3e-90,   Method: Composition-based stats.
 Identities = 174/298 (58%), Positives = 223/298 (74%), Gaps = 8/298 (2%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSI  DK+TKV++QG+TGK G FH EQ + Y  T++VGG+ P KG T       NVPVF 
Sbjct: 1   MSIWADKDTKVIIQGITGKQGLFHGEQMLAY-NTKLVGGVTPGKGGTTVLD---NVPVFN 56

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV+EA E T ANAS+IYVPP+ A D+I+E+ ++ I LI+CITEGIPV+DM++VK  LE  
Sbjct: 57  TVSEAVEATGANASIIYVPPAFAADSIMEAADSGIELIICITEGIPVVDMIQVKRYLEDK 116

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            +RLIGPNCPGI+TP   K+GIMPG I  KG VGI+SRSGTLTYEAV Q +  G+GQSTA
Sbjct: 117 PARLIGPNCPGIITPGEAKLGIMPGYIHTKGHVGIVSRSGTLTYEAVHQLTTAGIGQSTA 176

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPV GT FID L+ F  DE T++++M+GEIGG+AEEEAA+++K        KP++
Sbjct: 177 VGIGGDPVNGTNFIDTLKAFNEDEDTKAVIMIGEIGGTAEEEAAEWVKANM----TKPVI 232

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           GF+ G+TAP G+ MGHAGA+ISGGKG A +KI  +   GI +A +PA IG +L+ +L 
Sbjct: 233 GFIGGQTAPEGKRMGHAGAIISGGKGTAAEKIKTLNANGIEVAETPAVIGETLIRVLK 290


>gi|49474815|ref|YP_032857.1| succinyl-CoA synthetase subunit alpha [Bartonella quintana str.
           Toulouse]
 gi|49240319|emb|CAF26801.1| Succinyl-CoA synthetase alpha chain [Bartonella quintana str.
           Toulouse]
          Length = 300

 Score =  336 bits (861), Expect = 3e-90,   Method: Composition-based stats.
 Identities = 240/298 (80%), Positives = 272/298 (91%), Gaps = 1/298 (0%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTG-GNVNVPVF 59
           MSIL+ +NTKVLVQGLTGK GTFHTEQA+ Y  T++VGGIHPKKG   W G    ++P+F
Sbjct: 1   MSILIHQNTKVLVQGLTGKTGTFHTEQALAYYGTKMVGGIHPKKGGEVWEGSRGESLPIF 60

Query: 60  TTVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEK 119
            +VAE KERT A+ASVIYVPPSGA DAIIE+IEAEI LIVCITEGIPV+DMVRVK +LE+
Sbjct: 61  ASVAEGKERTGADASVIYVPPSGAADAIIEAIEAEIGLIVCITEGIPVMDMVRVKVKLEQ 120

Query: 120 SSSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQST 179
           S SRLIGPNCPGILTP +CKIGIMPGSIFRKGSVG++SRSGTLTYEAVFQTSQEGLGQ+T
Sbjct: 121 SKSRLIGPNCPGILTPHACKIGIMPGSIFRKGSVGVVSRSGTLTYEAVFQTSQEGLGQTT 180

Query: 180 AVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPI 239
           A+GIGGDPVKGTEFIDVLELFLAD+ TESIVM+GEIGGSAEEEAAQFLKDEAK+GRKKPI
Sbjct: 181 AIGIGGDPVKGTEFIDVLELFLADDETESIVMIGEIGGSAEEEAAQFLKDEAKKGRKKPI 240

Query: 240 VGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELL 297
           VGF+AG+TAPPGRTMGHAGAVISGGKGGAEDKI AM+ AGI ++PSP++IG++L+ LL
Sbjct: 241 VGFIAGRTAPPGRTMGHAGAVISGGKGGAEDKIAAMESAGIHVSPSPSQIGKTLMVLL 298


>gi|23014367|ref|ZP_00054187.1| COG0074: Succinyl-CoA synthetase, alpha subunit [Magnetospirillum
           magnetotacticum MS-1]
          Length = 291

 Score =  336 bits (861), Expect = 3e-90,   Method: Composition-based stats.
 Identities = 184/298 (61%), Positives = 228/298 (76%), Gaps = 8/298 (2%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           M++LV+ NTKV+ QG TG  GTFH+EQAI Y  T++VGG+ P KG T      +++PVF 
Sbjct: 1   MAVLVNANTKVICQGFTGAQGTFHSEQAIAY-GTKMVGGVTPGKGGTTH----LDLPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TVAEAK +T  NASVIYVPP  A DAI+E+I+AEI L VCITEGIPV DM+ VK  L+ S
Sbjct: 56  TVAEAKAKTGCNASVIYVPPPFAADAILEAIDAEIELAVCITEGIPVADMLAVKRALQGS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            +RLIGPNCPG++TP  CKIGIMPG I  +G VGI+SRSGTLTYEAV QT+  GLGQ+T 
Sbjct: 116 KTRLIGPNCPGVITPGECKIGIMPGHIHLRGKVGIVSRSGTLTYEAVAQTTATGLGQTTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           +GIGGDP+ GT F+D LELFLAD  T++I+M+GEIGG AE + A+ LK   +   KKP V
Sbjct: 176 IGIGGDPINGTNFVDSLELFLADPETQAIIMIGEIGGDAEVQGAELLK---RSKIKKPTV 232

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           GF+AG+TAPPGR MGHAGAVISGG   A+ K+ A+K AGI +A SPA +G ++V+LL 
Sbjct: 233 GFIAGRTAPPGRRMGHAGAVISGGNDTADFKVEALKSAGIAVADSPASLGSTMVKLLK 290


>gi|170747354|ref|YP_001753614.1| succinyl-CoA synthetase, alpha subunit [Methylobacterium
           radiotolerans JCM 2831]
 gi|170653876|gb|ACB22931.1| succinyl-CoA synthetase, alpha subunit [Methylobacterium
           radiotolerans JCM 2831]
          Length = 294

 Score =  336 bits (861), Expect = 3e-90,   Method: Composition-based stats.
 Identities = 222/298 (74%), Positives = 251/298 (84%), Gaps = 5/298 (1%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+++D NTKV+ QG TGK GTFH+EQAI Y  T++VGG  P KG +   G    +PVF 
Sbjct: 1   MSVMIDANTKVICQGFTGKNGTFHSEQAIAY-GTKMVGGTSPGKGGSSHLG----LPVFD 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TVAEA+E T A ASV+YVPP GA DAI E+I AE+PLIVCITEGIPVLDMVRVK  L  S
Sbjct: 56  TVAEAREATGAEASVVYVPPPGAADAICEAIAAEVPLIVCITEGIPVLDMVRVKRALTGS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            SRL+GPNCPGI+T    KIGIMP +IFR GSVGI+SRSGTLTYEAVFQTS  GLGQ+TA
Sbjct: 116 KSRLVGPNCPGIVTAGESKIGIMPANIFRPGSVGIVSRSGTLTYEAVFQTSNAGLGQTTA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPVKGTEFIDVLELFLAD  TESIVM+GEIGGSAEEEAAQFLKDEAKRGRKKP+V
Sbjct: 176 VGIGGDPVKGTEFIDVLELFLADPKTESIVMIGEIGGSAEEEAAQFLKDEAKRGRKKPMV 235

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           GF+AG+TAPPGR MGHAGA+ISGGKGGAEDKI AM+ AGI ++PSPAR+G +LVE+L 
Sbjct: 236 GFIAGRTAPPGRRMGHAGAIISGGKGGAEDKIAAMEAAGIRVSPSPARLGSTLVEVLK 293


>gi|75294330|sp|Q6ZL94|SUCA_ORYSJ RecName: Full=Probable succinyl-CoA ligase [ADP-forming] subunit
           alpha, mitochondrial; AltName: Full=Succinyl-CoA
           synthetase subunit alpha; Short=SCS-alpha; Flags:
           Precursor
 gi|34393512|dbj|BAC83073.1| putative succinyl-CoA ligase alpha subunit [Oryza sativa Japonica
           Group]
 gi|125600835|gb|EAZ40411.1| hypothetical protein OsJ_24862 [Oryza sativa Japonica Group]
 gi|215769291|dbj|BAH01520.1| unnamed protein product [Oryza sativa Japonica Group]
          Length = 331

 Score =  335 bits (860), Expect = 3e-90,   Method: Composition-based stats.
 Identities = 185/298 (62%), Positives = 229/298 (76%), Gaps = 9/298 (3%)

Query: 2   SILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFTT 61
           ++ VDK+T+V+ QG+TGK GTFHTEQAI Y  T +VGG+ PKKG T   G    +PVF +
Sbjct: 36  AVFVDKSTRVICQGITGKNGTFHTEQAIEY-GTTMVGGVTPKKGGTEHLG----LPVFNS 90

Query: 62  VAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEK-S 120
           VAEAK  T ANASVIYVPP  A  AI+E++EAE+ L+VCITEGIP  DMV+VKA L K S
Sbjct: 91  VAEAKAETKANASVIYVPPPFAAAAIMEAMEAELDLVVCITEGIPQHDMVKVKAALNKQS 150

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            +RLIGPNCPGI+ P  CKIGIMPG I + G VGI+SRSGTLTYEAVFQT+  GLGQST 
Sbjct: 151 KTRLIGPNCPGIIKPGECKIGIMPGYIHKPGRVGIVSRSGTLTYEAVFQTTAVGLGQSTC 210

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP  GT F+D LE F+ D  TE IV++GEIGG+AEE+AA F+++      +KP+V
Sbjct: 211 VGIGGDPFNGTNFVDCLEKFVDDPQTEGIVLIGEIGGTAEEDAAAFIQE---SKTQKPVV 267

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            F+AG TAPPGR MGHAGA++SGGKG A+DKI A++EAG+ +  SPA+IG ++ E+  
Sbjct: 268 AFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKALREAGVTVVESPAKIGSTMFEIFK 325


>gi|320354456|ref|YP_004195795.1| succinyl-CoA synthetase (ADP-forming) subunit alpha [Desulfobulbus
           propionicus DSM 2032]
 gi|320122958|gb|ADW18504.1| succinyl-CoA synthetase (ADP-forming) alpha subunit [Desulfobulbus
           propionicus DSM 2032]
          Length = 291

 Score =  335 bits (860), Expect = 3e-90,   Method: Composition-based stats.
 Identities = 164/299 (54%), Positives = 214/299 (71%), Gaps = 10/299 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+ V+KNT+++VQG+TG+ G FHT   I Y  T VV G+ P KG         +VP+F 
Sbjct: 1   MSVFVNKNTRLVVQGITGQEGQFHTRSCIAY-GTNVVAGVTPGKGGQKMD----DVPIFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           +V EA+E+T  NAS+I VPP  A DAI+E+ +A I L+VCITEG+PVLDM+RVK  L   
Sbjct: 56  SVKEAREKTGCNASMILVPPPFAADAIMEAADAGIELVVCITEGVPVLDMMRVKNYLATK 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRK-GSVGILSRSGTLTYEAVFQTSQEGLGQST 179
           ++RLIGPNCPGI+TP  CKIGIMPG + +  G  G++SRSGTLTYEAV Q +Q G GQ+T
Sbjct: 116 TTRLIGPNCPGIITPGECKIGIMPGPMHKPGGPWGVVSRSGTLTYEAVHQLTQAGFGQTT 175

Query: 180 AVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPI 239
            +GIGGDP+ GT F+D LE F AD  T++IVM+GEIGG+AEE A +++K       KKP+
Sbjct: 176 CIGIGGDPINGTNFLDCLEAFAADPDTKAIVMIGEIGGNAEENACEWIKAN----TKKPV 231

Query: 240 VGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           VGF+AG TAPPGR MGHAGA++SGGKG AE KI AMK +G+    +  ++G    ++  
Sbjct: 232 VGFIAGLTAPPGRRMGHAGAIVSGGKGTAEAKIEAMKASGVHHCANLGKLGELCKQVYK 290


>gi|148652082|ref|YP_001279175.1| succinyl-CoA synthetase subunit alpha [Psychrobacter sp. PRwf-1]
 gi|148571166|gb|ABQ93225.1| succinyl-CoA synthetase (ADP-forming) alpha subunit [Psychrobacter
           sp. PRwf-1]
          Length = 291

 Score =  335 bits (860), Expect = 3e-90,   Method: Composition-based stats.
 Identities = 167/299 (55%), Positives = 220/299 (73%), Gaps = 10/299 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L+DK+TKVLVQG TGK GTFH+EQAI Y  T+VVGG+ P KG     G    +PVF 
Sbjct: 1   MSVLIDKDTKVLVQGFTGKNGTFHSEQAIEY-GTKVVGGVTPGKGGQTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEK- 119
           T+AEA E T A+ASVIYVP     D+IIE+++A + LIV ITEG+P LDM++ K  +E+ 
Sbjct: 56  TMAEAMEATQADASVIYVPAPFVLDSIIEAVDAGVKLIVVITEGVPTLDMLKAKRYIEEA 115

Query: 120 SSSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQST 179
              +++GPNCPG++TP  CKIGIMPG I   G VGI+SRSGTLTYEAV QT++ G GQST
Sbjct: 116 GDVKMVGPNCPGVITPGQCKIGIMPGHIHLPGKVGIISRSGTLTYEAVAQTTKLGFGQST 175

Query: 180 AVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPI 239
            +GIGGDP+ G   ID L++F  D  TE+IV++GEIGG+AEEEAA ++K+       KP+
Sbjct: 176 CIGIGGDPIPGMNQIDCLKMFQEDPQTEAIVLIGEIGGTAEEEAAAYIKEH----VTKPV 231

Query: 240 VGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           +G++AG TAP G+ MGHAGA+ISGGKG AE+K  A ++AGI     P++IG ++ ++ G
Sbjct: 232 IGYIAGVTAPKGKRMGHAGAIISGGKGTAEEKFKAFEDAGIAYTRDPSKIGETVKQVTG 290


>gi|91975019|ref|YP_567678.1| succinyl-CoA synthetase, alpha subunit [Rhodopseudomonas palustris
           BisB5]
 gi|91681475|gb|ABE37777.1| succinyl-CoA synthetase (ADP-forming) alpha subunit
           [Rhodopseudomonas palustris BisB5]
          Length = 294

 Score =  335 bits (860), Expect = 4e-90,   Method: Composition-based stats.
 Identities = 215/298 (72%), Positives = 251/298 (84%), Gaps = 5/298 (1%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL+D NTKV+ QG TGK GTFH+E A+ Y  T++VGG  P KG T   G    +PVF 
Sbjct: 1   MSILIDANTKVICQGFTGKNGTFHSEAAVAY-GTKMVGGTSPGKGGTTHLG----LPVFD 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA+++T A+ASVIYVPP GA DAI E+I+AEIPLIVCITEGIPVLDMVRVK  L  S
Sbjct: 56  TVREARDKTGADASVIYVPPPGAADAICEAIDAEIPLIVCITEGIPVLDMVRVKRSLVGS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            SRLIGPNCPG++T   CKIGIMP +IF++GSVGI+SRSGTLTYEAVFQT+ EGLGQ+TA
Sbjct: 116 KSRLIGPNCPGVMTAGECKIGIMPANIFKQGSVGIVSRSGTLTYEAVFQTTSEGLGQTTA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPVKGTEFIDVLE+FLAD+ T SI+M+GEIGGSAEEEAAQFL DEAKRGRKKP+V
Sbjct: 176 VGIGGDPVKGTEFIDVLEMFLADDKTTSIIMIGEIGGSAEEEAAQFLIDEAKRGRKKPMV 235

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           GF+AG TAPPGR MGHAGA+ISGGKG A  K +AM+ AGI ++PSPAR+G++LVE+L 
Sbjct: 236 GFIAGVTAPPGRRMGHAGAIISGGKGDAASKTSAMEAAGITVSPSPARLGKTLVEVLK 293


>gi|152990586|ref|YP_001356308.1| succinyl-CoA synthase, alpha subunit [Nitratiruptor sp. SB155-2]
 gi|151422447|dbj|BAF69951.1| succinyl-CoA synthase, alpha subunit [Nitratiruptor sp. SB155-2]
          Length = 290

 Score =  335 bits (860), Expect = 4e-90,   Method: Composition-based stats.
 Identities = 161/299 (53%), Positives = 215/299 (71%), Gaps = 9/299 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSILV+K+TKV+VQG TGK GTFH+EQ I Y  TQ+VGG+ P KG        ++ PVF 
Sbjct: 1   MSILVNKDTKVIVQGFTGKEGTFHSEQCIEY-GTQIVGGVTPGKGGQTH----LDRPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA + T A  S+I+VPP+   DA++E+ +A I L V ITEG PV DM+  K    K 
Sbjct: 56  TVKEAVDATGATVSMIFVPPAFTADAVMEAADAGIELAVIITEGAPVKDMMYAKMYATKK 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             + IGPNCPGI+T + CKIGIMPG IF+KG VG++S+SGTLTYEA  Q  +EG G +TA
Sbjct: 116 GMKTIGPNCPGIITAEECKIGIMPGFIFKKGPVGLISKSGTLTYEASNQVVKEGYGITTA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G  +  +L +F AD  TE+IVM+GEIGG+ E EAA+F+K+       KP+V
Sbjct: 176 VGIGGDPIIGLSYKQLLPMFEADPETEAIVMIGEIGGTLEIEAAEFIKEN----ITKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
            F+AG+TAP G+ MGHAGA+ISGG+G A++K++A+  AG+ +  SPA IG+++ ++LG 
Sbjct: 232 AFIAGQTAPKGKRMGHAGAIISGGQGTAQEKMDALAAAGVHVVKSPADIGKTVAKVLGK 290


>gi|70726668|ref|YP_253582.1| succinyl-CoA synthetase subunit alpha [Staphylococcus haemolyticus
           JCSC1435]
 gi|68447392|dbj|BAE04976.1| succinyl-CoA synthetase (alpha subunit) [Staphylococcus
           haemolyticus JCSC1435]
          Length = 301

 Score =  335 bits (860), Expect = 4e-90,   Method: Composition-based stats.
 Identities = 170/296 (57%), Positives = 225/296 (76%), Gaps = 9/296 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+ +DKNTKV+VQG+TG    FHT+Q + Y  TQ+V G+ P KG     G    VPV+ 
Sbjct: 1   MSVFIDKNTKVMVQGITGSTALFHTKQMLDY-GTQIVAGVTPGKGGQVVEG----VPVYN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TVAEAKE T AN SV+YVP   A D+I+E+ +A++ +++CITE IPV+DMV+VK  LE  
Sbjct: 56  TVAEAKEETGANVSVVYVPAPFAADSILEAADADLDMVICITEHIPVVDMVKVKRYLEGR 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            +RL+GPNCPG++T D CKIGIMPG I +KG VG++SRSGTLTYEAV Q ++EG+GQ+TA
Sbjct: 116 KTRLVGPNCPGVITADECKIGIMPGYIHKKGHVGVVSRSGTLTYEAVHQLTEEGIGQTTA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPV GT FIDVL+ F  DE T+++VM+GEIGG+AEEEAA+++K        KP++
Sbjct: 176 VGIGGDPVNGTNFIDVLKAFNEDEDTKAVVMIGEIGGTAEEEAAEWIKANM----TKPVI 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVEL 296
           GF+ G+TAPPG+ MGHAGA+ISGGKG A++KI  + E G+  A +P+ IG +L+E 
Sbjct: 232 GFIGGQTAPPGKRMGHAGAIISGGKGTADEKIKTLNECGVKTADTPSEIGTTLIEA 287


>gi|288819189|ref|YP_003433537.1| succinyl-CoA synthetase alpha subunit [Hydrogenobacter thermophilus
           TK-6]
 gi|46849524|dbj|BAD17852.1| succinyl-CoA synthetase small subunit [Hydrogenobacter
           thermophilus]
 gi|288788589|dbj|BAI70336.1| succinyl-CoA synthetase alpha subunit [Hydrogenobacter thermophilus
           TK-6]
 gi|308752771|gb|ADO46254.1| succinyl-CoA synthetase, alpha subunit [Hydrogenobacter
           thermophilus TK-6]
          Length = 293

 Score =  335 bits (860), Expect = 4e-90,   Method: Composition-based stats.
 Identities = 170/299 (56%), Positives = 225/299 (75%), Gaps = 11/299 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           M+ILV+++TKV+VQG+TGK G+FH  Q   Y  TQVV G+ P KG     G    +PVF 
Sbjct: 1   MAILVNRDTKVVVQGITGKEGSFHAAQCKAY-GTQVVAGVTPGKGGQSVEG----IPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA + T AN S+I+VPP+ A DAI+E+++A I LIVCITEG+PV DM+ VK  + K+
Sbjct: 56  TVEEAVQETNANCSLIFVPPAFAADAIVEALDAGIELIVCITEGVPVKDMMMVKDYMRKN 115

Query: 121 --SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQS 178
             S++LIGPNCPG++TP   K+GIMPG +F++GSVGI+SRSGTLTYEA +Q +  GLGQS
Sbjct: 116 YPSAKLIGPNCPGVITPGEAKVGIMPGHVFKRGSVGIVSRSGTLTYEAAYQLTMVGLGQS 175

Query: 179 TAVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKP 238
           TAVGIGGDPV G    DV+ +F  D  TE+I+++GEIGG+AEEEAA+++K       KKP
Sbjct: 176 TAVGIGGDPVHGLSHKDVISMFNEDPETEAILIIGEIGGTAEEEAAEYIKHH----VKKP 231

Query: 239 IVGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELL 297
           +  ++AG TAPPGR MGHAGA+ISGG+G A+ K+ A++EAG+ +  +PA IG+SL ELL
Sbjct: 232 VFAYIAGITAPPGRRMGHAGAIISGGRGTAQAKMQALREAGVYVIENPAFIGKSLQELL 290


>gi|227886928|ref|ZP_04004733.1| succinyl-CoA synthetase alpha chain [Escherichia coli 83972]
 gi|227836069|gb|EEJ46535.1| succinyl-CoA synthetase alpha chain [Escherichia coli 83972]
 gi|307556210|gb|ADN48985.1| succinyl-CoA synthase, alpha subunit [Escherichia coli ABU 83972]
          Length = 290

 Score =  335 bits (859), Expect = 4e-90,   Method: Composition-based stats.
 Identities = 167/299 (55%), Positives = 219/299 (73%), Gaps = 10/299 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+L++K+T+VLV G+TGK GTFHTEQAI Y  TQ+VGG+ P KG       +++ PVF 
Sbjct: 1   MSVLINKHTRVLVLGITGKNGTFHTEQAIAY-GTQIVGGVTPGKGGQ----RHLDRPVFD 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           ++ EA  +T A+ASVIYVP     D+++E+IEA + L+V ITEG+P LDMV+V+  L+  
Sbjct: 56  SMKEAMRQTEADASVIYVPAPFVLDSVVEAIEAGVKLVVVITEGVPTLDMVKVRRLLDCH 115

Query: 121 S-SRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQST 179
              RLIGPNCPG++TP  CKIGIMPG I R G +GI+SRSGTLTYEAV QT+  GLGQST
Sbjct: 116 PDVRLIGPNCPGVITPGECKIGIMPGEIHRPGRIGIVSRSGTLTYEAVAQTTALGLGQST 175

Query: 180 AVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPI 239
            +GIGGDPV GT FID L LF  D  T++++M+GEIGG+AEE AA+F++ E      KP+
Sbjct: 176 CIGIGGDPVPGTNFIDALRLFENDPQTDAVIMIGEIGGNAEERAAEFIRHEM----NKPV 231

Query: 240 VGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           VG++AG TAP G+ MGHAGA+ISGG G AEDK  A  +AG+    +PA +G +L  ++ 
Sbjct: 232 VGYIAGVTAPKGKRMGHAGAIISGGSGSAEDKFRAFDKAGMAWTRNPALLGETLWNVIK 290


>gi|194333247|ref|YP_002015107.1| succinyl-CoA synthetase subunit alpha [Prosthecochloris aestuarii
           DSM 271]
 gi|194311065|gb|ACF45460.1| succinyl-CoA synthetase, alpha subunit [Prosthecochloris aestuarii
           DSM 271]
          Length = 300

 Score =  335 bits (859), Expect = 4e-90,   Method: Composition-based stats.
 Identities = 166/303 (54%), Positives = 226/303 (74%), Gaps = 10/303 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVN----- 55
           MS+LV+K+T+++VQG+TG  GTFHT Q + Y  T VV G+ P KG   + G   +     
Sbjct: 1   MSVLVNKDTRLVVQGITGGEGTFHTSQILEY-GTNVVAGVTPGKGGLQYNGNEKDAFCRP 59

Query: 56  VPVFTTVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKA 115
           VPV+ TV +A E   ANASVI+VP   A DAI+E+ EA + +I+CITEGIPV DM++   
Sbjct: 60  VPVYNTVKDAVEEAGANASVIFVPAPFAADAIMEAAEAGLKVIICITEGIPVNDMMKAYN 119

Query: 116 RLEKSSSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGL 175
            +++  + LIGPNCPG++TPD  K+GIMPG I +KG++G++SRSGTLTYEAV Q +  GL
Sbjct: 120 YVQEKGAVLIGPNCPGVITPDEAKVGIMPGFIHKKGTIGVVSRSGTLTYEAVHQLTDVGL 179

Query: 176 GQSTAVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGR 235
           GQST +GIGGDP+ GT FID ++LF  D+ TE ++M+GEIGG+AEEEAA+++K       
Sbjct: 180 GQSTCIGIGGDPIIGTRFIDAIKLFAKDDETEGLIMIGEIGGTAEEEAAEYIKRH----F 235

Query: 236 KKPIVGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVE 295
           KKP+VGF+AG+TAPPGR MGHAGA++SGGKG A++KI AM+ AGI +  +PA IG ++++
Sbjct: 236 KKPVVGFIAGRTAPPGRRMGHAGAIVSGGKGTADEKIKAMERAGIHVVENPADIGDAMLK 295

Query: 296 LLG 298
            LG
Sbjct: 296 ALG 298


>gi|259415235|ref|ZP_05739157.1| succinyl-CoA ligase, alpha subunit [Silicibacter sp. TrichCH4B]
 gi|259349145|gb|EEW60899.1| succinyl-CoA ligase, alpha subunit [Silicibacter sp. TrichCH4B]
          Length = 295

 Score =  335 bits (859), Expect = 5e-90,   Method: Composition-based stats.
 Identities = 197/299 (65%), Positives = 247/299 (82%), Gaps = 5/299 (1%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           M++L+D+NTKV+ QGLTG  GTFHTEQAI Y  T++VGG+ P KG        +++PVF 
Sbjct: 1   MAVLIDENTKVICQGLTGSQGTFHTEQAIAY-GTKMVGGVTPGKGGQKH----LDLPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           +V EAK  T ANASVIYVPP  A D+I+E+I+AE+ LIVCITEGIPVLDM++VK  LE S
Sbjct: 56  SVHEAKHVTEANASVIYVPPPFAADSILEAIDAEMELIVCITEGIPVLDMMKVKRALETS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            SRLIGPNCPG++TPD+CKIGIMPG I ++GSVG++SRSGTLTYEAV QTS  GLGQS+A
Sbjct: 116 KSRLIGPNCPGVITPDACKIGIMPGHIHKRGSVGVVSRSGTLTYEAVKQTSDIGLGQSSA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+KGTE IDVL++FL D  T+SI+M+GEIGGSAEEEAA+F+ ++ K+GR KPI 
Sbjct: 176 VGIGGDPIKGTEHIDVLDMFLDDPETQSIIMIGEIGGSAEEEAAEFIAEQKKKGRWKPIA 235

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
           GF+AG+TAPPGR MGHAGA+++GGKGGAEDKI AMK AGI +A SPA +G ++ + + +
Sbjct: 236 GFIAGRTAPPGRRMGHAGAIVAGGKGGAEDKIEAMKSAGIVVADSPATLGEAVQKAIAN 294


>gi|145344592|ref|XP_001416813.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gi|144577039|gb|ABO95106.1| predicted protein [Ostreococcus lucimarinus CCE9901]
          Length = 344

 Score =  335 bits (859), Expect = 5e-90,   Method: Composition-based stats.
 Identities = 187/299 (62%), Positives = 230/299 (76%), Gaps = 9/299 (3%)

Query: 2   SILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFTT 61
           ++ VDKNT+V+VQG TGK GTFH+EQAI Y  TQVVGG+ P+KG T      +N+PVF T
Sbjct: 50  AVFVDKNTRVIVQGFTGKNGTFHSEQAIAY-GTQVVGGVTPRKGGTTH----LNLPVFDT 104

Query: 62  VAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLE-KS 120
           V EAKE T ANASVIYVPP  A  A++E+IEAE+ L+VCITEGIP  DMVRVK  L  +S
Sbjct: 105 VREAKESTKANASVIYVPPPFAARAVMEAIEAEVELVVCITEGIPQHDMVRVKQALMSQS 164

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            +RLIGPNCPGI+ P  CKIGIMPG I + G VG++SRSGTLTYEAV+QT+  GLGQST 
Sbjct: 165 KTRLIGPNCPGIIKPGECKIGIMPGYIHKPGRVGVVSRSGTLTYEAVYQTTVAGLGQSTC 224

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP  GT F+D LE F+ D  TE I+M+GEIGG+AEEEAA+F++     G +KPIV
Sbjct: 225 VGIGGDPFNGTNFVDCLEKFVKDPQTEGIIMIGEIGGTAEEEAAEFIRA---SGTEKPIV 281

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
            F+AG TAPPGR MGHAGA+ISGGKG A DKI A++  G+ +  SPA++G+++ E+ G 
Sbjct: 282 SFIAGLTAPPGRRMGHAGAIISGGKGSAGDKIAALERVGVRVVKSPAKMGQAMYEMFGE 340


>gi|222150039|ref|YP_002550996.1| succinyl-CoA synthetase subunit alpha [Agrobacterium vitis S4]
 gi|221737021|gb|ACM37984.1| succinyl-CoA synthetase alpha chain [Agrobacterium vitis S4]
          Length = 300

 Score =  335 bits (859), Expect = 5e-90,   Method: Composition-based stats.
 Identities = 235/299 (78%), Positives = 273/299 (91%), Gaps = 1/299 (0%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTG-GNVNVPVF 59
           MSIL++K+TKVLVQGLTGK GTFHTEQA+ Y  T++VGGIHP KG + WTG     +P+F
Sbjct: 1   MSILINKDTKVLVQGLTGKTGTFHTEQALAYYGTKMVGGIHPAKGGSNWTGSKGETLPIF 60

Query: 60  TTVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEK 119
            +VAE K+ T ANASVIYVPP+GA  AIIE+IEAEIPLIVCITEGIPV DMV+VKARL+K
Sbjct: 61  ASVAEGKDVTGANASVIYVPPAGAAAAIIEAIEAEIPLIVCITEGIPVADMVKVKARLDK 120

Query: 120 SSSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQST 179
           S SRLIGPNCPG++TP+ CKIGIMPGSIFRKGSVG+LSRSGTLTYEAVFQTS EGLGQ++
Sbjct: 121 SKSRLIGPNCPGVMTPEECKIGIMPGSIFRKGSVGVLSRSGTLTYEAVFQTSNEGLGQTS 180

Query: 180 AVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPI 239
           AVGIGGDPVKGTEFID+LE++LADEAT+SI+M+GEIGGSAEEEAAQFLKDEAK+GRKKP+
Sbjct: 181 AVGIGGDPVKGTEFIDILEMYLADEATKSIIMIGEIGGSAEEEAAQFLKDEAKKGRKKPM 240

Query: 240 VGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           VGF+AG+TAPPGRTMGHAGAVISGGKGGAEDKI AM+ AGI ++PSPAR+G++LVE+L 
Sbjct: 241 VGFIAGRTAPPGRTMGHAGAVISGGKGGAEDKIEAMESAGIRVSPSPARLGKTLVEVLK 299


>gi|323143444|ref|ZP_08078127.1| succinate-CoA ligase, alpha subunit [Succinatimonas hippei YIT
           12066]
 gi|322416729|gb|EFY07380.1| succinate-CoA ligase, alpha subunit [Succinatimonas hippei YIT
           12066]
          Length = 292

 Score =  335 bits (859), Expect = 5e-90,   Method: Composition-based stats.
 Identities = 171/299 (57%), Positives = 222/299 (74%), Gaps = 10/299 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSILV+K+TKV+ QG+TG  GT H+EQ + Y  T++VGG+ P +G +   G    +PVF 
Sbjct: 1   MSILVNKDTKVICQGITGSQGTAHSEQCLAY-GTKLVGGVTPGRGGSSHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA E T A  S+I+VPP  A D+I E+I+A I LIVCITEGIPVLDM+RVKARL +S
Sbjct: 56  TVREAVEVTQATTSMIFVPPPFAADSIFEAIDAGIELIVCITEGIPVLDMLRVKARLRES 115

Query: 121 -SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQST 179
             +RLIGPNCPGI+TP  CK+GIMPG I   G VGI+SRSGTLTYEAV QT+  G GQST
Sbjct: 116 GKTRLIGPNCPGIVTPGECKVGIMPGYIHTPGKVGIVSRSGTLTYEAVKQTTDAGFGQST 175

Query: 180 AVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPI 239
            VGIGGDP++G+ F+D+L+LF  D  TE++VMVGEIGG+AE++AA ++K+       KP+
Sbjct: 176 CVGIGGDPIQGSNFVDMLKLFEEDPQTEAVVMVGEIGGTAEQDAAMWIKEHM----TKPV 231

Query: 240 VGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           V ++AG TAP G+ MGHAGA+I+GG+G A+ K  A++EAG+ + P+ A I   L E  G
Sbjct: 232 VSYIAGSTAPQGQRMGHAGAIITGGQGTAQAKQKALREAGVTVVPTAADIADGLREATG 290


>gi|49483409|ref|YP_040633.1| succinyl-CoA synthetase subunit alpha [Staphylococcus aureus subsp.
           aureus MRSA252]
 gi|282903801|ref|ZP_06311689.1| succinyl-CoA synthase, alpha subunit [Staphylococcus aureus subsp.
           aureus C160]
 gi|282905564|ref|ZP_06313419.1| succinyl-CoA ligase [ADP-forming] subunit alpha [Staphylococcus
           aureus subsp. aureus Btn1260]
 gi|282908539|ref|ZP_06316369.1| succinyl-CoA synthetase subunit alpha [Staphylococcus aureus subsp.
           aureus WW2703/97]
 gi|282910818|ref|ZP_06318621.1| succinyl-CoA synthetase subunit alpha [Staphylococcus aureus subsp.
           aureus WBG10049]
 gi|282918945|ref|ZP_06326680.1| succinyl-CoA ligase [ADP-forming] subunit alpha [Staphylococcus
           aureus subsp. aureus C427]
 gi|283957989|ref|ZP_06375440.1| succinyl-CoA synthase, alpha subunit [Staphylococcus aureus subsp.
           aureus A017934/97]
 gi|295427733|ref|ZP_06820365.1| succinyl-CoA ligase subunit alpha [Staphylococcus aureus subsp.
           aureus EMRSA16]
 gi|297591309|ref|ZP_06949947.1| succinate--CoA ligase (ADP-forming) alpha subunit [Staphylococcus
           aureus subsp. aureus MN8]
 gi|81651268|sp|Q6GHI9|SUCD_STAAR RecName: Full=Succinyl-CoA ligase [ADP-forming] subunit alpha;
           AltName: Full=Succinyl-CoA synthetase subunit alpha;
           Short=SCS-alpha
 gi|49241538|emb|CAG40224.1| putative succinyl-CoA ligase [Staphylococcus aureus subsp. aureus
           MRSA252]
 gi|282316755|gb|EFB47129.1| succinyl-CoA ligase [ADP-forming] subunit alpha [Staphylococcus
           aureus subsp. aureus C427]
 gi|282325423|gb|EFB55732.1| succinyl-CoA synthetase subunit alpha [Staphylococcus aureus subsp.
           aureus WBG10049]
 gi|282327601|gb|EFB57884.1| succinyl-CoA synthetase subunit alpha [Staphylococcus aureus subsp.
           aureus WW2703/97]
 gi|282330856|gb|EFB60370.1| succinyl-CoA ligase [ADP-forming] subunit alpha [Staphylococcus
           aureus subsp. aureus Btn1260]
 gi|282595419|gb|EFC00383.1| succinyl-CoA synthase, alpha subunit [Staphylococcus aureus subsp.
           aureus C160]
 gi|283790138|gb|EFC28955.1| succinyl-CoA synthase, alpha subunit [Staphylococcus aureus subsp.
           aureus A017934/97]
 gi|295128091|gb|EFG57725.1| succinyl-CoA ligase subunit alpha [Staphylococcus aureus subsp.
           aureus EMRSA16]
 gi|297576195|gb|EFH94911.1| succinate--CoA ligase (ADP-forming) alpha subunit [Staphylococcus
           aureus subsp. aureus MN8]
 gi|312438376|gb|ADQ77447.1| succinyl-CoA synthetase subunit alpha [Staphylococcus aureus subsp.
           aureus TCH60]
 gi|315194135|gb|EFU24528.1| succinyl-CoA synthetase subunit alpha [Staphylococcus aureus subsp.
           aureus CGS00]
          Length = 302

 Score =  335 bits (859), Expect = 5e-90,   Method: Composition-based stats.
 Identities = 168/296 (56%), Positives = 221/296 (74%), Gaps = 9/296 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+ +DKNTKV+VQG+TG    FHT+Q + Y  T++V G+ P KG     G    VPVF 
Sbjct: 1   MSVFIDKNTKVMVQGITGSTALFHTKQMLDY-GTKIVAGVTPGKGGQVVEG----VPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EAK  T A  SVIYVP   A D+I+E+ +A++ +++CITE IPVLDMV+VK  L+  
Sbjct: 56  TVEEAKNETGATVSVIYVPAPFAADSILEAADADLDMVICITEHIPVLDMVKVKRYLQGR 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            +RL+GPNCPG++T D CKIGIMPG I +KG VG++SRSGTLTYEAV Q ++EG+GQ+TA
Sbjct: 116 KTRLVGPNCPGVITADECKIGIMPGYIHKKGHVGVVSRSGTLTYEAVHQLTEEGIGQTTA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPV GT FIDVL+ F  D+ T+++VM+GEIGG+AEEEAA+++K        KP+V
Sbjct: 176 VGIGGDPVNGTNFIDVLKAFNEDDETKAVVMIGEIGGTAEEEAAEWIKANM----TKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVEL 296
           GF+ G+TAPPG+ MGHAGA+ISGGKG AE+KI  +   G+  A +P+ IG +L+E 
Sbjct: 232 GFIGGQTAPPGKRMGHAGAIISGGKGTAEEKIKTLNSCGVKTAATPSEIGSTLIEA 287


>gi|108762192|ref|YP_631735.1| succinyl-CoA synthetase subunit alpha [Myxococcus xanthus DK 1622]
 gi|108466072|gb|ABF91257.1| succinyl-CoA synthetase, alpha subunit [Myxococcus xanthus DK 1622]
          Length = 299

 Score =  335 bits (859), Expect = 5e-90,   Method: Composition-based stats.
 Identities = 174/300 (58%), Positives = 225/300 (75%), Gaps = 10/300 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           M+ILV++NTKVL QG+TG AG+FH +Q + Y  T++V G+ P KG T + G    VPVF 
Sbjct: 1   MAILVNENTKVLCQGITGSAGSFHAKQMLEY-GTKLVAGVTPGKGGTTFEGK---VPVFN 56

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TVAEA + T AN SV++VPP  A D+I+E+ +A + LI+ ITEGIPV DMVR K  L+  
Sbjct: 57  TVAEAVKETGANTSVVFVPPPFAADSIMEAADAGVALIIVITEGIPVNDMVRAKRYLQGK 116

Query: 121 S-SRLIGPNCPGILTPDS-CKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQS 178
              RL+GPNCPG++TP + CKIGIMPG I + G +G++SRSGTLTYEAV Q +Q GLGQS
Sbjct: 117 PGIRLVGPNCPGVITPGALCKIGIMPGHIHKPGRIGVVSRSGTLTYEAVHQLTQLGLGQS 176

Query: 179 TAVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKP 238
           TAVGIGGDPV GT+F+DVL+LF AD  T++++M+GEIGG AEE  A+++     R   KP
Sbjct: 177 TAVGIGGDPVNGTDFVDVLKLFNADPDTDAVIMIGEIGGDAEERGAEYVA----REFTKP 232

Query: 239 IVGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           I GF+AG++APPG+ MGHAGA+ISGGKG A +KI AM+ AGI +A SPA +G +L E L 
Sbjct: 233 IAGFIAGQSAPPGKRMGHAGAIISGGKGTATEKIKAMEAAGILMAASPAELGTTLQEALK 292


>gi|163738926|ref|ZP_02146339.1| dihydrolipoamide acetyltransferase [Phaeobacter gallaeciensis
           BS107]
 gi|163741830|ref|ZP_02149220.1| succinyl-CoA synthase, alpha subunit [Phaeobacter gallaeciensis
           2.10]
 gi|161385003|gb|EDQ09382.1| succinyl-CoA synthase, alpha subunit [Phaeobacter gallaeciensis
           2.10]
 gi|161387731|gb|EDQ12087.1| succinyl-CoA ligase [ADP-forming] subunit alpha [Phaeobacter
           gallaeciensis BS107]
          Length = 294

 Score =  335 bits (858), Expect = 6e-90,   Method: Composition-based stats.
 Identities = 197/299 (65%), Positives = 248/299 (82%), Gaps = 5/299 (1%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           M++L+D+NTKV+ QG TG  GTFH+EQAI Y  T++VGG+ P KG        +N+PVF 
Sbjct: 1   MAVLIDENTKVICQGFTGSQGTFHSEQAIAY-GTKMVGGVTPGKGGQTH----LNLPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           +V EAK  T ANASVIYVPP  A D+I+E+I+AE+ LIVCITEGIPVLDM++VK  LE S
Sbjct: 56  SVHEAKHVTEANASVIYVPPPFAADSILEAIDAEMELIVCITEGIPVLDMMKVKRALEDS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            SRLIGPNCPG++TPD+CKIGIMPG I ++GSVG++SRSGTLTYEAV QT+  GLGQSTA
Sbjct: 116 KSRLIGPNCPGVITPDACKIGIMPGHIHKRGSVGVVSRSGTLTYEAVKQTADIGLGQSTA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+KGTE IDVL++FL D+ T+SI+M+GEIGGSAEEEAA+F+ ++ K+GR KPI 
Sbjct: 176 VGIGGDPIKGTEHIDVLDMFLNDDETQSIIMIGEIGGSAEEEAAEFIAEQKKKGRWKPIA 235

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
           GF+AG+TAPPGR MGHAGA+++GGKGGAEDKI AMK AGI +A SPA +G ++++ +G 
Sbjct: 236 GFIAGRTAPPGRRMGHAGAIVAGGKGGAEDKIEAMKSAGIVVADSPATLGEAVLKAIGK 294


>gi|83592548|ref|YP_426300.1| succinyl-CoA synthetase subunit alpha [Rhodospirillum rubrum ATCC
           11170]
 gi|83575462|gb|ABC22013.1| succinyl-CoA synthetase (ADP-forming) alpha subunit [Rhodospirillum
           rubrum ATCC 11170]
          Length = 292

 Score =  335 bits (858), Expect = 6e-90,   Method: Composition-based stats.
 Identities = 186/299 (62%), Positives = 230/299 (76%), Gaps = 8/299 (2%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+LV  +TKV+ QG TG  GTFH+EQAI Y  T++VGG+ P KG +      +++PVF 
Sbjct: 1   MSVLVSNDTKVICQGFTGSQGTFHSEQAIAY-GTKMVGGVTPGKGGSTH----LDLPVFD 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV +A+E T  NA+VIYVPP  A DAI+E+I AEI L VCITEGIPVLDMV+VK  L  S
Sbjct: 56  TVIQAREATGCNATVIYVPPPFAADAILEAINAEIELAVCITEGIPVLDMVKVKRALRGS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            +RLIGPNCPG++TP  CKIGIMPG I  +G +G++SRSGTLTYEAV QT+  GLGQST 
Sbjct: 116 KTRLIGPNCPGVITPGECKIGIMPGHIHTRGKIGVVSRSGTLTYEAVAQTTAAGLGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           +GIGGDPV GT FID LE+FLAD  T+ I+M+GEIGGSAEEEAA+FLK       KKP+ 
Sbjct: 176 IGIGGDPVNGTNFIDCLEMFLADPETQGIIMIGEIGGSAEEEAAEFLK---HSKIKKPMC 232

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
           GF+AG TAPPG+ MGHAGA+ISGGKG A DK++AM+ AGI +A SP+ +G ++VE + S
Sbjct: 233 GFIAGVTAPPGKRMGHAGAIISGGKGTAGDKMDAMRSAGILVADSPSALGSTMVEAMKS 291


>gi|304404234|ref|ZP_07385896.1| succinyl-CoA synthetase, alpha subunit [Paenibacillus
           curdlanolyticus YK9]
 gi|304347212|gb|EFM13044.1| succinyl-CoA synthetase, alpha subunit [Paenibacillus
           curdlanolyticus YK9]
          Length = 310

 Score =  335 bits (858), Expect = 6e-90,   Method: Composition-based stats.
 Identities = 174/304 (57%), Positives = 227/304 (74%), Gaps = 10/304 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWT-----GGNVN 55
           MSIL++K+TKV+ QG+TGK   FH + A+ Y  TQ+VGG  P KG T        G   +
Sbjct: 1   MSILINKDTKVITQGITGKTALFHAKGALDY-GTQMVGGTSPGKGGTTVEIALENGSTAS 59

Query: 56  VPVFTTVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKA 115
           +PVF TV EA   T A ASVIYVPP+ A DAI+E+++AE+ +++CITEGIPVLDMV+V+ 
Sbjct: 60  LPVFNTVTEAVAATGATASVIYVPPAFAADAILEAVDAELEIVICITEGIPVLDMVKVQR 119

Query: 116 RLEKSSSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGL 175
            LE   +RLIGPNCPG++TPD CKIGIMPG I  KG VG++SRSGTLTYEAV Q +  G+
Sbjct: 120 YLEGKKTRLIGPNCPGLITPDECKIGIMPGYIHTKGHVGVVSRSGTLTYEAVHQLTTRGI 179

Query: 176 GQSTAVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGR 235
           GQS+AVGIGGDPVKGTEFIDVL +F  D  T +++M+GEIGG+AEEEAA+++K       
Sbjct: 180 GQSSAVGIGGDPVKGTEFIDVLNMFNEDPDTYAVIMIGEIGGTAEEEAAEWIKANM---- 235

Query: 236 KKPIVGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVE 295
           KKP+VGF+ G TAP G+ MGHAGA+ISGGKG A +KI  ++  G+ ++P+P+ +G +LV 
Sbjct: 236 KKPVVGFIGGATAPEGKRMGHAGAIISGGKGTAAEKIATLEACGVKVSPTPSEMGSTLVS 295

Query: 296 LLGS 299
           +L  
Sbjct: 296 VLEE 299


>gi|221142036|ref|ZP_03566529.1| succinyl-CoA synthetase subunit alpha [Staphylococcus aureus subsp.
           aureus str. JKD6009]
 gi|304381190|ref|ZP_07363843.1| succinyl-CoA synthetase subunit alpha [Staphylococcus aureus subsp.
           aureus ATCC BAA-39]
 gi|269940738|emb|CBI49119.1| putative succinyl-CoA ligase [Staphylococcus aureus subsp. aureus
           TW20]
 gi|302751069|gb|ADL65246.1| succinate--CoA ligase (ADP-forming) alpha subunit [Staphylococcus
           aureus subsp. aureus str. JKD6008]
 gi|304340173|gb|EFM06114.1| succinyl-CoA synthetase subunit alpha [Staphylococcus aureus subsp.
           aureus ATCC BAA-39]
 gi|329313915|gb|AEB88328.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Staphylococcus
           aureus subsp. aureus T0131]
          Length = 302

 Score =  335 bits (858), Expect = 7e-90,   Method: Composition-based stats.
 Identities = 168/296 (56%), Positives = 220/296 (74%), Gaps = 9/296 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+ +DKNTKV+VQG+TG    FHT+Q + Y  T++V G+ P KG     G    VPVF 
Sbjct: 1   MSVFIDKNTKVMVQGITGSTALFHTKQMLDY-GTKIVAGVTPGKGGQVVEG----VPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EAK  T A  SVIYVP   A D+I+E+ +A++ +++CITE IPVLDMV+VK  L+  
Sbjct: 56  TVEEAKNETGATVSVIYVPAPFAADSILEAADADLDMVICITEHIPVLDMVKVKRYLQGR 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            +RL+GPNCPG++T D CKIGIMPG I  KG VG++SRSGTLTYEAV Q ++EG+GQ+TA
Sbjct: 116 KTRLVGPNCPGVITADECKIGIMPGYIHEKGHVGVVSRSGTLTYEAVHQLTEEGIGQTTA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPV GT FIDVL+ F  D+ T+++VM+GEIGG+AEEEAA+++K        KP+V
Sbjct: 176 VGIGGDPVNGTNFIDVLKAFNEDDETKAVVMIGEIGGTAEEEAAEWIKANM----TKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVEL 296
           GF+ G+TAPPG+ MGHAGA+ISGGKG AE+KI  +   G+  A +P+ IG +L+E 
Sbjct: 232 GFIGGQTAPPGKRMGHAGAIISGGKGTAEEKIKTLNSCGVKTAATPSEIGSTLIEA 287


>gi|283782077|ref|YP_003372832.1| succinyl-CoA synthetase, alpha subunit [Pirellula staleyi DSM 6068]
 gi|283440530|gb|ADB18972.1| succinyl-CoA synthetase, alpha subunit [Pirellula staleyi DSM 6068]
          Length = 293

 Score =  335 bits (858), Expect = 7e-90,   Method: Composition-based stats.
 Identities = 165/299 (55%), Positives = 221/299 (73%), Gaps = 9/299 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL++KNT+V+ QG+TGKAG FHT+    Y  T +VGG+ P K      G    +PVF 
Sbjct: 1   MSILINKNTRVICQGITGKAGAFHTKGCKEY-GTNMVGGVTPGKSGETVEG----LPVFD 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA ++T ANA++I+VP +   DAI+E+++A I +I  ITEG+PV+DMVRV   +  S
Sbjct: 56  TVKEAVDKTGANATMIFVPAAYTADAILEALDAGIEVIAAITEGVPVIDMVRVYELVRAS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            S LIGPNCPG++TP  CKIGIMPG I + G+VGI+SRSGTLTYEAV+QT+  GLGQST 
Sbjct: 116 KSVLIGPNCPGLITPGECKIGIMPGYIHKPGNVGIMSRSGTLTYEAVWQTTGLGLGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VG+GGDP+ GT +ID+ +L+ AD  TE+I+M+GEIGG+AEEEAA ++K        KP+ 
Sbjct: 176 VGLGGDPIVGTNYIDLFKLYEADPQTEAILMIGEIGGTAEEEAAAYVKAH----VTKPVA 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
            F+AG+TAPPGR MGHAGA+ISGGKG A +K+ A+++AGI +A SPA +G ++   +  
Sbjct: 232 AFIAGRTAPPGRRMGHAGAIISGGKGTAAEKVAALEDAGIEVADSPATMGEAVQRAIAK 290


>gi|99078488|ref|YP_611746.1| succinyl-CoA synthetase (ADP-forming) alpha subunit [Ruegeria sp.
           TM1040]
 gi|99035626|gb|ABF62484.1| succinyl-CoA synthetase (ADP-forming) alpha subunit [Ruegeria sp.
           TM1040]
          Length = 295

 Score =  335 bits (858), Expect = 7e-90,   Method: Composition-based stats.
 Identities = 196/299 (65%), Positives = 248/299 (82%), Gaps = 5/299 (1%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           M++L+D+NTKV+ QGLTG  GTFHTEQAI Y  T++VGG+ P KG        +++PVF 
Sbjct: 1   MAVLIDENTKVICQGLTGSQGTFHTEQAIAY-GTKMVGGVTPGKGGQTH----LDLPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           +V EAK  T ANASVIYVPP  A D+I+E+I+AE+ LIVCITEGIPVLDM++V+  LE S
Sbjct: 56  SVHEAKHVTEANASVIYVPPPFAADSILEAIDAEMELIVCITEGIPVLDMMKVQRALEGS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            SRLIGPNCPG++TPD+CKIGIMPG I ++GSVG++SRSGTLTYEAV QTS  GLGQS+A
Sbjct: 116 KSRLIGPNCPGVITPDACKIGIMPGHIHKRGSVGVVSRSGTLTYEAVKQTSDIGLGQSSA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+KGTE IDVL++FL D+ T+SI+M+GEIGGSAEEEAA+F+ ++ K+GR KPI 
Sbjct: 176 VGIGGDPIKGTEHIDVLDMFLDDDETQSIIMIGEIGGSAEEEAAEFIAEQKKKGRWKPIA 235

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
           GF+AG+TAPPGR MGHAGA+++GGKGGAEDKI AMK AGI +A SPA +G ++ + + +
Sbjct: 236 GFIAGRTAPPGRRMGHAGAIVAGGKGGAEDKIEAMKSAGIVVADSPATLGEAVQKAIAN 294


>gi|15924236|ref|NP_371770.1| succinyl-CoA synthetase subunit alpha [Staphylococcus aureus subsp.
           aureus Mu50]
 gi|15926829|ref|NP_374362.1| succinyl-CoA synthetase subunit alpha [Staphylococcus aureus subsp.
           aureus N315]
 gi|57651815|ref|YP_186121.1| succinyl-CoA synthetase subunit alpha [Staphylococcus aureus subsp.
           aureus COL]
 gi|82750849|ref|YP_416590.1| succinyl-CoA synthetase subunit alpha [Staphylococcus aureus RF122]
 gi|87161332|ref|YP_493836.1| succinyl-CoA synthetase subunit alpha [Staphylococcus aureus subsp.
           aureus USA300_FPR3757]
 gi|88194954|ref|YP_499754.1| succinyl-CoA synthetase subunit alpha [Staphylococcus aureus subsp.
           aureus NCTC 8325]
 gi|148267737|ref|YP_001246680.1| succinyl-CoA synthetase subunit alpha [Staphylococcus aureus subsp.
           aureus JH9]
 gi|150393795|ref|YP_001316470.1| succinyl-CoA synthetase subunit alpha [Staphylococcus aureus subsp.
           aureus JH1]
 gi|151221368|ref|YP_001332190.1| succinyl-CoA synthetase subunit alpha [Staphylococcus aureus subsp.
           aureus str. Newman]
 gi|156979567|ref|YP_001441826.1| succinyl-CoA synthetase subunit alpha [Staphylococcus aureus subsp.
           aureus Mu3]
 gi|161509412|ref|YP_001575071.1| succinyl-CoA synthetase subunit alpha [Staphylococcus aureus subsp.
           aureus USA300_TCH1516]
 gi|253315604|ref|ZP_04838817.1| succinyl-CoA synthetase subunit alpha [Staphylococcus aureus subsp.
           aureus str. CF-Marseille]
 gi|255006033|ref|ZP_05144634.2| succinyl-CoA synthetase subunit alpha [Staphylococcus aureus subsp.
           aureus Mu50-omega]
 gi|257795698|ref|ZP_05644677.1| succinyl-CoA synthetase subunit alpha [Staphylococcus aureus A9781]
 gi|258415922|ref|ZP_05682192.1| succinyl-CoA synthetase subunit alpha [Staphylococcus aureus A9763]
 gi|258421684|ref|ZP_05684608.1| succinyl-CoA synthetase subunit alpha [Staphylococcus aureus A9719]
 gi|258423913|ref|ZP_05686798.1| succinyl-CoA synthetase subunit alpha [Staphylococcus aureus A9635]
 gi|258444584|ref|ZP_05692913.1| succinyl-CoA synthetase subunit alpha [Staphylococcus aureus A8115]
 gi|258447583|ref|ZP_05695727.1| succinyl-CoA synthetase subunit alpha [Staphylococcus aureus A6300]
 gi|258449425|ref|ZP_05697528.1| succinyl-CoA synthetase subunit alpha [Staphylococcus aureus A6224]
 gi|258452545|ref|ZP_05700551.1| succinyl-CoA synthetase subunit alpha [Staphylococcus aureus A5948]
 gi|258454804|ref|ZP_05702768.1| succinyl-CoA synthetase subunit alpha [Staphylococcus aureus A5937]
 gi|262048144|ref|ZP_06021031.1| succinyl-CoA synthetase alpha subunit [Staphylococcus aureus D30]
 gi|262051309|ref|ZP_06023532.1| succinyl-CoA synthetase alpha subunit [Staphylococcus aureus
           930918-3]
 gi|269202862|ref|YP_003282131.1| succinyl-CoA synthetase subunit alpha [Staphylococcus aureus subsp.
           aureus ED98]
 gi|282892734|ref|ZP_06300969.1| succinyl-CoA ligase [ADP-forming] subunit alpha [Staphylococcus
           aureus A8117]
 gi|282920030|ref|ZP_06327759.1| succinyl-CoA ligase [ADP-forming] subunit alpha [Staphylococcus
           aureus A9765]
 gi|282927588|ref|ZP_06335204.1| succinyl-CoA ligase [ADP-forming] subunit alpha [Staphylococcus
           aureus A10102]
 gi|284024239|ref|ZP_06378637.1| succinyl-CoA synthetase subunit alpha [Staphylococcus aureus subsp.
           aureus 132]
 gi|294848241|ref|ZP_06788988.1| succinyl-CoA ligase subunit alpha [Staphylococcus aureus A9754]
 gi|295406181|ref|ZP_06815988.1| succinyl-CoA ligase subunit alpha [Staphylococcus aureus A8819]
 gi|296274803|ref|ZP_06857310.1| succinyl-CoA synthetase subunit alpha [Staphylococcus aureus subsp.
           aureus MR1]
 gi|297244409|ref|ZP_06928292.1| succinyl-CoA ligase subunit alpha [Staphylococcus aureus A8796]
 gi|54039646|sp|P99070|SUCD_STAAN RecName: Full=Succinyl-CoA ligase [ADP-forming] subunit alpha;
           AltName: Full=Succinyl-CoA synthetase subunit alpha;
           Short=SCS-alpha
 gi|54042230|sp|P66866|SUCD_STAAM RecName: Full=Succinyl-CoA ligase [ADP-forming] subunit alpha;
           AltName: Full=Succinyl-CoA synthetase subunit alpha;
           Short=SCS-alpha
 gi|81694646|sp|Q5HGI6|SUCD_STAAC RecName: Full=Succinyl-CoA ligase [ADP-forming] subunit alpha;
           AltName: Full=Succinyl-CoA synthetase subunit alpha;
           Short=SCS-alpha
 gi|13701046|dbj|BAB42341.1| succinyl-CoA synthetase [Staphylococcus aureus subsp. aureus N315]
 gi|14247016|dbj|BAB57408.1| succinyl-CoA synthetase [Staphylococcus aureus subsp. aureus Mu50]
 gi|57286001|gb|AAW38095.1| succinyl-CoA synthase, alpha subunit [Staphylococcus aureus subsp.
           aureus COL]
 gi|82656380|emb|CAI80799.1| succinyl-CoA synthetase alpha chain [Staphylococcus aureus RF122]
 gi|87127306|gb|ABD21820.1| succinyl-CoA synthetase, alpha subunit [Staphylococcus aureus
           subsp. aureus USA300_FPR3757]
 gi|87202512|gb|ABD30322.1| succinyl-CoA synthetase, alpha subunit, putative [Staphylococcus
           aureus subsp. aureus NCTC 8325]
 gi|147740806|gb|ABQ49104.1| succinyl-CoA synthetase (ADP-forming) alpha subunit [Staphylococcus
           aureus subsp. aureus JH9]
 gi|149946247|gb|ABR52183.1| succinyl-CoA synthetase, alpha subunit [Staphylococcus aureus
           subsp. aureus JH1]
 gi|150374168|dbj|BAF67428.1| succinyl-CoA synthetase, alpha subunit [Staphylococcus aureus
           subsp. aureus str. Newman]
 gi|156721702|dbj|BAF78119.1| succinyl-CoA synthetase [Staphylococcus aureus subsp. aureus Mu3]
 gi|160368221|gb|ABX29192.1| succinate--CoA ligase (ADP-forming) alpha subunit [Staphylococcus
           aureus subsp. aureus USA300_TCH1516]
 gi|257789670|gb|EEV28010.1| succinyl-CoA synthetase subunit alpha [Staphylococcus aureus A9781]
 gi|257839258|gb|EEV63732.1| succinyl-CoA synthetase subunit alpha [Staphylococcus aureus A9763]
 gi|257842370|gb|EEV66795.1| succinyl-CoA synthetase subunit alpha [Staphylococcus aureus A9719]
 gi|257845942|gb|EEV69971.1| succinyl-CoA synthetase subunit alpha [Staphylococcus aureus A9635]
 gi|257850077|gb|EEV74030.1| succinyl-CoA synthetase subunit alpha [Staphylococcus aureus A8115]
 gi|257853774|gb|EEV76733.1| succinyl-CoA synthetase subunit alpha [Staphylococcus aureus A6300]
 gi|257857413|gb|EEV80311.1| succinyl-CoA synthetase subunit alpha [Staphylococcus aureus A6224]
 gi|257859763|gb|EEV82605.1| succinyl-CoA synthetase subunit alpha [Staphylococcus aureus A5948]
 gi|257863187|gb|EEV85951.1| succinyl-CoA synthetase subunit alpha [Staphylococcus aureus A5937]
 gi|259160684|gb|EEW45705.1| succinyl-CoA synthetase alpha subunit [Staphylococcus aureus
           930918-3]
 gi|259163710|gb|EEW48265.1| succinyl-CoA synthetase alpha subunit [Staphylococcus aureus D30]
 gi|262075152|gb|ACY11125.1| succinyl-CoA synthetase subunit alpha [Staphylococcus aureus subsp.
           aureus ED98]
 gi|282590591|gb|EFB95668.1| succinyl-CoA ligase [ADP-forming] subunit alpha [Staphylococcus
           aureus A10102]
 gi|282594746|gb|EFB99730.1| succinyl-CoA ligase [ADP-forming] subunit alpha [Staphylococcus
           aureus A9765]
 gi|282764731|gb|EFC04856.1| succinyl-CoA ligase [ADP-forming] subunit alpha [Staphylococcus
           aureus A8117]
 gi|285816928|gb|ADC37415.1| Succinyl-CoA ligase [ADP-forming] alpha chain [Staphylococcus
           aureus 04-02981]
 gi|294825041|gb|EFG41463.1| succinyl-CoA ligase subunit alpha [Staphylococcus aureus A9754]
 gi|294968769|gb|EFG44791.1| succinyl-CoA ligase subunit alpha [Staphylococcus aureus A8819]
 gi|297178439|gb|EFH37685.1| succinyl-CoA ligase subunit alpha [Staphylococcus aureus A8796]
 gi|298694539|gb|ADI97761.1| succinyl-CoA synthetase alpha chain [Staphylococcus aureus subsp.
           aureus ED133]
 gi|312829640|emb|CBX34482.1| succinyl-CoA ligase [Staphylococcus aureus subsp. aureus ECT-R 2]
 gi|315131040|gb|EFT87024.1| succinyl-CoA synthetase subunit alpha [Staphylococcus aureus subsp.
           aureus CGS03]
 gi|315198486|gb|EFU28815.1| succinyl-CoA synthetase subunit alpha [Staphylococcus aureus subsp.
           aureus CGS01]
 gi|320140938|gb|EFW32785.1| succinyl-CoA synthetase subunit alpha [Staphylococcus aureus subsp.
           aureus MRSA131]
 gi|320144347|gb|EFW36113.1| succinyl-CoA synthetase subunit alpha [Staphylococcus aureus subsp.
           aureus MRSA177]
 gi|323441024|gb|EGA98731.1| succinyl-CoA synthetase subunit alpha [Staphylococcus aureus O11]
 gi|323443892|gb|EGB01503.1| succinyl-CoA synthetase subunit alpha [Staphylococcus aureus O46]
 gi|329727104|gb|EGG63560.1| succinyl-CoA synthetase, alpha subunit [Staphylococcus aureus
           subsp. aureus 21172]
 gi|329727821|gb|EGG64272.1| succinyl-CoA synthetase, alpha subunit [Staphylococcus aureus
           subsp. aureus 21189]
 gi|329733612|gb|EGG69940.1| succinyl-CoA synthetase, alpha subunit [Staphylococcus aureus
           subsp. aureus 21193]
          Length = 302

 Score =  334 bits (857), Expect = 7e-90,   Method: Composition-based stats.
 Identities = 168/296 (56%), Positives = 221/296 (74%), Gaps = 9/296 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+ +DKNTKV+VQG+TG    FHT+Q + Y  T++V G+ P KG     G    VPVF 
Sbjct: 1   MSVFIDKNTKVMVQGITGSTALFHTKQMLDY-GTKIVAGVTPGKGGQVVEG----VPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EAK  T A  SVIYVP   A D+I+E+ +A++ +++CITE IPVLDMV+VK  L+  
Sbjct: 56  TVEEAKNETGATVSVIYVPAPFAADSILEAADADLDMVICITEHIPVLDMVKVKRYLQGR 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            +RL+GPNCPG++T D CKIGIMPG I +KG VG++SRSGTLTYEAV Q ++EG+GQ+TA
Sbjct: 116 KTRLVGPNCPGVITADECKIGIMPGYIHKKGHVGVVSRSGTLTYEAVHQLTEEGIGQTTA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPV GT FIDVL+ F  D+ T+++VM+GEIGG+AEEEAA+++K        KP+V
Sbjct: 176 VGIGGDPVNGTNFIDVLKAFNEDDETKAVVMIGEIGGTAEEEAAEWIKANM----TKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVEL 296
           GF+ G+TAPPG+ MGHAGA+ISGGKG AE+KI  +   G+  A +P+ IG +L+E 
Sbjct: 232 GFIGGQTAPPGKRMGHAGAIISGGKGTAEEKIKTLNSCGVKTAATPSEIGSTLIEA 287


>gi|85374425|ref|YP_458487.1| succinyl-CoA synthetase, alpha subunit [Erythrobacter litoralis
           HTCC2594]
 gi|84787508|gb|ABC63690.1| succinyl-CoA synthetase, alpha subunit [Erythrobacter litoralis
           HTCC2594]
          Length = 296

 Score =  334 bits (857), Expect = 7e-90,   Method: Composition-based stats.
 Identities = 203/300 (67%), Positives = 243/300 (81%), Gaps = 5/300 (1%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSILV+K+TKV+ QG+TG  GTFHT+QA+ Y  TQ+V G+ P KG T   G    +P F 
Sbjct: 1   MSILVNKDTKVITQGMTGNTGTFHTQQALDY-GTQMVAGVTPGKGGTEHIG----LPQFD 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EAK+ T A AS IYVPP  A DAI E+I+A I LI+CITEGIPVLDMVR K  L+ S
Sbjct: 56  TVREAKDATGATASCIYVPPPFAADAICEAIDAGIELIICITEGIPVLDMVRAKRALQGS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
           +SRLIGPNCPG+LTPD CKIGIMPGSIF+KGSVG++SRSGTLTYEAV QT+  GLGQSTA
Sbjct: 116 NSRLIGPNCPGVLTPDECKIGIMPGSIFKKGSVGVVSRSGTLTYEAVHQTTMVGLGQSTA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPV GT FIDVL+LFL D  T+S++M+GEIGGSAEEEAA FLK EA +GR KP V
Sbjct: 176 VGIGGDPVNGTNFIDVLDLFLDDPETKSMIMIGEIGGSAEEEAAAFLKAEAAKGRSKPTV 235

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGSL 300
           GF+AG+TAPPGR MGHAGA++SGGKGGA+DKI AM++AGI ++PSP+ +G +L  +L  +
Sbjct: 236 GFIAGRTAPPGRRMGHAGAIVSGGKGGADDKIAAMEDAGIRVSPSPSELGTTLDAMLKEM 295


>gi|229596684|ref|XP_001007751.3| succinyl-CoA synthetase, alpha subunit family protein [Tetrahymena
           thermophila]
 gi|225565165|gb|EAR87506.3| succinyl-CoA synthetase, alpha subunit family protein [Tetrahymena
           thermophila SB210]
          Length = 310

 Score =  334 bits (857), Expect = 8e-90,   Method: Composition-based stats.
 Identities = 168/297 (56%), Positives = 218/297 (73%), Gaps = 8/297 (2%)

Query: 3   ILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFTTV 62
           + ++K+TKV+ QG+TG  GT HT+QA+ Y  T++VGG++P K      G    +PVF   
Sbjct: 17  VWINKHTKVICQGITGNQGTLHTQQALEY-GTKMVGGVNPAKAGQTHLG----LPVFKNC 71

Query: 63  AEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARL-EKSS 121
            EAK+ T  +ASVIYVPP  A  AI+E+IEAEIPL+V IT+GIP  DMV+VK  L ++  
Sbjct: 72  QEAKKVTGCDASVIYVPPPHAAKAIMEAIEAEIPLVVVITDGIPQHDMVKVKHALRQQKI 131

Query: 122 SRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTAV 181
           +R+IGPNCPGI+ P+ CKIGIMPG I + G +GI+SRSGTLTYEAV QT++ GLGQST V
Sbjct: 132 TRIIGPNCPGIIKPNECKIGIMPGYIHKPGKIGIVSRSGTLTYEAVDQTTKAGLGQSTVV 191

Query: 182 GIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIVG 241
           GIGGDP  GT FIDVLE F+ D  TE I+++GEIGG AEE+AA +LK   K    KP+V 
Sbjct: 192 GIGGDPFNGTNFIDVLERFVEDPETEGILLIGEIGGEAEEQAAAWLKANNK--TNKPVVS 249

Query: 242 FVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           F+AG TAPP R MGHAGA++SGGKG A +KI A++ AGI +  SPA +G+ ++ L+ 
Sbjct: 250 FIAGVTAPPERRMGHAGAIVSGGKGSATEKIKALESAGIKVCRSPATLGQEMLNLMK 306


>gi|308068643|ref|YP_003870248.1| succinyl-CoA synthetase subunit alpha (SCS-alpha) [Paenibacillus
           polymyxa E681]
 gi|305857922|gb|ADM69710.1| Succinyl-CoA synthetase alpha chain (SCS-alpha) [Paenibacillus
           polymyxa E681]
          Length = 309

 Score =  334 bits (857), Expect = 8e-90,   Method: Composition-based stats.
 Identities = 176/304 (57%), Positives = 230/304 (75%), Gaps = 10/304 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWT-----GGNVN 55
           MSILVDK+TKV+ QG+TGK   FH + A+ Y  TQ+VGG  P KG T        G  V 
Sbjct: 1   MSILVDKHTKVITQGITGKTALFHAKGALDY-GTQMVGGTSPGKGGTEVEITLENGQQVK 59

Query: 56  VPVFTTVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKA 115
           +PVF TV+EAKE T A ASVIYVPP+ A D+I+E+++AE+ L++CITEGIPVLDM+RVK 
Sbjct: 60  LPVFNTVSEAKEATGATASVIYVPPAFAADSILEAVDAELDLVICITEGIPVLDMIRVKR 119

Query: 116 RLEKSSSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGL 175
            +E   + LIGPNCPG++TP  CKIGIMPG I   G VG++SRSGTLTYEAV Q +  G+
Sbjct: 120 FMEGKKTVLIGPNCPGVITPGECKIGIMPGYIHLPGHVGVVSRSGTLTYEAVHQLTTRGI 179

Query: 176 GQSTAVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGR 235
           GQS+AVGIGGDPVKG+EFID+L+ F  D  T +++M+GEIGG+AEEEAA++++D      
Sbjct: 180 GQSSAVGIGGDPVKGSEFIDILQRFNEDPNTHAVIMIGEIGGTAEEEAAEWIRDNM---- 235

Query: 236 KKPIVGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVE 295
            KP+VGF+ G TAPPG+ MGHAGA+ISGGKG A++KI  ++  GI +AP+P+ +G +LV 
Sbjct: 236 TKPVVGFIGGVTAPPGKRMGHAGAIISGGKGTAKEKIATLEACGIKVAPTPSEMGSTLVS 295

Query: 296 LLGS 299
           +L +
Sbjct: 296 VLEA 299


>gi|73662829|ref|YP_301610.1| succinyl-CoA synthetase subunit alpha [Staphylococcus saprophyticus
           subsp. saprophyticus ATCC 15305]
 gi|72495344|dbj|BAE18665.1| succinyl-CoA synthetase alpha subunit [Staphylococcus saprophyticus
           subsp. saprophyticus ATCC 15305]
          Length = 301

 Score =  334 bits (857), Expect = 9e-90,   Method: Composition-based stats.
 Identities = 171/296 (57%), Positives = 220/296 (74%), Gaps = 9/296 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+ +DKNTKV+VQG+TG    FHT+Q + Y  TQ+V G+ P KG     G    VPVF 
Sbjct: 1   MSVFIDKNTKVIVQGITGSTALFHTKQMLEY-GTQIVAGVTPGKGGQVVEG----VPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA++ T A  SVIYVP   A DAI+E IEAE+ L +CITE IPV+DMV+VK   E  
Sbjct: 56  TVEEAQKETGATVSVIYVPAPFAADAILECIEAELDLAICITEHIPVIDMVKVKRYSEGK 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            +R++GPNCPG++T D CKIGIMPG I +KG VG++SRSGTLTYEAV Q ++EG+GQ+TA
Sbjct: 116 KTRIVGPNCPGVITADECKIGIMPGYIHKKGHVGVVSRSGTLTYEAVHQLTEEGIGQTTA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPV GT FIDVL+ F  D+ T+++VM+GEIGG+AEEEAA+++K        KP+V
Sbjct: 176 VGIGGDPVNGTNFIDVLKAFNEDDETKAVVMIGEIGGTAEEEAAEWIKANM----TKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVEL 296
           GFV G+TAPPG+ MGHAGA+ISGGKG AE+KI  +   G+  A +P+ IG +L++ 
Sbjct: 232 GFVGGQTAPPGKRMGHAGAIISGGKGTAEEKIKTLNSCGVKTADTPSEIGTTLIDA 287


>gi|172057899|ref|YP_001814359.1| succinyl-CoA synthetase subunit alpha [Exiguobacterium sibiricum
           255-15]
 gi|171990420|gb|ACB61342.1| succinyl-CoA synthetase, alpha subunit [Exiguobacterium sibiricum
           255-15]
          Length = 304

 Score =  334 bits (857), Expect = 9e-90,   Method: Composition-based stats.
 Identities = 172/299 (57%), Positives = 222/299 (74%), Gaps = 9/299 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSI V+++TKV++QG+TG  G FH EQ I Y  T +VGG+ P KG T   G    VPVF 
Sbjct: 1   MSIWVNESTKVIIQGITGNQGMFHGEQMIDY-GTNLVGGVTPGKGGTEVLG----VPVFD 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TVA+A E+T ANAS+IYVPP+ A DAI+E+ +A I LI+CITEGIPVLDMV+VK  L+  
Sbjct: 56  TVAQAVEKTGANASIIYVPPAFAADAIMEAADANIALIICITEGIPVLDMVKVKRYLDGK 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             RLIGPNCPG++TP   K+GIMPG I   G VGI+SRSGTLTYEAV Q +  G+GQSTA
Sbjct: 116 PVRLIGPNCPGVITPGVAKLGIMPGYIHTPGHVGIVSRSGTLTYEAVHQLTTAGIGQSTA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPV GT+FID L+ F  D  T++++M+GEIGG+AEEEAA+++K        KP++
Sbjct: 176 VGIGGDPVNGTDFIDTLKAFNEDPETKAVIMLGEIGGTAEEEAAEWVKANM----TKPVI 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
           GF+ G+TAP G+ MGHAGA+ISGGKG A +KI  ++  GI +A +PA IG +L+ ++  
Sbjct: 232 GFIGGQTAPEGKRMGHAGAIISGGKGTAAEKIKTLRANGIEVAETPAIIGETLIRVIKE 290


>gi|251797455|ref|YP_003012186.1| succinyl-CoA synthetase, subunit alpha [Paenibacillus sp. JDR-2]
 gi|247545081|gb|ACT02100.1| succinyl-CoA synthetase, alpha subunit [Paenibacillus sp. JDR-2]
          Length = 313

 Score =  334 bits (857), Expect = 9e-90,   Method: Composition-based stats.
 Identities = 175/304 (57%), Positives = 227/304 (74%), Gaps = 10/304 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWT-----GGNVN 55
           MSILV+K+TKV+ QG+TG  G FH + A+ Y  TQ+VGG+ P KG T        G  V+
Sbjct: 1   MSILVNKDTKVITQGITGATGLFHAKGALDY-GTQMVGGVTPGKGGTNVDITLENGNVVS 59

Query: 56  VPVFTTVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKA 115
           +PVF TV +A   T A ASVIYVPP+ A D+I+E+++A + L++CITEGIPVLDMV+VK 
Sbjct: 60  LPVFNTVEQAVAATGATASVIYVPPAFAADSIMEAVDAGLDLVICITEGIPVLDMVKVKR 119

Query: 116 RLEKSSSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGL 175
            +E S + LIGPNCPG++TP  CKIGIMPG I  KG VG++SRSGTLTYEAV Q S  G+
Sbjct: 120 YMEGSKTTLIGPNCPGVITPGECKIGIMPGYIHTKGHVGVVSRSGTLTYEAVHQLSTRGI 179

Query: 176 GQSTAVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGR 235
           GQS+AVGIGGDPVKG+EFID+L  F  D  T +++M+GEIGG+AEEEAA+++K       
Sbjct: 180 GQSSAVGIGGDPVKGSEFIDILSRFNEDPDTYAVIMIGEIGGTAEEEAAEWIKANM---- 235

Query: 236 KKPIVGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVE 295
           KKP+VGF+ G TAPPG+ MGHAGA+ISGGKG A +KI  ++  GI +AP+P+ +G +LV 
Sbjct: 236 KKPVVGFIGGATAPPGKRMGHAGAIISGGKGTAAEKIATLEACGIKVAPTPSDMGSTLVS 295

Query: 296 LLGS 299
           +L  
Sbjct: 296 VLEE 299


>gi|304394257|ref|ZP_07376180.1| succinyl-CoA ligase, alpha subunit [Ahrensia sp. R2A130]
 gi|303293697|gb|EFL88074.1| succinyl-CoA ligase, alpha subunit [Ahrensia sp. R2A130]
          Length = 300

 Score =  334 bits (856), Expect = 9e-90,   Method: Composition-based stats.
 Identities = 220/299 (73%), Positives = 259/299 (86%), Gaps = 1/299 (0%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWT-GGNVNVPVF 59
           MSIL+DKNTK++VQGLTGK GTFHTEQA+ Y  TQ+V G HPKKG T W       +P+F
Sbjct: 1   MSILIDKNTKIIVQGLTGKTGTFHTEQALAYHGTQMVAGTHPKKGGTDWESADGAKLPIF 60

Query: 60  TTVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEK 119
           TTVA+AKE+T ANASVIYVPP+G   AI E+I+AEIPLIV ITEG+PVLDMVRVK +L+K
Sbjct: 61  TTVADAKEKTGANASVIYVPPAGCAAAIEEAIDAEIPLIVAITEGVPVLDMVRVKEKLDK 120

Query: 120 SSSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQST 179
           S SRLIGPNCPG++TPD CKIGIMPGSIF+ G+VGI+SRSGTLTYEAVFQT+  GLGQ+T
Sbjct: 121 SKSRLIGPNCPGVMTPDECKIGIMPGSIFKDGNVGIVSRSGTLTYEAVFQTTNAGLGQTT 180

Query: 180 AVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPI 239
           AVGIGGDPVKGTEFID+LE+FLADE T+SI+M+GEIGGSAEE+AAQFL DEAK+GR KP 
Sbjct: 181 AVGIGGDPVKGTEFIDMLEMFLADEETKSIIMIGEIGGSAEEDAAQFLADEAKKGRMKPT 240

Query: 240 VGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           VGF+AG TAPPGRTMGHAGAV+SGGKG A  KI AM+ AGI ++PSPA++G +L++LL 
Sbjct: 241 VGFIAGVTAPPGRTMGHAGAVVSGGKGDAPSKIAAMEAAGIRVSPSPAKLGETLLDLLK 299


>gi|261856575|ref|YP_003263858.1| succinyl-CoA synthetase, subunit alpha [Halothiobacillus
           neapolitanus c2]
 gi|261837044|gb|ACX96811.1| succinyl-CoA synthetase, alpha subunit [Halothiobacillus
           neapolitanus c2]
          Length = 295

 Score =  334 bits (856), Expect = 1e-89,   Method: Composition-based stats.
 Identities = 177/301 (58%), Positives = 219/301 (72%), Gaps = 11/301 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL++K T+V+ QG TGK GTFH+EQAI Y  T  VGG+ P KG        ++ PVF 
Sbjct: 1   MSILINKQTRVICQGFTGKQGTFHSEQAIAY-GTNFVGGVTPGKGGQSH----LDRPVFD 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARL--E 118
           TV +A ++TAA AS+IYVP   A DAI+E+ +A I +I CITEGIPVLDM+ VKA L  +
Sbjct: 56  TVHDAVQQTAATASMIYVPAPFAADAILEAADAGIEVIACITEGIPVLDMLNVKAVLASD 115

Query: 119 KSSSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQS 178
               RLIGPNCPG++TP  CKIGIMPGSI   G +GI+SRSGTLTYEAV QT+  GLGQS
Sbjct: 116 YPDVRLIGPNCPGLITPGECKIGIMPGSIHLPGRIGIVSRSGTLTYEAVAQTTAAGLGQS 175

Query: 179 TAVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKP 238
           T VGIGGDP+ G +FID L LF  D  TE+++MVGEIGG+AEEEAA F+K+       KP
Sbjct: 176 TCVGIGGDPIHGMDFIDCLALFADDPQTEAVIMVGEIGGNAEEEAAHFIKE----QFNKP 231

Query: 239 IVGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           +V ++AG TAP G+ MGHAGAVI+GG+G AEDK  A+K AG+ I   P  +GR++  LLG
Sbjct: 232 VVAYIAGATAPTGKRMGHAGAVIAGGRGSAEDKFRALKAAGVHIVRDPTTMGRTMANLLG 291

Query: 299 S 299
           S
Sbjct: 292 S 292


>gi|144898024|emb|CAM74888.1| Succinyl-CoA synthetase alpha chain [Magnetospirillum
           gryphiswaldense MSR-1]
          Length = 291

 Score =  334 bits (856), Expect = 1e-89,   Method: Composition-based stats.
 Identities = 179/298 (60%), Positives = 227/298 (76%), Gaps = 8/298 (2%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           M++LV+ NTKV+ QG TG  GTFH+EQAI Y  T++VGG+ P KG +      +++PVF 
Sbjct: 1   MAVLVNANTKVICQGFTGAQGTFHSEQAIAY-GTKMVGGVTPGKGGSKH----LDLPVFD 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TVAEAK +T  NASVIYVPP  A DAI+E+I+AEI L VCITEGIPV DM+ VK  L  S
Sbjct: 56  TVAEAKAKTGCNASVIYVPPPFAADAILEAIDAEIELAVCITEGIPVADMLTVKRALVGS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            +RLIGPNCPG++TP  CKIGIMPG I ++G VGI+SRSGTLTYEAV QT+  GLGQ+T 
Sbjct: 116 KTRLIGPNCPGVITPGECKIGIMPGHIHQRGKVGIVSRSGTLTYEAVAQTTAAGLGQTTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           +GIGGDP+ GT F+D L++FL D  TE+I+M+GEIGG AE + A+ L+       KKP V
Sbjct: 176 IGIGGDPINGTNFVDSLQMFLDDPETEAIIMIGEIGGDAEVQGAELLRS---SKIKKPTV 232

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           GF+AG+TAPPGR MGHAGAVISGG   A+ KI+AM+ AGI +A SPA +G +++++L 
Sbjct: 233 GFIAGRTAPPGRRMGHAGAVISGGNDTADFKIDAMRSAGIAVADSPASLGSTMLKVLK 290


>gi|226491860|ref|NP_001149702.1| succinyl-CoA ligase alpha-chain 2 [Zea mays]
 gi|195629598|gb|ACG36440.1| succinyl-CoA ligase alpha-chain 2 [Zea mays]
          Length = 331

 Score =  334 bits (856), Expect = 1e-89,   Method: Composition-based stats.
 Identities = 181/298 (60%), Positives = 228/298 (76%), Gaps = 9/298 (3%)

Query: 2   SILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFTT 61
           ++ VDK+T+V+ QG+TGK GTFHTEQAI Y  T +VGG+ PKKG T   G    +PVF +
Sbjct: 36  AVFVDKSTRVICQGITGKNGTFHTEQAIEY-GTNMVGGVTPKKGGTEHLG----LPVFNS 90

Query: 62  VAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLE-KS 120
           VAEAK  T ANA+VIYVPP  A  AI+E++EAE+ L VCITEGIP  DMV+VKA L  +S
Sbjct: 91  VAEAKAETKANATVIYVPPPFAAAAIMEAMEAELDLAVCITEGIPQHDMVKVKAALNSQS 150

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            +RLIGPNCPGI+ P  CKIGIMPG I + G +GI+SRSGTLTYEAVFQT+  GLGQST 
Sbjct: 151 KTRLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTC 210

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP  GT F+D LE F+ D  TE IV++GEIGG+AEE+AA F+++      +KP+V
Sbjct: 211 VGIGGDPFNGTNFVDCLEKFVNDPQTEGIVLIGEIGGTAEEDAATFIQE---SKTQKPVV 267

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            F+AG TAPPGR MGHAGA+++GGKG A+DKI A++EAG+ +  SPA+IG ++ E+  
Sbjct: 268 AFIAGLTAPPGRRMGHAGAIVAGGKGTAQDKIKALREAGVTVVESPAKIGSTMFEIFK 325


>gi|224083892|ref|XP_002307162.1| predicted protein [Populus trichocarpa]
 gi|222856611|gb|EEE94158.1| predicted protein [Populus trichocarpa]
          Length = 298

 Score =  334 bits (856), Expect = 1e-89,   Method: Composition-based stats.
 Identities = 182/299 (60%), Positives = 232/299 (77%), Gaps = 9/299 (3%)

Query: 2   SILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFTT 61
           ++ VDKNT+V+ QG+TGK GTFHTEQAI Y  T++VGG+ PKKG T   G    +PVF +
Sbjct: 3   AVFVDKNTRVICQGITGKNGTFHTEQAIEY-GTKMVGGVTPKKGGTEHLG----LPVFNS 57

Query: 62  VAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEK-S 120
           V+EAK  T ANASVIYVPP  A  AI+E++EAE+ L+VCITEGIP  DMVRVKA ++K +
Sbjct: 58  VSEAKAETKANASVIYVPPPFAAAAILEAVEAELDLVVCITEGIPQHDMVRVKAAIKKQT 117

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            +RLIGPNCPGI+ P  CKIGIMPG I + G VGI+SRSGTLTYEAVFQT+  GLGQST 
Sbjct: 118 KTRLIGPNCPGIIKPGECKIGIMPGYIHKPGRVGIVSRSGTLTYEAVFQTTAVGLGQSTC 177

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP  GT F+D ++ FLAD  TE IV++GEIGG+AEE+AA  +K+    G +KP+V
Sbjct: 178 VGIGGDPFNGTNFVDCVKKFLADPQTEGIVLIGEIGGTAEEDAATLIKE---SGTEKPVV 234

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
            F+AG TAPPGR MGHAGA++SGGKG A+DKI  +++AG+ +  SPA+IG +++++   
Sbjct: 235 AFIAGVTAPPGRRMGHAGAIVSGGKGTAQDKIKTLRDAGVIVVESPAKIGTAMLDVFKE 293


>gi|268581731|ref|XP_002645849.1| Hypothetical protein CBG07585 [Caenorhabditis briggsae]
          Length = 344

 Score =  334 bits (856), Expect = 1e-89,   Method: Composition-based stats.
 Identities = 178/294 (60%), Positives = 223/294 (75%), Gaps = 6/294 (2%)

Query: 5   VDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFTTVAE 64
           ++K+TKV+VQG TGK GTFH +Q I Y  T VVGG++  K  T   G    +PVF  V E
Sbjct: 52  INKDTKVIVQGFTGKQGTFHGKQMIDYK-TNVVGGVNANKAGTQHLG----LPVFKNVTE 106

Query: 65  AKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVK-ARLEKSSSR 123
           A+ +T A+ASVIYVP S A +AI E+++AEIPL+VCITEGIP  DMVRVK   L+++ +R
Sbjct: 107 ARNKTGADASVIYVPASAAANAIEEAMDAEIPLVVCITEGIPQHDMVRVKSRLLKQNKTR 166

Query: 124 LIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTAVGI 183
           L+GPNCPGI++ D CKIGIMPG I ++G +GI+SRSGTLTYEAV QT+Q G GQ+  VGI
Sbjct: 167 LVGPNCPGIISADQCKIGIMPGHIHKRGCIGIVSRSGTLTYEAVHQTTQVGFGQTLCVGI 226

Query: 184 GGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIVGFV 243
           GGDP  GT FID L +FL D  T+ I+++GEIGGSAEEEAAQFLKD      KKP+V F+
Sbjct: 227 GGDPFNGTNFIDCLHVFLEDPETKGIILIGEIGGSAEEEAAQFLKDHNTGVNKKPVVSFI 286

Query: 244 AGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELL 297
           AG TAPPGR MGHAGA+ISGGKG A DKINA++EAG+ +  SPA++G S+ +  
Sbjct: 287 AGVTAPPGRRMGHAGAIISGGKGTAADKINALREAGVVVTDSPAKLGTSMAKAF 340


>gi|326437952|gb|EGD83522.1| succinyl-CoA ligase subunit alpha [Salpingoeca sp. ATCC 50818]
          Length = 322

 Score =  334 bits (856), Expect = 1e-89,   Method: Composition-based stats.
 Identities = 175/298 (58%), Positives = 225/298 (75%), Gaps = 6/298 (2%)

Query: 3   ILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFTTV 62
           +L++K+TKV+ QG TG+ GTFH+E AI Y  T++VGG+ PKK      G    +PVF +V
Sbjct: 28  LLINKDTKVICQGFTGRQGTFHSEAAIEY-GTRMVGGVSPKKAGQEHLG----LPVFGSV 82

Query: 63  AEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRV-KARLEKSS 121
            EAK  T A+A+V+YVPP GA  A++E++EAE+PLIVCITEGIP  DMVRV  A L++  
Sbjct: 83  EEAKRETNADATVVYVPPPGAAAAVLEAMEAEVPLIVCITEGIPQQDMVRVKHALLQQDK 142

Query: 122 SRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTAV 181
           SRL+GPNCPGI+ P  CKIGIMPG I   G++G++SRSGTLTYEAV QT+  GLGQS  V
Sbjct: 143 SRLVGPNCPGIIKPGECKIGIMPGHIHTPGNIGVVSRSGTLTYEAVGQTTTVGLGQSLCV 202

Query: 182 GIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIVG 241
           GIGGDP  GT+FID L++FL D  T  I+M+GEIGGSAEEEAA+FLK       +KP+V 
Sbjct: 203 GIGGDPFNGTDFIDCLDVFLKDPDTHGIIMIGEIGGSAEEEAAEFLKQNNSGPNRKPVVS 262

Query: 242 FVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
           F+AG TAPPGR MGHAGA+ISGGKGGA +KI A+++AG+ +A SPA++G  + + +  
Sbjct: 263 FIAGLTAPPGRRMGHAGAIISGGKGGAAEKIAALEDAGVIVAKSPAQMGTLMKQAMED 320


>gi|21282858|ref|NP_645946.1| succinyl-CoA synthetase subunit alpha [Staphylococcus aureus subsp.
           aureus MW2]
 gi|49486085|ref|YP_043306.1| succinyl-CoA synthetase subunit alpha [Staphylococcus aureus subsp.
           aureus MSSA476]
 gi|253731865|ref|ZP_04866030.1| succinyl-CoA synthetase subunit alpha [Staphylococcus aureus subsp.
           aureus USA300_TCH959]
 gi|253733516|ref|ZP_04867681.1| succinyl-CoA synthetase subunit alpha [Staphylococcus aureus subsp.
           aureus TCH130]
 gi|282916496|ref|ZP_06324258.1| succinyl-CoA ligase [ADP-forming] subunit alpha [Staphylococcus
           aureus subsp. aureus D139]
 gi|297208108|ref|ZP_06924539.1| succinate--CoA ligase (ADP-forming) alpha subunit [Staphylococcus
           aureus subsp. aureus ATCC 51811]
 gi|300912189|ref|ZP_07129632.1| succinate--CoA ligase (ADP-forming) alpha subunit [Staphylococcus
           aureus subsp. aureus TCH70]
 gi|38605353|sp|Q8NX01|SUCD_STAAW RecName: Full=Succinyl-CoA ligase [ADP-forming] subunit alpha;
           AltName: Full=Succinyl-CoA synthetase subunit alpha;
           Short=SCS-alpha
 gi|81649421|sp|Q6G9W7|SUCD_STAAS RecName: Full=Succinyl-CoA ligase [ADP-forming] subunit alpha;
           AltName: Full=Succinyl-CoA synthetase subunit alpha;
           Short=SCS-alpha
 gi|21204297|dbj|BAB94994.1| succinyl-CoA synthetase [Staphylococcus aureus subsp. aureus MW2]
 gi|49244528|emb|CAG42957.1| putative succinyl-CoA ligase [Staphylococcus aureus subsp. aureus
           MSSA476]
 gi|253724275|gb|EES93004.1| succinyl-CoA synthetase subunit alpha [Staphylococcus aureus subsp.
           aureus USA300_TCH959]
 gi|253728570|gb|EES97299.1| succinyl-CoA synthetase subunit alpha [Staphylococcus aureus subsp.
           aureus TCH130]
 gi|282319936|gb|EFB50284.1| succinyl-CoA ligase [ADP-forming] subunit alpha [Staphylococcus
           aureus subsp. aureus D139]
 gi|296887351|gb|EFH26253.1| succinate--CoA ligase (ADP-forming) alpha subunit [Staphylococcus
           aureus subsp. aureus ATCC 51811]
 gi|300886435|gb|EFK81637.1| succinate--CoA ligase (ADP-forming) alpha subunit [Staphylococcus
           aureus subsp. aureus TCH70]
          Length = 302

 Score =  334 bits (856), Expect = 1e-89,   Method: Composition-based stats.
 Identities = 168/296 (56%), Positives = 221/296 (74%), Gaps = 9/296 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+ +DKNTKV+VQG+TG    FHT+Q + Y  T++V G+ P KG     G    VPVF 
Sbjct: 1   MSVFIDKNTKVMVQGITGSTALFHTKQMLDY-GTKIVAGVTPGKGGQVVEG----VPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EAK  T A  SVIYVP   A D+I+E+ +A++ +++CITE IPVLDMV+VK  L+  
Sbjct: 56  TVEEAKNETGATVSVIYVPAPFAADSILEAADADLDMVICITEHIPVLDMVKVKRYLQGR 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            +RL+GPNCPG++T D CKIGIMPG I +KG VG++SRSGTLTYEAV Q ++EG+GQ+TA
Sbjct: 116 KTRLVGPNCPGVITADECKIGIMPGYIHKKGHVGVVSRSGTLTYEAVHQLTEEGIGQTTA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPV GT FIDVL+ F  D+ T+++VM+GEIGG+AEEEAA+++K        KP+V
Sbjct: 176 VGIGGDPVNGTNFIDVLKAFNEDDETKAVVMIGEIGGTAEEEAAEWIKANM----TKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVEL 296
           GF+ G+TAPPG+ MGHAGA+ISGGKG AE+KI  +   G+  A +P+ IG +L+E 
Sbjct: 232 GFIGGQTAPPGKRMGHAGAIISGGKGTAEEKIKTLNSCGVKTAATPSEIGSTLIEA 287


>gi|330720907|gb|EGG99089.1| Succinyl-CoA ligase [ADP-forming] alpha chain [gamma
           proteobacterium IMCC2047]
          Length = 291

 Score =  334 bits (856), Expect = 1e-89,   Method: Composition-based stats.
 Identities = 172/298 (57%), Positives = 216/298 (72%), Gaps = 9/298 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSIL+DKNTKV+ QGLTG  G+FHTEQA+  C TQVV G+ P KG     G    +PVF 
Sbjct: 1   MSILIDKNTKVICQGLTGAQGSFHTEQALA-CGTQVVAGVVPGKGGQTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           +V EAKE T A ASV+YVP +   D+I+E+  A I LIVCITEGIP LDM+ VK + ++ 
Sbjct: 56  SVKEAKEVTGATASVLYVPAAFCKDSILEAANAGIELIVCITEGIPTLDMLYVKEKCDQL 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
             RL+GPNCPG++TP  CKIGIMP SI   G VG++SRSGTLTYEAV QT+  G GQST 
Sbjct: 116 GVRLVGPNCPGVITPGECKIGIMPASIHLPGKVGVVSRSGTLTYEAVKQTTDYGFGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDP+ G+ FID+L LF AD  TE+IVM+GEIGG+AEEEAA +++D       KP+V
Sbjct: 176 VGIGGDPIPGSHFIDILALFEADPKTEAIVMIGEIGGTAEEEAAAYIRDH----VSKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
            ++AG  AP G+ MGHAGA+I+GGKG A++K  A++ AG+    S A IG +L E+ G
Sbjct: 232 SYIAGVAAPAGKRMGHAGAIIAGGKGTADEKFAALEAAGVKTVRSLACIGEALAEITG 289


>gi|196015167|ref|XP_002117441.1| hypothetical protein TRIADDRAFT_61514 [Trichoplax adhaerens]
 gi|190579970|gb|EDV20057.1| hypothetical protein TRIADDRAFT_61514 [Trichoplax adhaerens]
          Length = 327

 Score =  334 bits (856), Expect = 1e-89,   Method: Composition-based stats.
 Identities = 173/298 (58%), Positives = 214/298 (71%), Gaps = 6/298 (2%)

Query: 3   ILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFTTV 62
           I++ K T+V+ QG TG+ GTFH+EQAI Y  T +VGG+ P KG     G    +PVF +V
Sbjct: 31  IMIGKETRVICQGFTGRQGTFHSEQAIAY-GTNMVGGVSPGKGGKTHLG----LPVFNSV 85

Query: 63  AEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRV-KARLEKSS 121
            EA + T A A+VIYVPP GA  AI E+++A I LIVCITEGIP  DMV+V    L +  
Sbjct: 86  QEAVDSTGAEATVIYVPPQGAAAAIHEAVDAGIGLIVCITEGIPQQDMVKVKHKILRQDK 145

Query: 122 SRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTAV 181
           SRLIGPNCPGI+ P  CKIGIMP  I   G +GI+SRSGTLTYEAVFQT+  GLGQ+  V
Sbjct: 146 SRLIGPNCPGIIRPGHCKIGIMPAHIHLPGRIGIVSRSGTLTYEAVFQTTNVGLGQTLCV 205

Query: 182 GIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIVG 241
           GIGGDP  GT+FID L++FL D+ TE IV++GEIGG AEE+AA+FL         KP+V 
Sbjct: 206 GIGGDPFNGTDFIDCLDIFLKDDKTEGIVLIGEIGGEAEEKAAEFLAKHNSGPNAKPVVS 265

Query: 242 FVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
           F+AG TAPPGR MGHAGA+ISGGKGGAE+KI  ++ AG+ +  SPARIG ++ E +  
Sbjct: 266 FIAGITAPPGRRMGHAGAIISGGKGGAEEKIATLEGAGVVVTKSPARIGSTIKEAMQK 323


>gi|88608406|ref|YP_506144.1| succinyl-CoA synthetase, alpha subunit [Neorickettsia sennetsu str.
           Miyayama]
 gi|88600575|gb|ABD46043.1| succinyl-CoA synthetase, alpha subunit [Neorickettsia sennetsu str.
           Miyayama]
          Length = 290

 Score =  334 bits (856), Expect = 1e-89,   Method: Composition-based stats.
 Identities = 181/298 (60%), Positives = 224/298 (75%), Gaps = 8/298 (2%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           M+ILV+K T+V+ QG TG  GTFH+EQAI Y  T++VGG+ P KG     G    +PVF 
Sbjct: 1   MAILVNKETRVICQGFTGHQGTFHSEQAIEY-GTKMVGGVTPGKGGQMHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV  A++ T ANA+VIYVP   A DAI+E+I+AEI LIVCITEGIPV DM+RVK+ L  S
Sbjct: 56  TVYHARKETGANATVIYVPAPFAMDAILEAIDAEIELIVCITEGIPVQDMMRVKSALSNS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            S LIGPNCPGI+TP  CKIGIMPG I ++G +GI+SRSGTLTYEAV QT+Q GLGQST 
Sbjct: 116 KSLLIGPNCPGIITPGECKIGIMPGYIHKRGKIGIVSRSGTLTYEAVAQTTQMGLGQSTC 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           +G+GGDPVKG +F+D +++FL D  TE+I+M+GEIGGSAEE+A   LK       KKP V
Sbjct: 176 IGVGGDPVKGLDFVDCVKMFLDDPETEAIIMIGEIGGSAEEKACALLKSSQS---KKPTV 232

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           GF+AG TAPPGR MGHAGA+IS     AE KI  MK+AGI IA +PA IG+++ +L+ 
Sbjct: 233 GFIAGATAPPGRRMGHAGAIISSSDESAESKIKVMKDAGIVIAETPALIGKTVADLIA 290


>gi|257425300|ref|ZP_05601725.1| succinyl-CoA synthetase subunit alpha [Staphylococcus aureus subsp.
           aureus 55/2053]
 gi|257427960|ref|ZP_05604358.1| succinyl-CoA synthetase subunit alpha [Staphylococcus aureus subsp.
           aureus 65-1322]
 gi|257430593|ref|ZP_05606975.1| succinyl-CoA synthetase subunit alpha [Staphylococcus aureus subsp.
           aureus 68-397]
 gi|257433354|ref|ZP_05609712.1| succinyl-CoA synthetase subunit alpha [Staphylococcus aureus subsp.
           aureus E1410]
 gi|257436196|ref|ZP_05612243.1| succinyl-CoA synthetase subunit alpha [Staphylococcus aureus subsp.
           aureus M876]
 gi|282914023|ref|ZP_06321810.1| succinyl-CoA synthase, alpha subunit [Staphylococcus aureus subsp.
           aureus M899]
 gi|282924068|ref|ZP_06331744.1| succinyl-CoA ligase [ADP-forming] subunit alpha [Staphylococcus
           aureus subsp. aureus C101]
 gi|293501054|ref|ZP_06666905.1| succinyl-CoA ligase [ADP-forming] subunit alpha [Staphylococcus
           aureus subsp. aureus 58-424]
 gi|293510016|ref|ZP_06668724.1| succinyl-CoA ligase [ADP-forming] subunit alpha [Staphylococcus
           aureus subsp. aureus M809]
 gi|293526603|ref|ZP_06671288.1| succinyl-CoA synthase, alpha subunit [Staphylococcus aureus subsp.
           aureus M1015]
 gi|257271757|gb|EEV03895.1| succinyl-CoA synthetase subunit alpha [Staphylococcus aureus subsp.
           aureus 55/2053]
 gi|257274801|gb|EEV06288.1| succinyl-CoA synthetase subunit alpha [Staphylococcus aureus subsp.
           aureus 65-1322]
 gi|257278721|gb|EEV09340.1| succinyl-CoA synthetase subunit alpha [Staphylococcus aureus subsp.
           aureus 68-397]
 gi|257281447|gb|EEV11584.1| succinyl-CoA synthetase subunit alpha [Staphylococcus aureus subsp.
           aureus E1410]
 gi|257284478|gb|EEV14598.1| succinyl-CoA synthetase subunit alpha [Staphylococcus aureus subsp.
           aureus M876]
 gi|282314040|gb|EFB44432.1| succinyl-CoA ligase [ADP-forming] subunit alpha [Staphylococcus
           aureus subsp. aureus C101]
 gi|282322091|gb|EFB52415.1| succinyl-CoA synthase, alpha subunit [Staphylococcus aureus subsp.
           aureus M899]
 gi|290920675|gb|EFD97738.1| succinyl-CoA synthase, alpha subunit [Staphylococcus aureus subsp.
           aureus M1015]
 gi|291096059|gb|EFE26320.1| succinyl-CoA ligase [ADP-forming] subunit alpha [Staphylococcus
           aureus subsp. aureus 58-424]
 gi|291466960|gb|EFF09478.1| succinyl-CoA ligase [ADP-forming] subunit alpha [Staphylococcus
           aureus subsp. aureus M809]
          Length = 302

 Score =  334 bits (856), Expect = 1e-89,   Method: Composition-based stats.
 Identities = 169/296 (57%), Positives = 221/296 (74%), Gaps = 9/296 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+ +DKNTKV+VQG+TG    FHT+Q + Y  T++V G+ P KG     G    VPVF 
Sbjct: 1   MSVFIDKNTKVMVQGITGSTALFHTKQMLDY-GTKIVAGVTPGKGGQVVEG----VPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EAK  T A  SVIYVP   A D+I+ES +A++ +++CITE IPVLDMV+VK  L+  
Sbjct: 56  TVEEAKNETGATVSVIYVPAPFAADSILESADADLDMVICITEHIPVLDMVKVKRYLQGR 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            +RL+GPNCPG++T D CKIGIMPG I +KG VG++SRSGTLTYEAV Q ++EG+GQ+TA
Sbjct: 116 KTRLVGPNCPGVITADECKIGIMPGYIHKKGHVGVVSRSGTLTYEAVHQLTEEGIGQTTA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPV GT FIDVL+ F  D+ T+++VM+GEIGG+AEEEAA+++K        KP+V
Sbjct: 176 VGIGGDPVNGTNFIDVLKAFNEDDETKAVVMIGEIGGTAEEEAAEWIKANM----TKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVEL 296
           GF+ G+TAPPG+ MGHAGA+ISGGKG AE+KI  +   G+  A +P+ IG +L+E 
Sbjct: 232 GFIGGQTAPPGKRMGHAGAIISGGKGTAEEKIKTLNSCGVKTAATPSEIGSTLIEA 287


>gi|23098999|ref|NP_692465.1| succinyl-CoA synthetase subunit alpha [Oceanobacillus iheyensis
           HTE831]
 gi|22777227|dbj|BAC13500.1| succinyl-CoA synthetase alpha subunit [Oceanobacillus iheyensis
           HTE831]
          Length = 300

 Score =  334 bits (856), Expect = 1e-89,   Method: Composition-based stats.
 Identities = 167/299 (55%), Positives = 223/299 (74%), Gaps = 9/299 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MS+ ++K+TKV+VQG+TG    FHT+Q + Y  T++V G+ PKKG T   G    VPV+ 
Sbjct: 1   MSVYINKDTKVIVQGITGGTARFHTKQMLEY-GTKIVAGVTPKKGGTEVEG----VPVYN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV +A + T A ASVIYVP   A DAI+E+ +AE+ L++CITE IPV+DMV+VK  +E  
Sbjct: 56  TVKDAVDATGATASVIYVPAPFAADAILEATDAELDLVICITEHIPVMDMVKVKRYMEGK 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            +RL+GPNCPG++T D  KIGIMPG I +KG +G++SRSGTLTYEAV Q S+ G GQ+TA
Sbjct: 116 KTRLVGPNCPGVITADETKIGIMPGYIHKKGHIGVVSRSGTLTYEAVHQLSEAGYGQTTA 175

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPV GT FIDVL+ F  D  TE+++M+GEIGG+AEEEAA+++K        KP+V
Sbjct: 176 VGIGGDPVNGTNFIDVLDAFNQDPETEAVIMIGEIGGTAEEEAAEWVKANM----NKPVV 231

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGS 299
           GF+ G TAPPG+ MGHAGA+ISGGKG A++KI  M+ AGI +A +PA +G ++++ L  
Sbjct: 232 GFIGGATAPPGKRMGHAGAIISGGKGTADEKIRTMEAAGIKVADTPAVMGETMIKALKE 290


>gi|310641534|ref|YP_003946292.1| succinyl-CoA ligase [ADP-forming] subunit alpha [Paenibacillus
           polymyxa SC2]
 gi|309246484|gb|ADO56051.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Paenibacillus
           polymyxa SC2]
          Length = 309

 Score =  333 bits (855), Expect = 1e-89,   Method: Composition-based stats.
 Identities = 175/304 (57%), Positives = 229/304 (75%), Gaps = 10/304 (3%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWT-----GGNVN 55
           MSILVDK+TKV+ QG+TGK   FH + A+ Y  TQ+VGG  P KG T        G  V 
Sbjct: 1   MSILVDKHTKVITQGITGKTALFHAKGALDY-GTQMVGGTSPGKGGTEVEITLENGQQVK 59

Query: 56  VPVFTTVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKA 115
           +PVF TV+EAKE T A ASVIYVPP+ A D+I+E+++AE+ L++CITEGIPVLDM++VK 
Sbjct: 60  LPVFNTVSEAKEATGATASVIYVPPAFAADSILEAVDAELDLVICITEGIPVLDMIKVKR 119

Query: 116 RLEKSSSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGL 175
            +E   + LIGPNCPG++TP  CKIGIMPG I   G VG++SRSGTLTYEAV Q +  G+
Sbjct: 120 FMEGKKTVLIGPNCPGVITPGECKIGIMPGYIHLPGHVGVVSRSGTLTYEAVHQLTTRGI 179

Query: 176 GQSTAVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGR 235
           GQS+AVGIGGDPVKG+EFID+L  F  D  T +++M+GEIGG+AEEEAA++++D      
Sbjct: 180 GQSSAVGIGGDPVKGSEFIDILHRFNEDPNTHAVIMIGEIGGTAEEEAAEWIRDNM---- 235

Query: 236 KKPIVGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVE 295
            KP+VGF+ G TAPPG+ MGHAGA+ISGGKG A++KI  ++  GI +AP+P+ +G +LV 
Sbjct: 236 TKPVVGFIGGVTAPPGKRMGHAGAIISGGKGTAKEKIATLEACGIKVAPTPSEMGSTLVS 295

Query: 296 LLGS 299
           +L +
Sbjct: 296 VLEA 299


>gi|310814642|ref|YP_003962606.1| succinyl-CoA synthetase (ADP-forming) alpha subunit
           [Ketogulonicigenium vulgare Y25]
 gi|308753377|gb|ADO41306.1| succinyl-CoA synthetase (ADP-forming) alpha subunit
           [Ketogulonicigenium vulgare Y25]
          Length = 294

 Score =  333 bits (855), Expect = 1e-89,   Method: Composition-based stats.
 Identities = 198/297 (66%), Positives = 242/297 (81%), Gaps = 5/297 (1%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           M+ILV+  T+V+ QG+TG  GTFH++QA+ Y  TQ+ GG+ P KG T   G    +PVF 
Sbjct: 1   MAILVNAQTRVICQGITGAQGTFHSQQALDY-GTQLAGGVTPGKGGTTHLG----LPVFN 55

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           TV EA  +T ANA+ IYVPP  A D+I+E+I+AE+PLIV ITEGIPVLDM+RVK  L  S
Sbjct: 56  TVHEAIAKTGANATAIYVPPPFAADSILEAIDAEVPLIVAITEGIPVLDMMRVKRALVGS 115

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
            SRLIGPNCPG+LTP++CKIGIMPGSIF  GSVG++SRSGTLTYEAV QT+  GLGQSTA
Sbjct: 116 KS