HHsearch alignment for GI: 254781055 and conserved domain: PTZ00052

>PTZ00052 thioredoxin reductase; Provisional.
Probab=100.00  E-value=0  Score=851.51  Aligned_cols=447  Identities=35%  Similarity=0.622  Sum_probs=408.6

Q ss_pred             CCCCCCEEEECCCHHHHHHHHHHHHCCCCEEEEE---------CCCCCEEEEEECCCCHHHHHHHHHHHHHHH-HHHCCC
Q ss_conf             9865468998898679999999998899299997---------787861464356827088999999999998-410177
Q gi|254781055|r    1 MRYEYDLVVIGAGSSGVRSARLAAQLGKKVAICE---------EYRVGGTCVIRGCIPKKLMFYASQYSEYFE-DSQGFG   70 (461)
Q Consensus         1 M~~~yDvvIIG~GpaG~~aA~~la~~g~kV~liE---------~~~~GGtC~~~GCiPsK~l~~~a~~~~~~~-~~~~~g   70 (461)
T Consensus        38 ~~~dYDvvVIG~GpgG~~AA~~Aa~~G~kValIE~~~~~~~~~k~~lGGtCln~GCIPSK~L~~aa~~~~~~~~~~~~~G  117 (541)
T PTZ00052         38 LTYDYDYVVIGGGPGGMASAKEAAAHGAKVLLFDYVKPSSQGTKWGIGGTCVNVGCVPKKLMHYAGLMGSSFKLDSQMYG  117 (541)
T ss_pred             CCCCCCEEEECCCHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCCCCCCCEEEECCHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             78779989999788999999999988990999942455666871779501178362899999999999999975688658


Q ss_pred             EECCCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCEEECCCCCCCCCCCCCCCCC-----CCCCEEEEEEEECCCCCEE
Q ss_conf             36377544999999999999985546688643003320012233222222222223-----2211001112322776402
Q gi|254781055|r   71 WSVDHKSFDWQSLITAQNKELSRLESFYHNRLESAGVEIFASKGILSSPHSVYIAN-----LNRTITSRYIVVSTGGSPN  145 (461)
Q Consensus        71 ~~~~~~~~d~~~~~~~~~~~~~~l~~~~~~~l~~~gv~vi~g~a~~~~~~~v~V~~-----~~~~i~a~~iiIATGs~p~  145 (461)
T Consensus       118 i~~~~~~~d~~~l~~~~~~~i~~l~~~~~~~l~~~~V~~i~G~a~f~~~~tV~v~~~~~~g~~~~i~a~~iIIATGS~P~  197 (541)
T PTZ00052        118 WKTSSLSHEWGKLVETVQSHIRSLNFSYRTGLRSSNVKYINGLAKLKDPHTVEYYLKGDNSQEETITSKYILIATGCRPH  197 (541)
T ss_pred             CCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEEEEEECCCEEEEEECCCCCCEEEEEEEEEEECCCCCCC
T ss_conf             32787631699999999999999888899888768968998589983698789984258885279995279985788876


Q ss_pred             EEE-ECCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCEECCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             332-0376-22112378511233334432123454530112442101221000001111222222321222222222223
Q gi|254781055|r  146 RMD-FKGS-DLCITSDEIFSLKSLPQSTLIIGGGYIAVEFAGILNSLGSKTTLVTRGNSILSKFDSDIRQGLTDVMISRG  223 (461)
Q Consensus       146 ~p~-i~g~-~~~~ts~~~~~l~~~P~~i~IiGgG~ig~E~A~~~~~lG~~Vtli~~~~~~l~~~d~~~~~~~~~~l~~~G  223 (461)
T Consensus       198 iP~~ipg~~~~~ltS~~~l~l~~lP~~lvIIGgG~IG~E~A~if~~lGs~VTi~~r-~~~L~~~D~di~~~l~~~l~~~G  276 (541)
T PTZ00052        198 IPEDVEGAIELSITSDDIFSLKKSPGKTLVVGASYVALECAGFLNSLGFDVTVAVR-SIVLRGFDRQCAEKVKEYMEEQG  276 (541)
T ss_pred             CCCCCCCCCCCCCCCHHHCCCCCCCCEEEEECCCHHHHHHHHHHHHCCCEEEEEEC-CCCCCCCCHHHHHHHHHHHHHCC
T ss_conf             78887767630206532206534896289989869999999999975985899953-77675657779999999998507


Q ss_pred             CCCCCCCEEEECCCCCCCCEEEEECCCCCCCCCCEECCCCEEEECCCCCCCCCCCCCCCC-CCCCCCCCCCCEEEEEEEC
Q ss_conf             323322000110244576102431275322221000015222001268411232112354-3344574300003558712
Q gi|254781055|r  224 MQVFHNDTIESVVSESGQLKSILKSGKIVKTDQVILAVGRTPRTTGIGLEKVGVKMDENG-FIITDCYSRTNVQSIFSLG  302 (461)
Q Consensus       224 v~i~~~~~v~~i~~~~~~~~~~~~~g~~~~~D~vl~a~Gr~Pn~~~l~L~~~gi~~~~~G-~i~vd~~~~Ts~~~IyA~G  302 (461)
T Consensus       277 V~i~~~~~v~~v~~~~~~~~v~~~dg~~~~~d~vLvA~GR~Pnt~~LgLe~~Gv~~~~~G~~i~~d~~~~Ts~p~IyAiG  356 (541)
T PTZ00052        277 VKFKVGVLPKKLEKVNDKIKVSFSDGTVELYDTVLYATGRKGDIKGLNLEALNVEVSKSGNKIIPKDLSCTNVPSIFAVG  356 (541)
T ss_pred             CEEECCEEEEEEEECCCEEEEEECCCCEEEEEEEEEECCCCCCCCCCCCHHCCEEECCCCCEEEEECCCCCCCCEEEEEC
T ss_conf             49974548999997398269997689478812899922655645777842206588789988951336667777399950


Q ss_pred             CCC-CCCCCCCHHHCCCCCCHHHHCCCCCCCCCCCCCCCCEEEHHHHHHHCCCHHHHHHCCC--CEEEEEEEECCCHHHH
Q ss_conf             543-2643100000011110122058875433233333312306887551689889985499--4799998303136687
Q gi|254781055|r  303 DIS-GHIQLTPVAIHAAACFVETVFKDNPTIPDYDLVPTAVFSKPEIASVGLTEEEAVQKFC--RLEIYKTKFFPMKCFL  379 (461)
Q Consensus       303 Dv~-g~~~l~~~A~~~g~~aa~~i~~~~~~~~~~~~ip~~ift~peiA~VG~te~~a~~~~~--~~~v~~~~~~~~~~~~  379 (461)
T Consensus       357 DV~~G~p~Lah~A~~eg~vaa~~i~~g~~~~~d~~~IP~vvfT~PEiA~VGlTEeeA~~~~~~~~v~v~~~~f~~~~~a~  436 (541)
T PTZ00052        357 DVAEGVPELAPVAIKAGEILARRLFKGSNEIMDYDFIPTTIYTPIEYGACGYSEEKAYEKYGESNVEVFLQEFNNLEISA  436 (541)
T ss_pred             CCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCEEEECCCCEEEEECCHHHHHHHCCCCCEEEEEEECCCHHHHH
T ss_conf             54689642489999999999999846999655658998599758962668899999997368887689876225501321


Q ss_pred             HCC---------------CCCEEEEEEE-ECCCCEEEEEEEECCCHHHHHHHHHHHHHCCCCHHHHHCCCCCCCCHHHHH
Q ss_conf             479---------------9840799999-789986999999819988999999999986798789963785477477899
Q gi|254781055|r  380 SKR---------------FEHTIMKIIV-HADNHKVLGVHILGHEASEIIQVLGVCLKAGCVKKDFDRCMAVHPTSSEEL  443 (461)
Q Consensus       380 ~~~---------------~~~g~~kli~-~~~~~~iLG~~~vg~~A~elI~~~~~ai~~~~t~~~l~~~~~~hPT~sE~l  443 (461)
T Consensus       437 ~~~~~~~~~~~~~~~~~~~~~g~~Kli~~~~~~~rILG~hivGp~AsELI~e~alAm~~g~t~~dla~tih~HPTlSEa~  516 (541)
T PTZ00052        437 VHREKHERAQKDEYDFDVSSTCLAKLVCLKSEDNRVVGFHYVGPNAGEVTQGMALALRLKATKKDFDDCIGIHPTDAESF  516 (541)
T ss_pred             CCHHHHHHHCCCCCCCCCCCCCEEEEEEEECCCCEEEEEEEECCCHHHHHHHHHHHHHCCCCHHHHHCCCCCCCCHHHHH
T ss_conf             00111011013432334456724999999289898999999869989999999999987999999931867799879999


Q ss_pred             HHHCC
Q ss_conf             87516
Q gi|254781055|r  444 VTMYN  448 (461)
Q Consensus       444 ~~~~~  448 (461)
T Consensus       517 ~~l~~  521 (541)
T PTZ00052        517 MNLEV  521 (541)
T ss_pred             HHCCC
T ss_conf             86786