>TIGR03197 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouridine biosynthesis protein MnmC, C-terminal domain. In Escherichia coli, the protein previously designated YfcK is now identified as the bifunctional enzyme MnmC. It acts, following the action of the heterotetramer of GidA and MnmE, in the modification of U-34 of certain tRNA to 5-methylaminomethyl-2-thiouridine (mnm5s2U). In other bacterial, the corresponding proteins are usually but always found as a single polypeptide chain, but occasionally as the product of tandem genes. This model represents the C-terminal region of the multifunctional protein.

Probab=90.47 E-value=0.079 Score=32.31 Aligned_cols=53 Identities=17% Similarity=0.268 Sum_probs=42.8 Q ss_pred CCCCCCCCCCCCCCCCCCCCEEEECCCCCCCCEEEEECCCCCCCCCCEECCCCE Q ss_conf 122222222222332332200011024457610243127532222100001522 Q gi|254781055|r 211 IRQGLTDVMISRGMQVFHNDTIESVVSESGQLKSILKSGKIVKTDQVILAVGRT 264 (461) Q Consensus 211 ~~~~~~~~l~~~Gv~i~~~~~v~~i~~~~~~~~~~~~~g~~~~~D~vl~a~Gr~ 264 (461) T Consensus 137 ~~~al~~~a-~~g~~~~~~~~V~~i~~~g~~~~v~~~~g~~~~ad~vV~AaG~~ 189 (381) T TIGR03197 137 LCRALLAHA-GIRLTLHFNTEITSLERDGEGWQLLDANGEVIAASVVVLANGAQ 189 (381) T ss_pred HHHHHHHHH-HHCCEEEECCEEEEEEEECCEEEEEECCCCEEECCEEEECCCCC T ss_conf 999999999-72978993625899999599899998999889735589855420

HHsearch alignment for GI: 254781055 and conserved domain: TIGR03197