HHsearch alignment for GI: 254781055 and conserved domain: TIGR02374

>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit; InterPro: IPR012744 This entry describes NirB, the large subunit of nitrite reductase [NAD(P)H] (the assimilatory nitrite reductase), which associates with NirD, the small subunit (IPR012748 from INTERPRO). In a few bacteria such as Klebsiella pneumoniae and in fungi, the two regions are fused.; GO: 0008942 nitrite reductase [NAD(P)H] activity, 0050660 FAD binding, 0050661 NADP binding, 0042128 nitrate assimilation.
Probab=100.00  E-value=1.4e-39  Score=309.58  Aligned_cols=360  Identities=17%  Similarity=0.269  Sum_probs=251.2

Q ss_pred             EEEECCCHHHHHHHHHH---H-HCCCCEEEEE-CCCCCEEEEEECCCCHHHHHHHHHHHHHHHHHHCCCEECCCCCCCHH
Q ss_conf             89988986799999999---9-8899299997-78786146435682708899999999999841017736377544999
Q gi|254781055|r    7 LVVIGAGSSGVRSARLA---A-QLGKKVAICE-EYRVGGTCVIRGCIPKKLMFYASQYSEYFEDSQGFGWSVDHKSFDWQ   81 (461)
Q Consensus         7 vvIIG~GpaG~~aA~~l---a-~~g~kV~liE-~~~~GGtC~~~GCiPsK~l~~~a~~~~~~~~~~~~g~~~~~~~~d~~   81 (461)
T Consensus         1 LvlvGnGM~G~R~iE~vl~~~~~~~f~Itvfg~EP~~-------------------~Y-------dRv~L---------S   45 (813)
T TIGR02374         1 LVLVGNGMVGHRLIEEVLKKDDKDEFEITVFGEEPHP-------------------AY-------DRVLL---------S   45 (813)
T ss_pred             CEEECCCCCCHHHHHHHHHHHHCCCCEEEEEECCCCC-------------------CC-------CCEEE---------C
T ss_conf             9787047410347776751210177308998258895-------------------43-------60221---------1


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCCEEECCCCCCCC--CCCCCCCCCCCCCEEEEEEEECCCCCEEEEEECCCCC--CCC
Q ss_conf             999999999985546688643003320012233222--2222222232211001112322776402332037622--112
Q gi|254781055|r   82 SLITAQNKELSRLESFYHNRLESAGVEIFASKGILS--SPHSVYIANLNRTITSRYIVVSTGGSPNRMDFKGSDL--CIT  157 (461)
Q Consensus        82 ~~~~~~~~~~~~l~~~~~~~l~~~gv~vi~g~a~~~--~~~~v~V~~~~~~i~a~~iiIATGs~p~~p~i~g~~~--~~t  157 (461)
T Consensus        46 s~l~G-~~~~~~l~L~~~D~y~~~~i~ly~ge~vi~id~~~k~v~t~a~r~~~YD~LilATGS~pfilPipG~D~~~v~~  124 (813)
T TIGR02374        46 SVLQG-EADLEDLTLNSKDWYEKHGIKLYTGERVIQIDREEKSVITDAGRTLSYDKLILATGSYPFILPIPGADKKGVYV  124 (813)
T ss_pred             EEECC-CCCHHHCCCCCCCCCCCCCEEEEECCEEEEEECCCCEEECCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCEEE
T ss_conf             01046-45577806687883122754898768889983576458704776335751787306657308668888886158


Q ss_pred             CCCCCCCCCC------CCCC------CCCCCCCCCCHHHHHHHCCCCCCCEECCCCCCCC-CCCCCCCCCCCCCCCCCCC
Q ss_conf             3785112333------3443------2123454530112442101221000001111222-2223212222222222233
Q gi|254781055|r  158 SDEIFSLKSL------PQST------LIIGGGYIAVEFAGILNSLGSKTTLVTRGNSILS-KFDSDIRQGLTDVMISRGM  224 (461)
Q Consensus       158 s~~~~~l~~~------P~~i------~IiGgG~ig~E~A~~~~~lG~~Vtli~~~~~~l~-~~d~~~~~~~~~~l~~~Gv  224 (461)
T Consensus       125 fRti~D~~A~~~~A~~~~~aGhtdGGaViGGGLLGLEAA~aL~~LG~~v~Vi~~~p~LM~~QLD~~aG~lL~~~le~~G~  204 (813)
T TIGR02374       125 FRTIEDLDAILAAAQRFKKAGHTDGGAVIGGGLLGLEAARALKNLGMDVSVIELAPFLMAKQLDQTAGRLLQRELEKKGL  204 (813)
T ss_pred             EECHHHHHHHHHHHHHHHCCCCCCCCEEECCCHHHHHHHHHHHHCCCEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             70567999999999863126766785588674158899999987797064467648989999999999999999985795


Q ss_pred             CCCC--CCEEEECCCCC---CCCEEEEECCCCCCCCCCEECCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEE
Q ss_conf             2332--20001102445---761024312753222210000152220012684112321123543344574300003558
Q gi|254781055|r  225 QVFH--NDTIESVVSES---GQLKSILKSGKIVKTDQVILAVGRTPRTTGIGLEKVGVKMDENGFIITDCYSRTNVQSIF  299 (461)
Q Consensus       225 ~i~~--~~~v~~i~~~~---~~~~~~~~~g~~~~~D~vl~a~Gr~Pn~~~l~L~~~gi~~~~~G~i~vd~~~~Ts~~~Iy  299 (461)
T Consensus       205 ~~l~Gt~k~t~eiv~~~d~~~~~~~rf~DG~~l~aDlvv~A~GirP~~~-L-A~~aGl~v~~RrGiivnd~~qTs~P~IY  282 (813)
T TIGR02374       205 TVLLGTEKDTVEIVGEDDVEKVERLRFKDGSSLEADLVVFAAGIRPRDE-L-AAEAGLKVNDRRGIIVNDSMQTSDPDIY  282 (813)
T ss_pred             EEEECCCCCEEEEEECCCHHHHCEEECCCCCEEEECEEEEECCCCCCHH-H-HHHCCCCCCCCCCEEECCCCCCCCCCEE
T ss_conf             7986176110576415640123122423897887037999515666368-9-9865973547676787262237888733


Q ss_pred             EECCCCCC----CCCCCHHHCCCCCCHHHHCCCCCCCCCCCCCCCCEEEHHHHHHHCCCHHHHHHCCCCEEE-EEEE-EC
Q ss_conf             71254326----431000000111101220588754332333333123068875516898899854994799-9983-03
Q gi|254781055|r  300 SLGDISGH----IQLTPVAIHAAACFVETVFKDNPTIPDYDLVPTAVFSKPEIASVGLTEEEAVQKFCRLEI-YKTK-FF  373 (461)
Q Consensus       300 A~GDv~g~----~~l~~~A~~~g~~aa~~i~~~~~~~~~~~~ip~~ift~peiA~VG~te~~a~~~~~~~~v-~~~~-~~  373 (461)
T Consensus       283 AvGEcA~~~G~~YGLVAPlY~~A~v~a~h~lG~~~~~y~-gs~LSa---------------~LK~~GvdV~S~Gd~~G~~  346 (813)
T TIGR02374       283 AVGECAEHNGRVYGLVAPLYEQAKVLADHILGVETEEYE-GSDLSA---------------KLKLLGVDVASAGDAQGET  346 (813)
T ss_pred             EEEEEEEECCEEEEECCCCHHHHHHHHHHHCCCCCCCCC-CCCHHH---------------HHHHCCEEEEEECCCCCCC
T ss_conf             566555108858971076147899999986489877676-765456---------------5403222455206544789


Q ss_pred             CCHHH-HHCCC-CCEEEEEEEECCCCEEEEEEEECCCHH--HHHHHHHHHH
Q ss_conf             13668-74799-840799999789986999999819988--9999999999
Q gi|254781055|r  374 PMKCF-LSKRF-EHTIMKIIVHADNHKVLGVHILGHEAS--EIIQVLGVCL  420 (461)
Q Consensus       374 ~~~~~-~~~~~-~~g~~kli~~~~~~~iLG~~~vg~~A~--elI~~~~~ai  420 (461)
T Consensus       347 e~~~~~~~~De~~~iYkk~vl~~d~~TL~GavL~GD~s~~~~L~~~v~k~~  397 (813)
T TIGR02374       347 EEAKSIKIYDEQKGIYKKLVLSDDKKTLLGAVLVGDTSDYGRLLDMVLKEA  397 (813)
T ss_pred             CCCEEEEEECCCCCEEEEEEEECCCCEEEEEEEEEECCCCCHHHHHHHHHH
T ss_conf             984068887266451567888448826887899863055425888865441